data_6ZSW # _entry.id 6ZSW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZSW pdb_00006zsw 10.2210/pdb6zsw/pdb WWPDB D_1292110026 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-28 2 'Structure model' 1 1 2021-11-17 3 'Structure model' 1 2 2022-01-19 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' diffrn_source 5 2 'Structure model' pdbx_database_proc 6 3 'Structure model' citation 7 3 'Structure model' citation_author 8 3 'Structure model' diffrn_source 9 4 'Structure model' chem_comp_atom 10 4 'Structure model' chem_comp_bond 11 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_database_2.pdbx_DOI' 10 2 'Structure model' '_database_2.pdbx_database_accession' 11 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation.year' 16 3 'Structure model' '_citation_author.identifier_ORCID' 17 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ZSW _pdbx_database_status.recvd_initial_deposition_date 2020-07-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II' 6Z2U unspecified PDB 'M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 2a conjugate' 6Z2Z unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tassone, G.' 1 0000-0002-2575-5528 'Pozzi, C.' 2 0000-0003-2574-3911 'Mangani, S.' 3 0000-0003-4824-7478 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first e202100449 _citation.page_last e202100449 _citation.title 'Xanthopsin-Like Systems via Site-Specific Click-Functionalization of a Retinoic Acid Binding Protein.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.202100449 _citation.pdbx_database_id_PubMed 34647400 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tassone, G.' 1 0000-0002-2575-5528 primary 'Paolino, M.' 2 ? primary 'Pozzi, C.' 3 0000-0003-2574-3911 primary 'Reale, A.' 4 0000-0001-6687-186X primary 'Salvini, L.' 5 ? primary 'Giorgi, G.' 6 0000-0002-8817-7745 primary 'Orlandini, M.' 7 0000-0002-6112-4889 primary 'Galvagni, F.' 8 0000-0003-1967-9554 primary 'Mangani, S.' 9 0000-0003-4824-7478 primary 'Yang, X.' 10 0000-0002-1500-1773 primary 'Carlotti, B.' 11 0000-0002-2980-2598 primary 'Ortica, F.' 12 0000-0001-8276-452X primary 'Latterini, L.' 13 0000-0002-1021-9423 primary 'Olivucci, M.' 14 0000-0002-8247-209X primary 'Cappelli, A.' 15 0000-0003-4140-3028 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cellular retinoic acid-binding protein 2' 15992.265 1 ? 'R111K, Y134F, T54V, R132Q, P39Y, R59Y' ? ? 2 non-polymer syn 'methyl (~{Z})-3-(4-hydroxyphenyl)-2-methyl-prop-2-enoate' 192.211 1 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cellular retinoic acid-binding protein II,CRABP-II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTV DGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTV DGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'methyl (~{Z})-3-(4-hydroxyphenyl)-2-methyl-prop-2-enoate' QPB 3 'ACETATE ION' ACT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 PRO n 1 6 ASN n 1 7 PHE n 1 8 SER n 1 9 GLY n 1 10 ASN n 1 11 TRP n 1 12 LYS n 1 13 ILE n 1 14 ILE n 1 15 ARG n 1 16 SER n 1 17 GLU n 1 18 ASN n 1 19 PHE n 1 20 GLU n 1 21 GLU n 1 22 LEU n 1 23 LEU n 1 24 LYS n 1 25 VAL n 1 26 LEU n 1 27 GLY n 1 28 VAL n 1 29 ASN n 1 30 VAL n 1 31 MET n 1 32 LEU n 1 33 ARG n 1 34 LYS n 1 35 ILE n 1 36 ALA n 1 37 VAL n 1 38 ALA n 1 39 ALA n 1 40 ALA n 1 41 SER n 1 42 LYS n 1 43 TYR n 1 44 ALA n 1 45 VAL n 1 46 GLU n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 GLU n 1 51 GLY n 1 52 ASP n 1 53 THR n 1 54 PHE n 1 55 TYR n 1 56 ILE n 1 57 LYS n 1 58 VAL n 1 59 SER n 1 60 THR n 1 61 THR n 1 62 VAL n 1 63 TYR n 1 64 THR n 1 65 THR n 1 66 GLU n 1 67 ILE n 1 68 ASN n 1 69 PHE n 1 70 LYS n 1 71 VAL n 1 72 GLY n 1 73 GLU n 1 74 GLU n 1 75 PHE n 1 76 GLU n 1 77 GLU n 1 78 GLN n 1 79 THR n 1 80 VAL n 1 81 ASP n 1 82 GLY n 1 83 ARG n 1 84 PRO n 1 85 CYS n 1 86 LYS n 1 87 SER n 1 88 LEU n 1 89 VAL n 1 90 LYS n 1 91 TRP n 1 92 GLU n 1 93 SER n 1 94 GLU n 1 95 ASN n 1 96 LYS n 1 97 MET n 1 98 VAL n 1 99 CYS n 1 100 GLU n 1 101 GLN n 1 102 LYS n 1 103 LEU n 1 104 LEU n 1 105 LYS n 1 106 GLY n 1 107 GLU n 1 108 GLY n 1 109 PRO n 1 110 LYS n 1 111 THR n 1 112 SER n 1 113 TRP n 1 114 THR n 1 115 LYS n 1 116 GLU n 1 117 LEU n 1 118 THR n 1 119 ASN n 1 120 ASP n 1 121 GLY n 1 122 GLU n 1 123 LEU n 1 124 ILE n 1 125 LEU n 1 126 THR n 1 127 MET n 1 128 THR n 1 129 ALA n 1 130 ASP n 1 131 ASP n 1 132 VAL n 1 133 VAL n 1 134 CYS n 1 135 THR n 1 136 GLN n 1 137 VAL n 1 138 PHE n 1 139 VAL n 1 140 ARG n 1 141 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 141 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CRABP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QPB non-polymer . 'methyl (~{Z})-3-(4-hydroxyphenyl)-2-methyl-prop-2-enoate' ? 'C11 H12 O3' 192.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 HIS 3 -1 ? ? ? A . n A 1 4 MET 4 0 0 MET MET A . n A 1 5 PRO 5 1 1 PRO PRO A . n A 1 6 ASN 6 2 2 ASN ASN A . n A 1 7 PHE 7 3 3 PHE PHE A . n A 1 8 SER 8 4 4 SER SER A . n A 1 9 GLY 9 5 5 GLY GLY A . n A 1 10 ASN 10 6 6 ASN ASN A . n A 1 11 TRP 11 7 7 TRP TRP A . n A 1 12 LYS 12 8 8 LYS LYS A . n A 1 13 ILE 13 9 9 ILE ILE A . n A 1 14 ILE 14 10 10 ILE ILE A . n A 1 15 ARG 15 11 11 ARG ARG A . n A 1 16 SER 16 12 12 SER SER A . n A 1 17 GLU 17 13 13 GLU GLU A . n A 1 18 ASN 18 14 14 ASN ASN A . n A 1 19 PHE 19 15 15 PHE PHE A . n A 1 20 GLU 20 16 16 GLU GLU A . n A 1 21 GLU 21 17 17 GLU GLU A . n A 1 22 LEU 22 18 18 LEU LEU A . n A 1 23 LEU 23 19 19 LEU LEU A . n A 1 24 LYS 24 20 20 LYS LYS A . n A 1 25 VAL 25 21 21 VAL VAL A . n A 1 26 LEU 26 22 22 LEU LEU A . n A 1 27 GLY 27 23 23 GLY GLY A . n A 1 28 VAL 28 24 24 VAL VAL A . n A 1 29 ASN 29 25 25 ASN ASN A . n A 1 30 VAL 30 26 26 VAL VAL A . n A 1 31 MET 31 27 27 MET MET A . n A 1 32 LEU 32 28 28 LEU LEU A . n A 1 33 ARG 33 29 29 ARG ARG A . n A 1 34 LYS 34 30 30 LYS LYS A . n A 1 35 ILE 35 31 31 ILE ILE A . n A 1 36 ALA 36 32 32 ALA ALA A . n A 1 37 VAL 37 33 33 VAL VAL A . n A 1 38 ALA 38 34 34 ALA ALA A . n A 1 39 ALA 39 35 35 ALA ALA A . n A 1 40 ALA 40 36 36 ALA ALA A . n A 1 41 SER 41 37 37 SER SER A . n A 1 42 LYS 42 38 38 LYS LYS A . n A 1 43 TYR 43 39 39 TYR TYR A . n A 1 44 ALA 44 40 40 ALA ALA A . n A 1 45 VAL 45 41 41 VAL VAL A . n A 1 46 GLU 46 42 42 GLU GLU A . n A 1 47 ILE 47 43 43 ILE ILE A . n A 1 48 LYS 48 44 44 LYS LYS A . n A 1 49 GLN 49 45 45 GLN GLN A . n A 1 50 GLU 50 46 46 GLU GLU A . n A 1 51 GLY 51 47 47 GLY GLY A . n A 1 52 ASP 52 48 48 ASP ASP A . n A 1 53 THR 53 49 49 THR THR A . n A 1 54 PHE 54 50 50 PHE PHE A . n A 1 55 TYR 55 51 51 TYR TYR A . n A 1 56 ILE 56 52 52 ILE ILE A . n A 1 57 LYS 57 53 53 LYS LYS A . n A 1 58 VAL 58 54 54 VAL VAL A . n A 1 59 SER 59 55 55 SER SER A . n A 1 60 THR 60 56 56 THR THR A . n A 1 61 THR 61 57 57 THR THR A . n A 1 62 VAL 62 58 58 VAL VAL A . n A 1 63 TYR 63 59 59 TYR TYR A . n A 1 64 THR 64 60 60 THR THR A . n A 1 65 THR 65 61 61 THR THR A . n A 1 66 GLU 66 62 62 GLU GLU A . n A 1 67 ILE 67 63 63 ILE ILE A . n A 1 68 ASN 68 64 64 ASN ASN A . n A 1 69 PHE 69 65 65 PHE PHE A . n A 1 70 LYS 70 66 66 LYS LYS A . n A 1 71 VAL 71 67 67 VAL VAL A . n A 1 72 GLY 72 68 68 GLY GLY A . n A 1 73 GLU 73 69 69 GLU GLU A . n A 1 74 GLU 74 70 70 GLU GLU A . n A 1 75 PHE 75 71 71 PHE PHE A . n A 1 76 GLU 76 72 72 GLU GLU A . n A 1 77 GLU 77 73 73 GLU GLU A . n A 1 78 GLN 78 74 74 GLN GLN A . n A 1 79 THR 79 75 75 THR THR A . n A 1 80 VAL 80 76 76 VAL VAL A . n A 1 81 ASP 81 77 77 ASP ASP A . n A 1 82 GLY 82 78 78 GLY GLY A . n A 1 83 ARG 83 79 79 ARG ARG A . n A 1 84 PRO 84 80 80 PRO PRO A . n A 1 85 CYS 85 81 81 CYS CYS A . n A 1 86 LYS 86 82 82 LYS LYS A . n A 1 87 SER 87 83 83 SER SER A . n A 1 88 LEU 88 84 84 LEU LEU A . n A 1 89 VAL 89 85 85 VAL VAL A . n A 1 90 LYS 90 86 86 LYS LYS A . n A 1 91 TRP 91 87 87 TRP TRP A . n A 1 92 GLU 92 88 88 GLU GLU A . n A 1 93 SER 93 89 89 SER SER A . n A 1 94 GLU 94 90 90 GLU GLU A . n A 1 95 ASN 95 91 91 ASN ASN A . n A 1 96 LYS 96 92 92 LYS LYS A . n A 1 97 MET 97 93 93 MET MET A . n A 1 98 VAL 98 94 94 VAL VAL A . n A 1 99 CYS 99 95 95 CYS CYS A . n A 1 100 GLU 100 96 96 GLU GLU A . n A 1 101 GLN 101 97 97 GLN GLN A . n A 1 102 LYS 102 98 98 LYS LYS A . n A 1 103 LEU 103 99 99 LEU LEU A . n A 1 104 LEU 104 100 100 LEU LEU A . n A 1 105 LYS 105 101 101 LYS LYS A . n A 1 106 GLY 106 102 102 GLY GLY A . n A 1 107 GLU 107 103 103 GLU GLU A . n A 1 108 GLY 108 104 104 GLY GLY A . n A 1 109 PRO 109 105 105 PRO PRO A . n A 1 110 LYS 110 106 106 LYS LYS A . n A 1 111 THR 111 107 107 THR THR A . n A 1 112 SER 112 108 108 SER SER A . n A 1 113 TRP 113 109 109 TRP TRP A . n A 1 114 THR 114 110 110 THR THR A . n A 1 115 LYS 115 111 111 LYS LYS A . n A 1 116 GLU 116 112 112 GLU GLU A . n A 1 117 LEU 117 113 113 LEU LEU A . n A 1 118 THR 118 114 114 THR THR A . n A 1 119 ASN 119 115 115 ASN ASN A . n A 1 120 ASP 120 116 116 ASP ASP A . n A 1 121 GLY 121 117 117 GLY GLY A . n A 1 122 GLU 122 118 118 GLU GLU A . n A 1 123 LEU 123 119 119 LEU LEU A . n A 1 124 ILE 124 120 120 ILE ILE A . n A 1 125 LEU 125 121 121 LEU LEU A . n A 1 126 THR 126 122 122 THR THR A . n A 1 127 MET 127 123 123 MET MET A . n A 1 128 THR 128 124 124 THR THR A . n A 1 129 ALA 129 125 125 ALA ALA A . n A 1 130 ASP 130 126 126 ASP ASP A . n A 1 131 ASP 131 127 127 ASP ASP A . n A 1 132 VAL 132 128 128 VAL VAL A . n A 1 133 VAL 133 129 129 VAL VAL A . n A 1 134 CYS 134 130 130 CYS CYS A . n A 1 135 THR 135 131 131 THR THR A . n A 1 136 GLN 136 132 132 GLN GLN A . n A 1 137 VAL 137 133 133 VAL VAL A . n A 1 138 PHE 138 134 134 PHE PHE A . n A 1 139 VAL 139 135 135 VAL VAL A . n A 1 140 ARG 140 136 136 ARG ARG A . n A 1 141 GLU 141 137 137 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QPB 1 201 201 QPB UNL A . C 3 ACT 1 202 501 ACT ACT A . D 4 HOH 1 301 41 HOH HOH A . D 4 HOH 2 302 32 HOH HOH A . D 4 HOH 3 303 18 HOH HOH A . D 4 HOH 4 304 9 HOH HOH A . D 4 HOH 5 305 14 HOH HOH A . D 4 HOH 6 306 20 HOH HOH A . D 4 HOH 7 307 17 HOH HOH A . D 4 HOH 8 308 37 HOH HOH A . D 4 HOH 9 309 34 HOH HOH A . D 4 HOH 10 310 13 HOH HOH A . D 4 HOH 11 311 36 HOH HOH A . D 4 HOH 12 312 15 HOH HOH A . D 4 HOH 13 313 43 HOH HOH A . D 4 HOH 14 314 59 HOH HOH A . D 4 HOH 15 315 44 HOH HOH A . D 4 HOH 16 316 26 HOH HOH A . D 4 HOH 17 317 10 HOH HOH A . D 4 HOH 18 318 24 HOH HOH A . D 4 HOH 19 319 42 HOH HOH A . D 4 HOH 20 320 38 HOH HOH A . D 4 HOH 21 321 33 HOH HOH A . D 4 HOH 22 322 30 HOH HOH A . D 4 HOH 23 323 54 HOH HOH A . D 4 HOH 24 324 55 HOH HOH A . D 4 HOH 25 325 58 HOH HOH A . D 4 HOH 26 326 8 HOH HOH A . D 4 HOH 27 327 11 HOH HOH A . D 4 HOH 28 328 47 HOH HOH A . D 4 HOH 29 329 7 HOH HOH A . D 4 HOH 30 330 3 HOH HOH A . D 4 HOH 31 331 35 HOH HOH A . D 4 HOH 32 332 40 HOH HOH A . D 4 HOH 33 333 61 HOH HOH A . D 4 HOH 34 334 53 HOH HOH A . D 4 HOH 35 335 57 HOH HOH A . D 4 HOH 36 336 49 HOH HOH A . D 4 HOH 37 337 50 HOH HOH A . D 4 HOH 38 338 60 HOH HOH A . D 4 HOH 39 339 64 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 8 ? CG ? A LYS 12 CG 2 1 Y 1 A LYS 8 ? CD ? A LYS 12 CD 3 1 Y 1 A LYS 8 ? CE ? A LYS 12 CE 4 1 Y 1 A LYS 8 ? NZ ? A LYS 12 NZ 5 1 Y 1 A LYS 38 ? CD ? A LYS 42 CD 6 1 Y 1 A LYS 38 ? CE ? A LYS 42 CE 7 1 Y 1 A LYS 38 ? NZ ? A LYS 42 NZ 8 1 Y 1 A LYS 44 ? CG ? A LYS 48 CG 9 1 Y 1 A LYS 44 ? CD ? A LYS 48 CD 10 1 Y 1 A LYS 44 ? CE ? A LYS 48 CE 11 1 Y 1 A LYS 44 ? NZ ? A LYS 48 NZ 12 1 Y 1 A GLU 46 ? CG ? A GLU 50 CG 13 1 Y 1 A GLU 46 ? CD ? A GLU 50 CD 14 1 Y 1 A GLU 46 ? OE1 ? A GLU 50 OE1 15 1 Y 1 A GLU 46 ? OE2 ? A GLU 50 OE2 16 1 Y 1 A LYS 53 ? NZ ? A LYS 57 NZ 17 1 Y 1 A LYS 66 ? NZ ? A LYS 70 NZ 18 1 Y 1 A GLN 74 ? CD ? A GLN 78 CD 19 1 Y 1 A GLN 74 ? OE1 ? A GLN 78 OE1 20 1 Y 1 A GLN 74 ? NE2 ? A GLN 78 NE2 21 1 Y 1 A LYS 82 ? CG ? A LYS 86 CG 22 1 Y 1 A LYS 82 ? CD ? A LYS 86 CD 23 1 Y 1 A LYS 82 ? CE ? A LYS 86 CE 24 1 Y 1 A LYS 82 ? NZ ? A LYS 86 NZ 25 1 Y 1 A GLU 96 ? CD ? A GLU 100 CD 26 1 Y 1 A GLU 96 ? OE1 ? A GLU 100 OE1 27 1 Y 1 A GLU 96 ? OE2 ? A GLU 100 OE2 28 1 Y 1 A LYS 98 ? CD ? A LYS 102 CD 29 1 Y 1 A LYS 98 ? CE ? A LYS 102 CE 30 1 Y 1 A LYS 98 ? NZ ? A LYS 102 NZ 31 1 Y 1 A LYS 101 ? CG ? A LYS 105 CG 32 1 Y 1 A LYS 101 ? CD ? A LYS 105 CD 33 1 Y 1 A LYS 101 ? CE ? A LYS 105 CE 34 1 Y 1 A LYS 101 ? NZ ? A LYS 105 NZ 35 1 Y 1 A GLU 103 ? CG ? A GLU 107 CG 36 1 Y 1 A GLU 103 ? CD ? A GLU 107 CD 37 1 Y 1 A GLU 103 ? OE1 ? A GLU 107 OE1 38 1 Y 1 A GLU 103 ? OE2 ? A GLU 107 OE2 39 1 Y 1 A LYS 106 ? CD ? A LYS 110 CD 40 1 Y 1 A LYS 106 ? CE ? A LYS 110 CE 41 1 Y 1 A LYS 106 ? NZ ? A LYS 110 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6ZSW _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.192 _cell.length_a_esd ? _cell.length_b 58.192 _cell.length_b_esd ? _cell.length_c 102.250 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZSW _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZSW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 281 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M sodium malonate pH 7 and 20 % w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-07-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976230 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976230 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 55.1 _reflns.entry_id 6ZSW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.08 _reflns.d_resolution_low 45.20 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12539 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_Rmerge_I_obs 0.031 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.034 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.08 _reflns_shell.d_res_low 2.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1774 _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.420 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.462 _reflns_shell.pdbx_Rpim_I_all 0.191 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.967 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.0000 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0100 _refine.B_iso_max 98.000 _refine.B_iso_mean 61.5090 _refine.B_iso_min 41.950 _refine.correlation_coeff_Fo_to_Fc 0.9640 _refine.correlation_coeff_Fo_to_Fc_free 0.9560 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ZSW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0800 _refine.ls_d_res_low 45.20 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11861 _refine.ls_number_reflns_R_free 648 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7100 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2079 _refine.ls_R_factor_R_free 0.2282 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2067 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4YFP _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1700 _refine.pdbx_overall_ESU_R_Free 0.1480 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.8790 _refine.overall_SU_ML 0.1270 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6ZSW _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.2985 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0800 _refine_hist.d_res_low 45.20 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1116 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 138 _refine_hist.pdbx_B_iso_mean_ligand 88.61 _refine_hist.pdbx_B_iso_mean_solvent 67.25 _refine_hist.pdbx_number_atoms_protein 1059 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 1094 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.763 1.653 1483 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.172 5.000 137 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.697 24.286 49 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.689 15.000 184 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.719 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.112 0.200 149 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 823 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0800 _refine_ls_shell.d_res_low 2.1340 _refine_ls_shell.number_reflns_all 893 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 54 _refine_ls_shell.number_reflns_R_work 839 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3140 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3040 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6ZSW _struct.title 'M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 6 conjugate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZSW _struct_keywords.text 'human cellular retinoic acid binding protein II, hCRABPII, conjigate, chromophore, M2, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RABP2_HUMAN _struct_ref.pdbx_db_accession P29373 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGR PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ZSW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 141 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29373 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6ZSW GLY A 1 ? UNP P29373 ? ? 'expression tag' -3 1 1 6ZSW SER A 2 ? UNP P29373 ? ? 'expression tag' -2 2 1 6ZSW HIS A 3 ? UNP P29373 ? ? 'expression tag' -1 3 1 6ZSW TYR A 43 ? UNP P29373 PRO 40 'engineered mutation' 39 4 1 6ZSW VAL A 58 ? UNP P29373 THR 55 'engineered mutation' 54 5 1 6ZSW TYR A 63 ? UNP P29373 ARG 60 'engineered mutation' 59 6 1 6ZSW LYS A 115 ? UNP P29373 ARG 112 'engineered mutation' 111 7 1 6ZSW GLN A 136 ? UNP P29373 ARG 133 'engineered mutation' 132 8 1 6ZSW PHE A 138 ? UNP P29373 TYR 135 'engineered mutation' 134 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 170 ? 1 MORE -0 ? 1 'SSA (A^2)' 7650 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 18 ? LEU A 26 ? ASN A 14 LEU A 22 1 ? 9 HELX_P HELX_P2 AA2 ASN A 29 ? SER A 41 ? ASN A 25 SER A 37 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 115 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id QPB _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CAJ _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 111 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id QPB _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.422 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 64 ? LYS A 70 ? THR A 60 LYS A 66 AA1 2 THR A 53 ? SER A 59 ? THR A 49 SER A 55 AA1 3 ALA A 44 ? GLU A 50 ? ALA A 40 GLU A 46 AA1 4 GLY A 9 ? GLU A 17 ? GLY A 5 GLU A 13 AA1 5 VAL A 132 ? ARG A 140 ? VAL A 128 ARG A 136 AA1 6 LEU A 123 ? ALA A 129 ? LEU A 119 ALA A 125 AA1 7 THR A 111 ? LEU A 117 ? THR A 107 LEU A 113 AA1 8 LYS A 96 ? LEU A 103 ? LYS A 92 LEU A 99 AA1 9 PRO A 84 ? SER A 93 ? PRO A 80 SER A 89 AA1 10 PHE A 75 ? GLN A 78 ? PHE A 71 GLN A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 67 ? O ILE A 63 N ILE A 56 ? N ILE A 52 AA1 2 3 O LYS A 57 ? O LYS A 53 N GLU A 46 ? N GLU A 42 AA1 3 4 O VAL A 45 ? O VAL A 41 N TRP A 11 ? N TRP A 7 AA1 4 5 N ILE A 14 ? N ILE A 10 O VAL A 137 ? O VAL A 133 AA1 5 6 O CYS A 134 ? O CYS A 130 N MET A 127 ? N MET A 123 AA1 6 7 O ILE A 124 ? O ILE A 120 N GLU A 116 ? N GLU A 112 AA1 7 8 O TRP A 113 ? O TRP A 109 N CYS A 99 ? N CYS A 95 AA1 8 9 O LYS A 102 ? O LYS A 98 N LYS A 86 ? N LYS A 82 AA1 9 10 O SER A 87 ? O SER A 83 N PHE A 75 ? N PHE A 71 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A QPB 201 ? 6 'binding site for residue QPB A 201' AC2 Software A ACT 202 ? 2 'binding site for residue ACT A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 TYR A 43 ? TYR A 39 . ? 1_555 ? 2 AC1 6 VAL A 58 ? VAL A 54 . ? 1_555 ? 3 AC1 6 TRP A 113 ? TRP A 109 . ? 1_555 ? 4 AC1 6 LYS A 115 ? LYS A 111 . ? 1_555 ? 5 AC1 6 LEU A 125 ? LEU A 121 . ? 1_555 ? 6 AC1 6 GLN A 136 ? GLN A 132 . ? 1_555 ? 7 AC2 2 ASN A 68 ? ASN A 64 . ? 1_555 ? 8 AC2 2 GLU A 73 ? GLU A 69 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 2 ? ? -144.42 -149.11 2 1 THR A 56 ? ? -118.20 -166.60 3 1 ASP A 77 ? ? -98.92 32.55 4 1 SER A 89 ? ? -170.47 -167.78 5 1 ASP A 126 ? ? 53.15 -115.84 # _pdbx_entry_details.entry_id 6ZSW _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 339 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.19 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A HIS -1 ? A HIS 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 QPB CAN C N N 297 QPB OAM O N N 298 QPB CAK C N N 299 QPB OAL O N N 300 QPB CAI C N N 301 QPB CAJ C N N 302 QPB CAH C N N 303 QPB CAD C Y N 304 QPB CAC C Y N 305 QPB CAA C Y N 306 QPB CAB C Y N 307 QPB OAG O N N 308 QPB CAF C Y N 309 QPB CAE C Y N 310 QPB H1 H N N 311 QPB H2 H N N 312 QPB H3 H N N 313 QPB H4 H N N 314 QPB H5 H N N 315 QPB H6 H N N 316 QPB H7 H N N 317 QPB H8 H N N 318 QPB H9 H N N 319 QPB H10 H N N 320 QPB H11 H N N 321 QPB H12 H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 QPB OAG CAB sing N N 283 QPB CAB CAF doub Y N 284 QPB CAB CAA sing Y N 285 QPB CAF CAE sing Y N 286 QPB CAA CAC doub Y N 287 QPB CAE CAD doub Y N 288 QPB CAC CAD sing Y N 289 QPB CAD CAH sing N N 290 QPB CAN OAM sing N N 291 QPB OAM CAK sing N N 292 QPB CAH CAI doub N Z 293 QPB CAK CAI sing N N 294 QPB CAK OAL doub N N 295 QPB CAI CAJ sing N N 296 QPB CAN H1 sing N N 297 QPB CAN H2 sing N N 298 QPB CAN H3 sing N N 299 QPB CAJ H4 sing N N 300 QPB CAJ H5 sing N N 301 QPB CAJ H6 sing N N 302 QPB CAH H7 sing N N 303 QPB CAC H8 sing N N 304 QPB CAA H9 sing N N 305 QPB OAG H10 sing N N 306 QPB CAF H11 sing N N 307 QPB CAE H12 sing N N 308 SER N CA sing N N 309 SER N H sing N N 310 SER N H2 sing N N 311 SER CA C sing N N 312 SER CA CB sing N N 313 SER CA HA sing N N 314 SER C O doub N N 315 SER C OXT sing N N 316 SER CB OG sing N N 317 SER CB HB2 sing N N 318 SER CB HB3 sing N N 319 SER OG HG sing N N 320 SER OXT HXT sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TRP N CA sing N N 338 TRP N H sing N N 339 TRP N H2 sing N N 340 TRP CA C sing N N 341 TRP CA CB sing N N 342 TRP CA HA sing N N 343 TRP C O doub N N 344 TRP C OXT sing N N 345 TRP CB CG sing N N 346 TRP CB HB2 sing N N 347 TRP CB HB3 sing N N 348 TRP CG CD1 doub Y N 349 TRP CG CD2 sing Y N 350 TRP CD1 NE1 sing Y N 351 TRP CD1 HD1 sing N N 352 TRP CD2 CE2 doub Y N 353 TRP CD2 CE3 sing Y N 354 TRP NE1 CE2 sing Y N 355 TRP NE1 HE1 sing N N 356 TRP CE2 CZ2 sing Y N 357 TRP CE3 CZ3 doub Y N 358 TRP CE3 HE3 sing N N 359 TRP CZ2 CH2 doub Y N 360 TRP CZ2 HZ2 sing N N 361 TRP CZ3 CH2 sing Y N 362 TRP CZ3 HZ3 sing N N 363 TRP CH2 HH2 sing N N 364 TRP OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QPB _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QPB _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4YFP _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6ZSW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017184 _atom_sites.fract_transf_matrix[1][2] 0.009921 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019843 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009780 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_