data_6YJL # _entry.id 6YJL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YJL pdb_00006yjl 10.2210/pdb6yjl/pdb WWPDB D_1292107742 ? ? BMRB 34512 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of the C-terminal arm of RSV nucleoprotein' _pdbx_database_related.db_id 34512 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6YJL _pdbx_database_status.recvd_initial_deposition_date 2020-04-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cardone, C.' 1 ? 'Eleouet, J.-F.' 2 ? 'Galloux, M.' 3 ? 'Sizun, C.' 4 0000-0002-5760-2614 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution NMR structure of the C-terminal arm of RSV nucleoprotein' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cardone, C.' 1 ? primary 'Eleouet, J.-F.' 2 ? primary 'Galloux, M.' 3 ? primary 'Sizun, C.' 4 0000-0002-5760-2614 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Nucleoprotein _entity.formula_weight 3627.982 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'Residues 361-391' # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein N,Nucleocapsid protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSGVINYSVLDLTAEELEAIKHQLNPKDNDVEL _entity_poly.pdbx_seq_one_letter_code_can GSGVINYSVLDLTAEELEAIKHQLNPKDNDVEL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 VAL n 1 5 ILE n 1 6 ASN n 1 7 TYR n 1 8 SER n 1 9 VAL n 1 10 LEU n 1 11 ASP n 1 12 LEU n 1 13 THR n 1 14 ALA n 1 15 GLU n 1 16 GLU n 1 17 LEU n 1 18 GLU n 1 19 ALA n 1 20 ILE n 1 21 LYS n 1 22 HIS n 1 23 GLN n 1 24 LEU n 1 25 ASN n 1 26 PRO n 1 27 LYS n 1 28 ASP n 1 29 ASN n 1 30 ASP n 1 31 VAL n 1 32 GLU n 1 33 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 33 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain A2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human respiratory syncytial virus A (strain A2)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11259 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pGEX-4T3 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCAP_HRSVA _struct_ref.pdbx_db_accession P03418 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GVINYSVLDLTAEELEAIKHQLNPKDNDVEL _struct_ref.pdbx_align_begin 361 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YJL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03418 _struct_ref_seq.db_align_beg 361 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 361 _struct_ref_seq.pdbx_auth_seq_align_end 391 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YJL GLY A 1 ? UNP P03418 ? ? 'expression tag' 359 1 1 6YJL SER A 2 ? UNP P03418 ? ? 'expression tag' 360 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HN(CO)CA' 1 isotropic 5 1 1 '3D HN(COCA)CB' 1 isotropic 8 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D HBHA(CO)NH' 1 isotropic 6 1 1 '3D HBHANH' 1 isotropic 11 1 1 '3D H(CCO)NH' 1 isotropic 10 1 1 '2D 1H-13C HSQC' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 133 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 15 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.2 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;20 mM unlabeled sodium phosphate, 100 mM unlabeled sodium chloride, 1 mM unlabeled TCEP, 1 mM [U-13C; U-15N] RSV_N_Carm, 93% H2O/7% D2O ; _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label 15N13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6YJL _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 6YJL _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6YJL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin 4.0 'Bruker Biospin' 2 'chemical shift assignment' 'CcpNmr Analysis' 2.4 CCPN 3 'peak picking' 'CcpNmr Analysis' 2.4 CCPN 4 'structure calculation' TALOS 4.21 'Cornilescu, Delaglio and Bax' 5 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YJL _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6YJL _struct.title 'Solution NMR structure of the C-terminal arm of RSV nucleoprotein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YJL _struct_keywords.text ;STRUCTURE FROM CYANA Nuclear Magnetic Resonance Respiratory Syncytial Virus Nucleoprotein Nucleocapsid RNA dependent RNA polymerase Peptide Intrinsically disordered region, VIRAL PROTEIN ; _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 371 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 381 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6YJL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 359 359 GLY GLY A . n A 1 2 SER 2 360 360 SER SER A . n A 1 3 GLY 3 361 361 GLY GLY A . n A 1 4 VAL 4 362 362 VAL VAL A . n A 1 5 ILE 5 363 363 ILE ILE A . n A 1 6 ASN 6 364 364 ASN ASN A . n A 1 7 TYR 7 365 365 TYR TYR A . n A 1 8 SER 8 366 366 SER SER A . n A 1 9 VAL 9 367 367 VAL VAL A . n A 1 10 LEU 10 368 368 LEU LEU A . n A 1 11 ASP 11 369 369 ASP ASP A . n A 1 12 LEU 12 370 370 LEU LEU A . n A 1 13 THR 13 371 371 THR THR A . n A 1 14 ALA 14 372 372 ALA ALA A . n A 1 15 GLU 15 373 373 GLU GLU A . n A 1 16 GLU 16 374 374 GLU GLU A . n A 1 17 LEU 17 375 375 LEU LEU A . n A 1 18 GLU 18 376 376 GLU GLU A . n A 1 19 ALA 19 377 377 ALA ALA A . n A 1 20 ILE 20 378 378 ILE ILE A . n A 1 21 LYS 21 379 379 LYS LYS A . n A 1 22 HIS 22 380 380 HIS HIS A . n A 1 23 GLN 23 381 381 GLN GLN A . n A 1 24 LEU 24 382 382 LEU LEU A . n A 1 25 ASN 25 383 383 ASN ASN A . n A 1 26 PRO 26 384 384 PRO PRO A . n A 1 27 LYS 27 385 385 LYS LYS A . n A 1 28 ASP 28 386 386 ASP ASP A . n A 1 29 ASN 29 387 387 ASN ASN A . n A 1 30 ASP 30 388 388 ASP ASP A . n A 1 31 VAL 31 389 389 VAL VAL A . n A 1 32 GLU 32 390 390 GLU GLU A . n A 1 33 LEU 33 391 391 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4040 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-14 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 20 ? mM unlabeled 1 'sodium chloride' 100 ? mM unlabeled 1 TCEP 1 ? mM unlabeled 1 RSV_N_Carm 1 ? mM '[U-13C; U-15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 383 ? ? 60.73 68.74 2 1 VAL A 389 ? ? 51.89 82.46 3 2 ILE A 363 ? ? 62.79 75.85 4 2 TYR A 365 ? ? -97.02 40.97 5 2 VAL A 367 ? ? -170.38 131.86 6 2 ASN A 383 ? ? 53.41 71.86 7 3 SER A 366 ? ? -113.24 69.77 8 3 LEU A 368 ? ? -106.22 61.07 9 3 ASN A 383 ? ? -154.92 71.28 10 4 SER A 360 ? ? -128.77 -61.84 11 4 ASP A 369 ? ? -105.37 70.79 12 4 ASN A 383 ? ? -174.13 70.20 13 4 PRO A 384 ? ? -69.84 80.32 14 5 ILE A 363 ? ? -104.96 42.86 15 5 ASP A 369 ? ? -112.20 62.88 16 6 ASN A 383 ? ? -118.43 68.97 17 6 PRO A 384 ? ? -69.80 -174.67 18 6 VAL A 389 ? ? -105.62 41.66 19 7 ASN A 364 ? ? -102.24 58.63 20 7 ASP A 369 ? ? -118.62 70.94 21 7 ASN A 383 ? ? 53.92 72.59 22 7 VAL A 389 ? ? -100.38 40.83 23 8 LEU A 368 ? ? -114.56 72.48 24 8 ASN A 383 ? ? 56.95 71.43 25 8 LYS A 385 ? ? -104.23 42.42 26 8 GLU A 390 ? ? -93.62 -60.44 27 9 ILE A 363 ? ? 60.11 77.63 28 9 PRO A 384 ? ? -69.78 96.10 29 10 ASN A 364 ? ? -106.16 49.84 30 10 VAL A 367 ? ? -117.35 77.58 31 10 ASN A 383 ? ? -155.91 69.03 32 10 PRO A 384 ? ? -69.80 79.44 33 11 GLN A 381 ? ? -173.56 139.66 34 11 ASN A 383 ? ? 61.20 71.12 35 11 LYS A 385 ? ? -130.55 -43.95 36 12 VAL A 367 ? ? -101.59 45.26 37 12 ASP A 369 ? ? -97.74 48.57 38 12 ASP A 388 ? ? -114.24 71.33 39 12 GLU A 390 ? ? -132.89 -47.14 40 13 VAL A 362 ? ? -173.44 145.17 41 13 ASN A 364 ? ? -170.07 -179.93 42 13 SER A 366 ? ? -161.21 117.55 43 13 LEU A 368 ? ? -103.29 52.38 44 14 ASP A 386 ? ? -108.21 43.93 45 15 ASP A 386 ? ? -102.00 72.18 46 16 ILE A 363 ? ? -105.16 -70.28 47 16 PRO A 384 ? ? -69.72 88.86 48 17 VAL A 367 ? ? -118.74 77.95 49 17 LYS A 385 ? ? -62.95 97.08 50 18 VAL A 367 ? ? -106.02 44.15 51 18 ASP A 369 ? ? -167.79 105.26 52 18 ASN A 383 ? ? 55.00 73.12 53 18 ASP A 388 ? ? -112.69 77.79 54 19 SER A 360 ? ? -62.04 -175.77 55 19 ASN A 383 ? ? -115.70 72.28 56 20 TYR A 365 ? ? -109.44 48.62 57 20 ASP A 369 ? ? -111.83 75.90 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #