data_6YLN # _entry.id 6YLN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YLN pdb_00006yln 10.2210/pdb6yln/pdb WWPDB D_1292106751 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-16 2 'Structure model' 1 1 2021-01-27 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YLN _pdbx_database_status.recvd_initial_deposition_date 2020-04-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Myskova, J.' 1 ? 'Rybakova, O.' 2 ? 'Brynda, J.' 3 ? 'Lazar, J.' 4 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 117 ? 32395 32401 'Directionality of light absorption and emission in representative fluorescent proteins.' 2020 ? 10.1073/pnas.2017379117 33273123 ? ? ? ? ? ? ? ? ? ? ? 1 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Directional optical properties of fluorescent proteins' ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Myskova, J.' 1 ? primary 'Rybakova, O.' 2 ? primary 'Brynda, J.' 3 ? primary 'Khoroshyy, P.' 4 ? primary 'Bondar, A.' 5 ? primary 'Lazar, J.' 6 ? 1 'Myskova, J.' 7 ? 1 'Lazar, J.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man EGFP 27700.178 1 ? ? ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 3 water nat water 18.015 65 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL(SWG)VQCFARYPDH MKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYFSDNVYITADKQ KNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELY KHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQCFARYPDHMK QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYFSDNVYITADKQKN GIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKH HHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LYS n 1 5 GLY n 1 6 GLU n 1 7 GLU n 1 8 LEU n 1 9 PHE n 1 10 THR n 1 11 GLY n 1 12 VAL n 1 13 VAL n 1 14 PRO n 1 15 ILE n 1 16 LEU n 1 17 VAL n 1 18 GLU n 1 19 LEU n 1 20 ASP n 1 21 GLY n 1 22 ASP n 1 23 VAL n 1 24 ASN n 1 25 GLY n 1 26 HIS n 1 27 LYS n 1 28 PHE n 1 29 SER n 1 30 VAL n 1 31 SER n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 ALA n 1 39 THR n 1 40 TYR n 1 41 GLY n 1 42 LYS n 1 43 LEU n 1 44 THR n 1 45 LEU n 1 46 LYS n 1 47 PHE n 1 48 ILE n 1 49 CYS n 1 50 THR n 1 51 THR n 1 52 GLY n 1 53 LYS n 1 54 LEU n 1 55 PRO n 1 56 VAL n 1 57 PRO n 1 58 TRP n 1 59 PRO n 1 60 THR n 1 61 LEU n 1 62 VAL n 1 63 THR n 1 64 THR n 1 65 LEU n 1 66 SWG n 1 67 VAL n 1 68 GLN n 1 69 CYS n 1 70 PHE n 1 71 ALA n 1 72 ARG n 1 73 TYR n 1 74 PRO n 1 75 ASP n 1 76 HIS n 1 77 MET n 1 78 LYS n 1 79 GLN n 1 80 HIS n 1 81 ASP n 1 82 PHE n 1 83 PHE n 1 84 LYS n 1 85 SER n 1 86 ALA n 1 87 MET n 1 88 PRO n 1 89 GLU n 1 90 GLY n 1 91 TYR n 1 92 VAL n 1 93 GLN n 1 94 GLU n 1 95 ARG n 1 96 THR n 1 97 ILE n 1 98 PHE n 1 99 PHE n 1 100 LYS n 1 101 ASP n 1 102 ASP n 1 103 GLY n 1 104 ASN n 1 105 TYR n 1 106 LYS n 1 107 THR n 1 108 ARG n 1 109 ALA n 1 110 GLU n 1 111 VAL n 1 112 LYS n 1 113 PHE n 1 114 GLU n 1 115 GLY n 1 116 ASP n 1 117 THR n 1 118 LEU n 1 119 VAL n 1 120 ASN n 1 121 ARG n 1 122 ILE n 1 123 GLU n 1 124 LEU n 1 125 LYS n 1 126 GLY n 1 127 ILE n 1 128 ASP n 1 129 PHE n 1 130 LYS n 1 131 GLU n 1 132 ASP n 1 133 GLY n 1 134 ASN n 1 135 ILE n 1 136 LEU n 1 137 GLY n 1 138 HIS n 1 139 LYS n 1 140 LEU n 1 141 GLU n 1 142 TYR n 1 143 ASN n 1 144 TYR n 1 145 PHE n 1 146 SER n 1 147 ASP n 1 148 ASN n 1 149 VAL n 1 150 TYR n 1 151 ILE n 1 152 THR n 1 153 ALA n 1 154 ASP n 1 155 LYS n 1 156 GLN n 1 157 LYS n 1 158 ASN n 1 159 GLY n 1 160 ILE n 1 161 LYS n 1 162 ALA n 1 163 ASN n 1 164 PHE n 1 165 LYS n 1 166 ILE n 1 167 ARG n 1 168 HIS n 1 169 ASN n 1 170 ILE n 1 171 GLU n 1 172 ASP n 1 173 GLY n 1 174 GLY n 1 175 VAL n 1 176 GLN n 1 177 LEU n 1 178 ALA n 1 179 ASP n 1 180 HIS n 1 181 TYR n 1 182 GLN n 1 183 GLN n 1 184 ASN n 1 185 THR n 1 186 PRO n 1 187 ILE n 1 188 GLY n 1 189 ASP n 1 190 GLY n 1 191 PRO n 1 192 VAL n 1 193 LEU n 1 194 LEU n 1 195 PRO n 1 196 ASP n 1 197 ASN n 1 198 HIS n 1 199 TYR n 1 200 LEU n 1 201 SER n 1 202 THR n 1 203 GLN n 1 204 SER n 1 205 ALA n 1 206 LEU n 1 207 SER n 1 208 LYS n 1 209 ASP n 1 210 PRO n 1 211 ASN n 1 212 GLU n 1 213 LYS n 1 214 ARG n 1 215 ASP n 1 216 HIS n 1 217 MET n 1 218 VAL n 1 219 LEU n 1 220 LEU n 1 221 GLU n 1 222 PHE n 1 223 VAL n 1 224 THR n 1 225 ALA n 1 226 ALA n 1 227 GLY n 1 228 ILE n 1 229 THR n 1 230 LEU n 1 231 GLY n 1 232 MET n 1 233 ASP n 1 234 GLU n 1 235 LEU n 1 236 TYR n 1 237 LYS n 1 238 HIS n 1 239 HIS n 1 240 HIS n 1 241 HIS n 1 242 HIS n 1 243 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 243 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EGFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vaccinia virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10245 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SWG 'L-peptide linking' n '2-[(4Z)-2-[(1R)-1-amino-2-hydroxy-ethyl]-4-(1H-indol-3-ylmethylidene)-5-oxo-imidazol-1-yl]ethanoic acid' ? 'C16 H16 N4 O4' 328.323 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 ? ? ? A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 GLY 5 4 4 GLY GLY A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 THR 10 9 9 THR THR A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 PRO 14 13 13 PRO PRO A . n A 1 15 ILE 15 14 14 ILE ILE A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 ASN 24 23 23 ASN ASN A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 THR 39 38 38 THR THR A . n A 1 40 TYR 40 39 39 TYR TYR A . n A 1 41 GLY 41 40 40 GLY GLY A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 CYS 49 48 48 CYS CYS A . n A 1 50 THR 50 49 49 THR THR A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 PRO 55 54 54 PRO PRO A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 PRO 57 56 56 PRO PRO A . n A 1 58 TRP 58 57 57 TRP TRP A . n A 1 59 PRO 59 58 58 PRO PRO A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 THR 63 62 62 THR THR A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 SWG 66 65 65 SWG SWG A . n A 1 67 VAL 67 68 68 VAL VAL A . n A 1 68 GLN 68 69 69 GLN GLN A . n A 1 69 CYS 69 70 70 CYS CYS A . n A 1 70 PHE 70 71 71 PHE PHE A . n A 1 71 ALA 71 72 72 ALA ALA A . n A 1 72 ARG 72 73 73 ARG ARG A . n A 1 73 TYR 73 74 74 TYR TYR A . n A 1 74 PRO 74 75 75 PRO PRO A . n A 1 75 ASP 75 76 76 ASP ASP A . n A 1 76 HIS 76 77 77 HIS HIS A . n A 1 77 MET 77 78 78 MET MET A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 GLN 79 80 80 GLN GLN A . n A 1 80 HIS 80 81 81 HIS HIS A . n A 1 81 ASP 81 82 82 ASP ASP A . n A 1 82 PHE 82 83 83 PHE PHE A . n A 1 83 PHE 83 84 84 PHE PHE A . n A 1 84 LYS 84 85 85 LYS LYS A . n A 1 85 SER 85 86 86 SER SER A . n A 1 86 ALA 86 87 87 ALA ALA A . n A 1 87 MET 87 88 88 MET MET A . n A 1 88 PRO 88 89 89 PRO PRO A . n A 1 89 GLU 89 90 90 GLU GLU A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 TYR 91 92 92 TYR TYR A . n A 1 92 VAL 92 93 93 VAL VAL A . n A 1 93 GLN 93 94 94 GLN GLN A . n A 1 94 GLU 94 95 95 GLU GLU A . n A 1 95 ARG 95 96 96 ARG ARG A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 ILE 97 98 98 ILE ILE A . n A 1 98 PHE 98 99 99 PHE PHE A . n A 1 99 PHE 99 100 100 PHE PHE A . n A 1 100 LYS 100 101 101 LYS LYS A . n A 1 101 ASP 101 102 102 ASP ASP A . n A 1 102 ASP 102 103 103 ASP ASP A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 ASN 104 105 105 ASN ASN A . n A 1 105 TYR 105 106 106 TYR TYR A . n A 1 106 LYS 106 107 107 LYS LYS A . n A 1 107 THR 107 108 108 THR THR A . n A 1 108 ARG 108 109 109 ARG ARG A . n A 1 109 ALA 109 110 110 ALA ALA A . n A 1 110 GLU 110 111 111 GLU GLU A . n A 1 111 VAL 111 112 112 VAL VAL A . n A 1 112 LYS 112 113 113 LYS LYS A . n A 1 113 PHE 113 114 114 PHE PHE A . n A 1 114 GLU 114 115 115 GLU GLU A . n A 1 115 GLY 115 116 116 GLY GLY A . n A 1 116 ASP 116 117 117 ASP ASP A . n A 1 117 THR 117 118 118 THR THR A . n A 1 118 LEU 118 119 119 LEU LEU A . n A 1 119 VAL 119 120 120 VAL VAL A . n A 1 120 ASN 120 121 121 ASN ASN A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 ILE 122 123 123 ILE ILE A . n A 1 123 GLU 123 124 124 GLU GLU A . n A 1 124 LEU 124 125 125 LEU LEU A . n A 1 125 LYS 125 126 126 LYS LYS A . n A 1 126 GLY 126 127 127 GLY GLY A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 PHE 129 130 130 PHE PHE A . n A 1 130 LYS 130 131 131 LYS LYS A . n A 1 131 GLU 131 132 132 GLU GLU A . n A 1 132 ASP 132 133 133 ASP ASP A . n A 1 133 GLY 133 134 134 GLY GLY A . n A 1 134 ASN 134 135 135 ASN ASN A . n A 1 135 ILE 135 136 136 ILE ILE A . n A 1 136 LEU 136 137 137 LEU LEU A . n A 1 137 GLY 137 138 138 GLY GLY A . n A 1 138 HIS 138 139 139 HIS HIS A . n A 1 139 LYS 139 140 140 LYS LYS A . n A 1 140 LEU 140 141 141 LEU LEU A . n A 1 141 GLU 141 142 142 GLU GLU A . n A 1 142 TYR 142 143 143 TYR TYR A . n A 1 143 ASN 143 144 144 ASN ASN A . n A 1 144 TYR 144 145 145 TYR TYR A . n A 1 145 PHE 145 146 146 PHE PHE A . n A 1 146 SER 146 147 147 SER SER A . n A 1 147 ASP 147 148 148 ASP ASP A . n A 1 148 ASN 148 149 149 ASN ASN A . n A 1 149 VAL 149 150 150 VAL VAL A . n A 1 150 TYR 150 151 151 TYR TYR A . n A 1 151 ILE 151 152 152 ILE ILE A . n A 1 152 THR 152 153 153 THR THR A . n A 1 153 ALA 153 154 154 ALA ALA A . n A 1 154 ASP 154 155 155 ASP ASP A . n A 1 155 LYS 155 156 156 LYS LYS A . n A 1 156 GLN 156 157 157 GLN GLN A . n A 1 157 LYS 157 158 158 LYS LYS A . n A 1 158 ASN 158 159 159 ASN ASN A . n A 1 159 GLY 159 160 160 GLY GLY A . n A 1 160 ILE 160 161 161 ILE ILE A . n A 1 161 LYS 161 162 162 LYS LYS A . n A 1 162 ALA 162 163 163 ALA ALA A . n A 1 163 ASN 163 164 164 ASN ASN A . n A 1 164 PHE 164 165 165 PHE PHE A . n A 1 165 LYS 165 166 166 LYS LYS A . n A 1 166 ILE 166 167 167 ILE ILE A . n A 1 167 ARG 167 168 168 ARG ARG A . n A 1 168 HIS 168 169 169 HIS HIS A . n A 1 169 ASN 169 170 170 ASN ASN A . n A 1 170 ILE 170 171 171 ILE ILE A . n A 1 171 GLU 171 172 172 GLU GLU A . n A 1 172 ASP 172 173 173 ASP ASP A . n A 1 173 GLY 173 174 174 GLY GLY A . n A 1 174 GLY 174 175 175 GLY GLY A . n A 1 175 VAL 175 176 176 VAL VAL A . n A 1 176 GLN 176 177 177 GLN GLN A . n A 1 177 LEU 177 178 178 LEU LEU A . n A 1 178 ALA 178 179 179 ALA ALA A . n A 1 179 ASP 179 180 180 ASP ASP A . n A 1 180 HIS 180 181 181 HIS HIS A . n A 1 181 TYR 181 182 182 TYR TYR A . n A 1 182 GLN 182 183 183 GLN GLN A . n A 1 183 GLN 183 184 184 GLN GLN A . n A 1 184 ASN 184 185 185 ASN ASN A . n A 1 185 THR 185 186 186 THR THR A . n A 1 186 PRO 186 187 187 PRO PRO A . n A 1 187 ILE 187 188 188 ILE ILE A . n A 1 188 GLY 188 189 189 GLY GLY A . n A 1 189 ASP 189 190 190 ASP ASP A . n A 1 190 GLY 190 191 191 GLY GLY A . n A 1 191 PRO 191 192 192 PRO PRO A . n A 1 192 VAL 192 193 193 VAL VAL A . n A 1 193 LEU 193 194 194 LEU LEU A . n A 1 194 LEU 194 195 195 LEU LEU A . n A 1 195 PRO 195 196 196 PRO PRO A . n A 1 196 ASP 196 197 197 ASP ASP A . n A 1 197 ASN 197 198 198 ASN ASN A . n A 1 198 HIS 198 199 199 HIS HIS A . n A 1 199 TYR 199 200 200 TYR TYR A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 SER 201 202 202 SER SER A . n A 1 202 THR 202 203 203 THR THR A . n A 1 203 GLN 203 204 204 GLN GLN A . n A 1 204 SER 204 205 205 SER SER A . n A 1 205 ALA 205 206 206 ALA ALA A . n A 1 206 LEU 206 207 207 LEU LEU A . n A 1 207 SER 207 208 208 SER SER A . n A 1 208 LYS 208 209 209 LYS LYS A . n A 1 209 ASP 209 210 210 ASP ASP A . n A 1 210 PRO 210 211 211 PRO PRO A . n A 1 211 ASN 211 212 212 ASN ASN A . n A 1 212 GLU 212 213 213 GLU GLU A . n A 1 213 LYS 213 214 214 LYS LYS A . n A 1 214 ARG 214 215 215 ARG ARG A . n A 1 215 ASP 215 216 216 ASP ASP A . n A 1 216 HIS 216 217 217 HIS HIS A . n A 1 217 MET 217 218 218 MET MET A . n A 1 218 VAL 218 219 219 VAL VAL A . n A 1 219 LEU 219 220 220 LEU LEU A . n A 1 220 LEU 220 221 221 LEU LEU A . n A 1 221 GLU 221 222 222 GLU GLU A . n A 1 222 PHE 222 223 223 PHE PHE A . n A 1 223 VAL 223 224 224 VAL VAL A . n A 1 224 THR 224 225 225 THR THR A . n A 1 225 ALA 225 226 226 ALA ALA A . n A 1 226 ALA 226 227 227 ALA ALA A . n A 1 227 GLY 227 228 228 GLY GLY A . n A 1 228 ILE 228 229 229 ILE ILE A . n A 1 229 THR 229 230 ? ? ? A . n A 1 230 LEU 230 231 ? ? ? A . n A 1 231 GLY 231 232 ? ? ? A . n A 1 232 MET 232 233 ? ? ? A . n A 1 233 ASP 233 234 ? ? ? A . n A 1 234 GLU 234 235 ? ? ? A . n A 1 235 LEU 235 236 ? ? ? A . n A 1 236 TYR 236 237 ? ? ? A . n A 1 237 LYS 237 238 ? ? ? A . n A 1 238 HIS 238 239 ? ? ? A . n A 1 239 HIS 239 240 ? ? ? A . n A 1 240 HIS 240 241 ? ? ? A . n A 1 241 HIS 241 242 ? ? ? A . n A 1 242 HIS 242 243 ? ? ? A . n A 1 243 HIS 243 244 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 301 1 K K A . C 3 HOH 1 401 29 HOH HOH A . C 3 HOH 2 402 65 HOH HOH A . C 3 HOH 3 403 47 HOH HOH A . C 3 HOH 4 404 23 HOH HOH A . C 3 HOH 5 405 48 HOH HOH A . C 3 HOH 6 406 18 HOH HOH A . C 3 HOH 7 407 16 HOH HOH A . C 3 HOH 8 408 60 HOH HOH A . C 3 HOH 9 409 50 HOH HOH A . C 3 HOH 10 410 66 HOH HOH A . C 3 HOH 11 411 57 HOH HOH A . C 3 HOH 12 412 49 HOH HOH A . C 3 HOH 13 413 3 HOH HOH A . C 3 HOH 14 414 7 HOH HOH A . C 3 HOH 15 415 26 HOH HOH A . C 3 HOH 16 416 32 HOH HOH A . C 3 HOH 17 417 11 HOH HOH A . C 3 HOH 18 418 39 HOH HOH A . C 3 HOH 19 419 21 HOH HOH A . C 3 HOH 20 420 30 HOH HOH A . C 3 HOH 21 421 22 HOH HOH A . C 3 HOH 22 422 37 HOH HOH A . C 3 HOH 23 423 54 HOH HOH A . C 3 HOH 24 424 24 HOH HOH A . C 3 HOH 25 425 6 HOH HOH A . C 3 HOH 26 426 59 HOH HOH A . C 3 HOH 27 427 61 HOH HOH A . C 3 HOH 28 428 33 HOH HOH A . C 3 HOH 29 429 8 HOH HOH A . C 3 HOH 30 430 45 HOH HOH A . C 3 HOH 31 431 51 HOH HOH A . C 3 HOH 32 432 67 HOH HOH A . C 3 HOH 33 433 41 HOH HOH A . C 3 HOH 34 434 9 HOH HOH A . C 3 HOH 35 435 13 HOH HOH A . C 3 HOH 36 436 58 HOH HOH A . C 3 HOH 37 437 4 HOH HOH A . C 3 HOH 38 438 64 HOH HOH A . C 3 HOH 39 439 19 HOH HOH A . C 3 HOH 40 440 34 HOH HOH A . C 3 HOH 41 441 44 HOH HOH A . C 3 HOH 42 442 10 HOH HOH A . C 3 HOH 43 443 14 HOH HOH A . C 3 HOH 44 444 63 HOH HOH A . C 3 HOH 45 445 43 HOH HOH A . C 3 HOH 46 446 15 HOH HOH A . C 3 HOH 47 447 2 HOH HOH A . C 3 HOH 48 448 17 HOH HOH A . C 3 HOH 49 449 20 HOH HOH A . C 3 HOH 50 450 52 HOH HOH A . C 3 HOH 51 451 1 HOH HOH A . C 3 HOH 52 452 53 HOH HOH A . C 3 HOH 53 453 31 HOH HOH A . C 3 HOH 54 454 40 HOH HOH A . C 3 HOH 55 455 62 HOH HOH A . C 3 HOH 56 456 28 HOH HOH A . C 3 HOH 57 457 42 HOH HOH A . C 3 HOH 58 458 56 HOH HOH A . C 3 HOH 59 459 55 HOH HOH A . C 3 HOH 60 460 27 HOH HOH A . C 3 HOH 61 461 38 HOH HOH A . C 3 HOH 62 462 25 HOH HOH A . C 3 HOH 63 463 35 HOH HOH A . C 3 HOH 64 464 46 HOH HOH A . C 3 HOH 65 465 36 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 3 ? CG ? A LYS 4 CG 2 1 Y 1 A LYS 3 ? CD ? A LYS 4 CD 3 1 Y 1 A LYS 3 ? CE ? A LYS 4 CE 4 1 Y 1 A LYS 3 ? NZ ? A LYS 4 NZ 5 1 Y 1 A GLU 6 ? CG ? A GLU 7 CG 6 1 Y 1 A GLU 6 ? CD ? A GLU 7 CD 7 1 Y 1 A GLU 6 ? OE1 ? A GLU 7 OE1 8 1 Y 1 A GLU 6 ? OE2 ? A GLU 7 OE2 9 1 Y 1 A LYS 79 ? CG ? A LYS 78 CG 10 1 Y 1 A LYS 79 ? CD ? A LYS 78 CD 11 1 Y 1 A LYS 79 ? CE ? A LYS 78 CE 12 1 Y 1 A LYS 79 ? NZ ? A LYS 78 NZ 13 1 Y 1 A LYS 156 ? CG ? A LYS 155 CG 14 1 Y 1 A LYS 156 ? CD ? A LYS 155 CD 15 1 Y 1 A LYS 156 ? CE ? A LYS 155 CE 16 1 Y 1 A LYS 156 ? NZ ? A LYS 155 NZ 17 1 Y 1 A GLU 172 ? CG ? A GLU 171 CG 18 1 Y 1 A GLU 172 ? CD ? A GLU 171 CD 19 1 Y 1 A GLU 172 ? OE1 ? A GLU 171 OE1 20 1 Y 1 A GLU 172 ? OE2 ? A GLU 171 OE2 21 1 Y 1 A ASP 173 ? CG ? A ASP 172 CG 22 1 Y 1 A ASP 173 ? OD1 ? A ASP 172 OD1 23 1 Y 1 A ASP 173 ? OD2 ? A ASP 172 OD2 24 1 Y 1 A ASP 190 ? CG ? A ASP 189 CG 25 1 Y 1 A ASP 190 ? OD1 ? A ASP 189 OD1 26 1 Y 1 A ASP 190 ? OD2 ? A ASP 189 OD2 27 1 Y 1 A LYS 214 ? CG ? A LYS 213 CG 28 1 Y 1 A LYS 214 ? CD ? A LYS 213 CD 29 1 Y 1 A LYS 214 ? CE ? A LYS 213 CE 30 1 Y 1 A LYS 214 ? NZ ? A LYS 213 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YLN _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.170 _cell.length_a_esd ? _cell.length_b 61.270 _cell.length_b_esd ? _cell.length_c 68.640 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YLN _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YLN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.01 _exptl_crystal.description ;A - long axis of crystal B, C - diagonal to the crystal faces ; _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 8000, HEPES, Magnesium chloride' _exptl_crystal_grow.pdbx_pH_range '8.0 - 8.5' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-07-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54187 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54187 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 38.631 _reflns.entry_id 6YLN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.850 _reflns.d_resolution_low 39.270 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18997 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.613 _reflns.pdbx_Rmerge_I_obs 0.052 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.510 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.078 _reflns.pdbx_scaling_rejects 366 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.053 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 239608 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.850 1.900 ? 0.950 ? 9363 1386 ? 1375 99.200 ? ? ? ? 1.906 ? ? ? ? ? ? ? ? 6.809 ? ? ? ? 2.058 ? ? 1 1 0.496 ? ? 1.900 1.950 ? 1.480 ? 9498 1340 ? 1340 100.000 ? ? ? ? 1.261 ? ? ? ? ? ? ? ? 7.088 ? ? ? ? 1.360 ? ? 2 1 0.666 ? ? 1.950 2.010 ? 1.930 ? 9637 1303 ? 1301 99.800 ? ? ? ? 0.967 ? ? ? ? ? ? ? ? 7.407 ? ? ? ? 1.039 ? ? 3 1 0.771 ? ? 2.010 2.070 ? 2.830 ? 10020 1271 ? 1271 100.000 ? ? ? ? 0.692 ? ? ? ? ? ? ? ? 7.884 ? ? ? ? 0.741 ? ? 4 1 0.838 ? ? 2.070 2.140 ? 3.860 ? 10928 1248 ? 1246 99.800 ? ? ? ? 0.545 ? ? ? ? ? ? ? ? 8.770 ? ? ? ? 0.578 ? ? 5 1 0.898 ? ? 2.140 2.210 ? 4.670 ? 11962 1204 ? 1204 100.000 ? ? ? ? 0.504 ? ? ? ? ? ? ? ? 9.935 ? ? ? ? 0.530 ? ? 6 1 0.939 ? ? 2.210 2.290 ? 6.560 ? 12479 1150 ? 1150 100.000 ? ? ? ? 0.388 ? ? ? ? ? ? ? ? 10.851 ? ? ? ? 0.407 ? ? 7 1 0.967 ? ? 2.290 2.390 ? 8.580 ? 12735 1109 ? 1109 100.000 ? ? ? ? 0.297 ? ? ? ? ? ? ? ? 11.483 ? ? ? ? 0.311 ? ? 8 1 0.981 ? ? 2.390 2.490 ? 11.810 ? 12620 1077 ? 1077 100.000 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 11.718 ? ? ? ? 0.234 ? ? 9 1 0.990 ? ? 2.490 2.620 ? 16.010 ? 12137 1021 ? 1021 100.000 ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 11.887 ? ? ? ? 0.172 ? ? 10 1 0.996 ? ? 2.620 2.760 ? 20.060 ? 11662 997 ? 997 100.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 11.697 ? ? ? ? 0.138 ? ? 11 1 0.996 ? ? 2.760 2.930 ? 28.130 ? 12093 927 ? 927 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 13.045 ? ? ? ? 0.098 ? ? 12 1 0.998 ? ? 2.930 3.130 ? 46.020 ? 15273 873 ? 873 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 17.495 ? ? ? ? 0.065 ? ? 13 1 0.999 ? ? 3.130 3.380 ? 65.060 ? 15588 827 ? 827 100.000 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 18.849 ? ? ? ? 0.048 ? ? 14 1 1.000 ? ? 3.380 3.700 ? 80.220 ? 15463 760 ? 760 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 20.346 ? ? ? ? 0.039 ? ? 15 1 1.000 ? ? 3.700 4.140 ? 103.800 ? 16413 692 ? 692 100.000 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 23.718 ? ? ? ? 0.032 ? ? 16 1 1.000 ? ? 4.140 4.780 ? 125.410 ? 14710 622 ? 622 100.000 ? ? ? ? 0.025 ? ? ? ? ? ? ? ? 23.650 ? ? ? ? 0.026 ? ? 17 1 1.000 ? ? 4.780 5.850 ? 122.500 ? 12205 530 ? 530 100.000 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 23.028 ? ? ? ? 0.028 ? ? 18 1 1.000 ? ? 5.850 8.270 ? 109.850 ? 9903 427 ? 427 100.000 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 23.192 ? ? ? ? 0.033 ? ? 19 1 1.000 ? ? 8.270 39.270 ? 128.930 ? 4919 254 ? 248 97.600 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 19.835 ? ? ? ? 0.024 ? ? 20 1 1.000 ? ? # _refine.aniso_B[1][1] -1.2600 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.0900 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 0.1700 _refine.B_iso_max 109.510 _refine.B_iso_mean 42.3720 _refine.B_iso_min 23.860 _refine.correlation_coeff_Fo_to_Fc 0.9700 _refine.correlation_coeff_Fo_to_Fc_free 0.9530 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YLN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8500 _refine.ls_d_res_low 39.2700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18046 _refine.ls_number_reflns_R_free 950 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8800 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1858 _refine.ls_R_factor_R_free 0.2179 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1840 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3ztf _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1450 _refine.pdbx_overall_ESU_R_Free 0.1310 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.9360 _refine.overall_SU_ML 0.1110 _refine.overall_SU_R_Cruickshank_DPI 0.1446 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8500 _refine_hist.d_res_low 39.2700 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1842 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 226 _refine_hist.pdbx_B_iso_mean_ligand 71.54 _refine_hist.pdbx_B_iso_mean_solvent 42.16 _refine_hist.pdbx_number_atoms_protein 1776 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 0.019 1832 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1689 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.711 1.963 2488 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.945 3.000 3886 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.436 5.000 227 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.922 25.114 88 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.266 15.000 293 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 8.449 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.109 0.200 269 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 2109 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 430 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.8500 _refine_ls_shell.d_res_low 1.8980 _refine_ls_shell.number_reflns_all 1367 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 68 _refine_ls_shell.number_reflns_R_work 1299 _refine_ls_shell.percent_reflns_obs 99.0600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3520 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3460 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YLN _struct.title 'mTurquoise2 SG P212121 - Directional optical properties of fluorescent proteins' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YLN _struct_keywords.text 'GFP, mTurquoise2, fluorescent protein' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1V0D974_9POXV _struct_ref.pdbx_db_accession A0A1V0D974 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YLN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1V0D974 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 239 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YLN SWG A 66 ? UNP A0A1V0D974 THR 66 chromophore 65 1 1 6YLN SWG A 66 ? UNP A0A1V0D974 TYR 67 chromophore 65 2 1 6YLN SWG A 66 ? UNP A0A1V0D974 GLY 68 chromophore 65 3 1 6YLN ALA A 71 ? UNP A0A1V0D974 SER 73 conflict 72 4 1 6YLN PHE A 145 ? UNP A0A1V0D974 ASN 147 conflict 146 5 1 6YLN ASP A 147 ? UNP A0A1V0D974 HIS 149 conflict 148 6 1 6YLN THR A 152 ? UNP A0A1V0D974 MET 154 conflict 153 7 1 6YLN GLY A 174 ? UNP A0A1V0D974 SER 176 conflict 175 8 1 6YLN HIS A 238 ? UNP A0A1V0D974 ? ? 'expression tag' 239 9 1 6YLN HIS A 239 ? UNP A0A1V0D974 ? ? 'expression tag' 240 10 1 6YLN HIS A 240 ? UNP A0A1V0D974 ? ? 'expression tag' 241 11 1 6YLN HIS A 241 ? UNP A0A1V0D974 ? ? 'expression tag' 242 12 1 6YLN HIS A 242 ? UNP A0A1V0D974 ? ? 'expression tag' 243 13 1 6YLN HIS A 243 ? UNP A0A1V0D974 ? ? 'expression tag' 244 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 240 ? 1 MORE 0 ? 1 'SSA (A^2)' 9780 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 4 ? THR A 10 ? LYS A 3 THR A 9 5 ? 7 HELX_P HELX_P2 AA2 PRO A 57 ? VAL A 62 ? PRO A 56 VAL A 61 5 ? 6 HELX_P HELX_P3 AA3 VAL A 67 ? ALA A 71 ? VAL A 68 ALA A 72 5 ? 5 HELX_P HELX_P4 AA4 PRO A 74 ? HIS A 80 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P5 AA5 ASP A 81 ? ALA A 86 ? ASP A 82 ALA A 87 1 ? 6 HELX_P HELX_P6 AA6 LYS A 155 ? ASN A 158 ? LYS A 156 ASN A 159 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 65 C ? ? ? 1_555 A SWG 66 N1 ? ? A LEU 64 A SWG 65 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A SWG 66 C3 ? ? ? 1_555 A VAL 67 N ? ? A SWG 65 A VAL 68 1_555 ? ? ? ? ? ? ? 1.329 ? ? metalc1 metalc ? ? A LEU 140 O ? ? ? 1_555 B K . K ? ? A LEU 141 A K 301 1_555 ? ? ? ? ? ? ? 3.105 ? ? metalc2 metalc ? ? B K . K ? ? ? 1_555 C HOH . O ? ? A K 301 A HOH 456 1_555 ? ? ? ? ? ? ? 3.164 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id LEU _pdbx_struct_conn_angle.ptnr1_label_seq_id 140 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id LEU _pdbx_struct_conn_angle.ptnr1_auth_seq_id 141 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id K _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id K _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id K _pdbx_struct_conn_angle.ptnr2_auth_seq_id 301 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id C _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 456 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 123.2 _pdbx_struct_conn_angle.value_esd ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 87 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 88 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.84 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 12 ? VAL A 23 ? VAL A 11 VAL A 22 AA1 2 HIS A 26 ? ASP A 37 ? HIS A 25 ASP A 36 AA1 3 LYS A 42 ? CYS A 49 ? LYS A 41 CYS A 48 AA1 4 HIS A 216 ? ALA A 226 ? HIS A 217 ALA A 227 AA1 5 HIS A 198 ? SER A 207 ? HIS A 199 SER A 208 AA1 6 TYR A 144 ? ASP A 154 ? TYR A 145 ASP A 155 AA1 7 GLY A 159 ? ASN A 169 ? GLY A 160 ASN A 170 AA1 8 VAL A 175 ? PRO A 186 ? VAL A 176 PRO A 187 AA1 9 TYR A 91 ? PHE A 99 ? TYR A 92 PHE A 100 AA1 10 ASN A 104 ? GLU A 114 ? ASN A 105 GLU A 115 AA1 11 THR A 117 ? ILE A 127 ? THR A 118 ILE A 128 AA1 12 VAL A 12 ? VAL A 23 ? VAL A 11 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 13 ? N VAL A 12 O GLY A 36 ? O GLY A 35 AA1 2 3 N SER A 31 ? N SER A 30 O ILE A 48 ? O ILE A 47 AA1 3 4 N LEU A 45 ? N LEU A 44 O LEU A 219 ? O LEU A 220 AA1 4 5 O THR A 224 ? O THR A 225 N SER A 201 ? N SER A 202 AA1 5 6 O SER A 204 ? O SER A 205 N PHE A 145 ? N PHE A 146 AA1 6 7 N THR A 152 ? N THR A 153 O LYS A 161 ? O LYS A 162 AA1 7 8 N PHE A 164 ? N PHE A 165 O HIS A 180 ? O HIS A 181 AA1 8 9 O ASP A 179 ? O ASP A 180 N PHE A 98 ? N PHE A 99 AA1 9 10 N ILE A 97 ? N ILE A 98 O TYR A 105 ? O TYR A 106 AA1 10 11 N LYS A 112 ? N LYS A 113 O VAL A 119 ? O VAL A 120 AA1 11 12 O LEU A 118 ? O LEU A 119 N PRO A 14 ? N PRO A 13 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id K _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'binding site for residue K A 301' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id LEU _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 140 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id LEU _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 141 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 136 ? ? -91.18 -66.69 2 1 ASN A 144 ? ? -154.73 -71.70 3 1 ASN A 144 ? ? -158.24 -65.55 4 1 TYR A 145 ? ? -171.28 139.61 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SWG 66 A SWG 65 ? THR chromophore 2 A SWG 66 A SWG 65 ? TYR chromophore 3 A SWG 66 A SWG 65 ? GLY chromophore # _pdbx_entry_details.entry_id 6YLN _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A VAL 1 ? A VAL 2 3 1 Y 1 A THR 230 ? A THR 229 4 1 Y 1 A LEU 231 ? A LEU 230 5 1 Y 1 A GLY 232 ? A GLY 231 6 1 Y 1 A MET 233 ? A MET 232 7 1 Y 1 A ASP 234 ? A ASP 233 8 1 Y 1 A GLU 235 ? A GLU 234 9 1 Y 1 A LEU 236 ? A LEU 235 10 1 Y 1 A TYR 237 ? A TYR 236 11 1 Y 1 A LYS 238 ? A LYS 237 12 1 Y 1 A HIS 239 ? A HIS 238 13 1 Y 1 A HIS 240 ? A HIS 239 14 1 Y 1 A HIS 241 ? A HIS 240 15 1 Y 1 A HIS 242 ? A HIS 241 16 1 Y 1 A HIS 243 ? A HIS 242 17 1 Y 1 A HIS 244 ? A HIS 243 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 K K K N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SWG CD2 C Y N 305 SWG CE3 C Y N 306 SWG CZ3 C Y N 307 SWG CH2 C Y N 308 SWG CZ2 C Y N 309 SWG CE2 C Y N 310 SWG NE1 N Y N 311 SWG CD1 C Y N 312 SWG CG C Y N 313 SWG CB2 C N N 314 SWG CA2 C N N 315 SWG N2 N N N 316 SWG C2 C N N 317 SWG O2 O N N 318 SWG N3 N N N 319 SWG CA3 C N N 320 SWG C3 C N N 321 SWG O3 O N N 322 SWG OXT O N N 323 SWG C1 C N N 324 SWG CA1 C N R 325 SWG N1 N N N 326 SWG CB1 C N N 327 SWG OG1 O N N 328 SWG HE3 H N N 329 SWG HZ3 H N N 330 SWG HH2 H N N 331 SWG HZ2 H N N 332 SWG HE1 H N N 333 SWG HD1 H N N 334 SWG HB2 H N N 335 SWG HA31 H N N 336 SWG HA32 H N N 337 SWG HXT H N N 338 SWG HA1 H N N 339 SWG H H N N 340 SWG H2 H N N 341 SWG HB11 H N N 342 SWG HB12 H N N 343 SWG HG1 H N N 344 THR N N N N 345 THR CA C N S 346 THR C C N N 347 THR O O N N 348 THR CB C N R 349 THR OG1 O N N 350 THR CG2 C N N 351 THR OXT O N N 352 THR H H N N 353 THR H2 H N N 354 THR HA H N N 355 THR HB H N N 356 THR HG1 H N N 357 THR HG21 H N N 358 THR HG22 H N N 359 THR HG23 H N N 360 THR HXT H N N 361 TRP N N N N 362 TRP CA C N S 363 TRP C C N N 364 TRP O O N N 365 TRP CB C N N 366 TRP CG C Y N 367 TRP CD1 C Y N 368 TRP CD2 C Y N 369 TRP NE1 N Y N 370 TRP CE2 C Y N 371 TRP CE3 C Y N 372 TRP CZ2 C Y N 373 TRP CZ3 C Y N 374 TRP CH2 C Y N 375 TRP OXT O N N 376 TRP H H N N 377 TRP H2 H N N 378 TRP HA H N N 379 TRP HB2 H N N 380 TRP HB3 H N N 381 TRP HD1 H N N 382 TRP HE1 H N N 383 TRP HE3 H N N 384 TRP HZ2 H N N 385 TRP HZ3 H N N 386 TRP HH2 H N N 387 TRP HXT H N N 388 TYR N N N N 389 TYR CA C N S 390 TYR C C N N 391 TYR O O N N 392 TYR CB C N N 393 TYR CG C Y N 394 TYR CD1 C Y N 395 TYR CD2 C Y N 396 TYR CE1 C Y N 397 TYR CE2 C Y N 398 TYR CZ C Y N 399 TYR OH O N N 400 TYR OXT O N N 401 TYR H H N N 402 TYR H2 H N N 403 TYR HA H N N 404 TYR HB2 H N N 405 TYR HB3 H N N 406 TYR HD1 H N N 407 TYR HD2 H N N 408 TYR HE1 H N N 409 TYR HE2 H N N 410 TYR HH H N N 411 TYR HXT H N N 412 VAL N N N N 413 VAL CA C N S 414 VAL C C N N 415 VAL O O N N 416 VAL CB C N N 417 VAL CG1 C N N 418 VAL CG2 C N N 419 VAL OXT O N N 420 VAL H H N N 421 VAL H2 H N N 422 VAL HA H N N 423 VAL HB H N N 424 VAL HG11 H N N 425 VAL HG12 H N N 426 VAL HG13 H N N 427 VAL HG21 H N N 428 VAL HG22 H N N 429 VAL HG23 H N N 430 VAL HXT H N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SWG CD2 CE3 sing Y N 290 SWG CD2 CE2 doub Y N 291 SWG CD2 CG sing Y N 292 SWG CE3 CZ3 doub Y N 293 SWG CZ3 CH2 sing Y N 294 SWG CH2 CZ2 doub Y N 295 SWG CZ2 CE2 sing Y N 296 SWG CE2 NE1 sing Y N 297 SWG NE1 CD1 sing Y N 298 SWG CD1 CG doub Y N 299 SWG CG CB2 sing N N 300 SWG CB2 CA2 doub N N 301 SWG CA2 N2 sing N N 302 SWG CA2 C2 sing N N 303 SWG N2 C1 doub N N 304 SWG C2 O2 doub N N 305 SWG C2 N3 sing N N 306 SWG N3 CA3 sing N Z 307 SWG N3 C1 sing N N 308 SWG CA3 C3 sing N N 309 SWG C3 O3 doub N N 310 SWG C3 OXT sing N N 311 SWG C1 CA1 sing N N 312 SWG CA1 N1 sing N N 313 SWG CA1 CB1 sing N N 314 SWG CB1 OG1 sing N N 315 SWG CE3 HE3 sing N N 316 SWG CZ3 HZ3 sing N N 317 SWG CH2 HH2 sing N N 318 SWG CZ2 HZ2 sing N N 319 SWG NE1 HE1 sing N N 320 SWG CD1 HD1 sing N N 321 SWG CB2 HB2 sing N N 322 SWG CA3 HA31 sing N N 323 SWG CA3 HA32 sing N N 324 SWG CA1 HA1 sing N N 325 SWG N1 H sing N N 326 SWG N1 H2 sing N N 327 SWG CB1 HB11 sing N N 328 SWG CB1 HB12 sing N N 329 SWG OG1 HG1 sing N N 330 SWG OXT HXT sing N N 331 THR N CA sing N N 332 THR N H sing N N 333 THR N H2 sing N N 334 THR CA C sing N N 335 THR CA CB sing N N 336 THR CA HA sing N N 337 THR C O doub N N 338 THR C OXT sing N N 339 THR CB OG1 sing N N 340 THR CB CG2 sing N N 341 THR CB HB sing N N 342 THR OG1 HG1 sing N N 343 THR CG2 HG21 sing N N 344 THR CG2 HG22 sing N N 345 THR CG2 HG23 sing N N 346 THR OXT HXT sing N N 347 TRP N CA sing N N 348 TRP N H sing N N 349 TRP N H2 sing N N 350 TRP CA C sing N N 351 TRP CA CB sing N N 352 TRP CA HA sing N N 353 TRP C O doub N N 354 TRP C OXT sing N N 355 TRP CB CG sing N N 356 TRP CB HB2 sing N N 357 TRP CB HB3 sing N N 358 TRP CG CD1 doub Y N 359 TRP CG CD2 sing Y N 360 TRP CD1 NE1 sing Y N 361 TRP CD1 HD1 sing N N 362 TRP CD2 CE2 doub Y N 363 TRP CD2 CE3 sing Y N 364 TRP NE1 CE2 sing Y N 365 TRP NE1 HE1 sing N N 366 TRP CE2 CZ2 sing Y N 367 TRP CE3 CZ3 doub Y N 368 TRP CE3 HE3 sing N N 369 TRP CZ2 CH2 doub Y N 370 TRP CZ2 HZ2 sing N N 371 TRP CZ3 CH2 sing Y N 372 TRP CZ3 HZ3 sing N N 373 TRP CH2 HH2 sing N N 374 TRP OXT HXT sing N N 375 TYR N CA sing N N 376 TYR N H sing N N 377 TYR N H2 sing N N 378 TYR CA C sing N N 379 TYR CA CB sing N N 380 TYR CA HA sing N N 381 TYR C O doub N N 382 TYR C OXT sing N N 383 TYR CB CG sing N N 384 TYR CB HB2 sing N N 385 TYR CB HB3 sing N N 386 TYR CG CD1 doub Y N 387 TYR CG CD2 sing Y N 388 TYR CD1 CE1 sing Y N 389 TYR CD1 HD1 sing N N 390 TYR CD2 CE2 doub Y N 391 TYR CD2 HD2 sing N N 392 TYR CE1 CZ doub Y N 393 TYR CE1 HE1 sing N N 394 TYR CE2 CZ sing Y N 395 TYR CE2 HE2 sing N N 396 TYR CZ OH sing N N 397 TYR OH HH sing N N 398 TYR OXT HXT sing N N 399 VAL N CA sing N N 400 VAL N H sing N N 401 VAL N H2 sing N N 402 VAL CA C sing N N 403 VAL CA CB sing N N 404 VAL CA HA sing N N 405 VAL C O doub N N 406 VAL C OXT sing N N 407 VAL CB CG1 sing N N 408 VAL CB CG2 sing N N 409 VAL CB HB sing N N 410 VAL CG1 HG11 sing N N 411 VAL CG1 HG12 sing N N 412 VAL CG1 HG13 sing N N 413 VAL CG2 HG21 sing N N 414 VAL CG2 HG22 sing N N 415 VAL CG2 HG23 sing N N 416 VAL OXT HXT sing N N 417 # _pdbx_audit_support.funding_organization 'Ministry of Education, Youth and Sports of the Czech Republic' _pdbx_audit_support.country 'Czech Republic' _pdbx_audit_support.grant_number CZ.02.1.01/0.0/0.0/16_019/0000729 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SWG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SWG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ZTF _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YLN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019543 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016321 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014569 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C K N O S # loop_