data_6ZU8 # _entry.id 6ZU8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZU8 pdb_00006zu8 10.2210/pdb6zu8/pdb WWPDB D_1292110190 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-05 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ZU8 _pdbx_database_status.recvd_initial_deposition_date 2020-07-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Newman, J.A.' 1 ? 'Gavard, A.E.' 2 ? 'Shrestha, L.' 3 ? 'Burgess-Brown, N.A.' 4 ? 'von Delft, F.' 5 ? 'Arrowsmith, C.H.' 6 ? 'Edwards, A.' 7 ? 'Bountra, C.' 8 ? 'Gileadi, O.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of human Brachyury G177D variant in complex with Afatinib' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Newman, J.A.' 1 ? primary 'Gavard, A.E.' 2 ? primary 'Shrestha, L.' 3 ? primary 'Burgess-Brown, N.A.' 4 ? primary 'von Delft, F.' 5 ? primary 'Arrowsmith, C.H.' 6 ? primary 'Edwards, A.' 7 ? primary 'Bountra, C.' 8 ? primary 'Gileadi, O.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Brachyury protein' 22080.395 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'N-{4-[(3-chloro-4-fluorophenyl)amino]-7-[(3S)-tetrahydrofuran-3-yloxy]quinazolin-6-yl}-4-(dimethylamino)butanamide' 487.954 1 ? ? ? ? 4 water nat water 18.015 73 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein T' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQ APSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGDPQRMITSHCFPETQFIAVTAY QNEEITALKIKYNPFAKAFLDAKERSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQ APSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGDPQRMITSHCFPETQFIAVTAY QNEEITALKIKYNPFAKAFLDAKERSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'N-{4-[(3-chloro-4-fluorophenyl)amino]-7-[(3S)-tetrahydrofuran-3-yloxy]quinazolin-6-yl}-4-(dimethylamino)butanamide' 0WN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLU n 1 4 LEU n 1 5 ARG n 1 6 VAL n 1 7 GLY n 1 8 LEU n 1 9 GLU n 1 10 GLU n 1 11 SER n 1 12 GLU n 1 13 LEU n 1 14 TRP n 1 15 LEU n 1 16 ARG n 1 17 PHE n 1 18 LYS n 1 19 GLU n 1 20 LEU n 1 21 THR n 1 22 ASN n 1 23 GLU n 1 24 MET n 1 25 ILE n 1 26 VAL n 1 27 THR n 1 28 LYS n 1 29 ASN n 1 30 GLY n 1 31 ARG n 1 32 ARG n 1 33 MET n 1 34 PHE n 1 35 PRO n 1 36 VAL n 1 37 LEU n 1 38 LYS n 1 39 VAL n 1 40 ASN n 1 41 VAL n 1 42 SER n 1 43 GLY n 1 44 LEU n 1 45 ASP n 1 46 PRO n 1 47 ASN n 1 48 ALA n 1 49 MET n 1 50 TYR n 1 51 SER n 1 52 PHE n 1 53 LEU n 1 54 LEU n 1 55 ASP n 1 56 PHE n 1 57 VAL n 1 58 ALA n 1 59 ALA n 1 60 ASP n 1 61 ASN n 1 62 HIS n 1 63 ARG n 1 64 TRP n 1 65 LYS n 1 66 TYR n 1 67 VAL n 1 68 ASN n 1 69 GLY n 1 70 GLU n 1 71 TRP n 1 72 VAL n 1 73 PRO n 1 74 GLY n 1 75 GLY n 1 76 LYS n 1 77 PRO n 1 78 GLU n 1 79 PRO n 1 80 GLN n 1 81 ALA n 1 82 PRO n 1 83 SER n 1 84 CYS n 1 85 VAL n 1 86 TYR n 1 87 ILE n 1 88 HIS n 1 89 PRO n 1 90 ASP n 1 91 SER n 1 92 PRO n 1 93 ASN n 1 94 PHE n 1 95 GLY n 1 96 ALA n 1 97 HIS n 1 98 TRP n 1 99 MET n 1 100 LYS n 1 101 ALA n 1 102 PRO n 1 103 VAL n 1 104 SER n 1 105 PHE n 1 106 SER n 1 107 LYS n 1 108 VAL n 1 109 LYS n 1 110 LEU n 1 111 THR n 1 112 ASN n 1 113 LYS n 1 114 LEU n 1 115 ASN n 1 116 GLY n 1 117 GLY n 1 118 GLY n 1 119 GLN n 1 120 ILE n 1 121 MET n 1 122 LEU n 1 123 ASN n 1 124 SER n 1 125 LEU n 1 126 HIS n 1 127 LYS n 1 128 TYR n 1 129 GLU n 1 130 PRO n 1 131 ARG n 1 132 ILE n 1 133 HIS n 1 134 ILE n 1 135 VAL n 1 136 ARG n 1 137 VAL n 1 138 GLY n 1 139 ASP n 1 140 PRO n 1 141 GLN n 1 142 ARG n 1 143 MET n 1 144 ILE n 1 145 THR n 1 146 SER n 1 147 HIS n 1 148 CYS n 1 149 PHE n 1 150 PRO n 1 151 GLU n 1 152 THR n 1 153 GLN n 1 154 PHE n 1 155 ILE n 1 156 ALA n 1 157 VAL n 1 158 THR n 1 159 ALA n 1 160 TYR n 1 161 GLN n 1 162 ASN n 1 163 GLU n 1 164 GLU n 1 165 ILE n 1 166 THR n 1 167 ALA n 1 168 LEU n 1 169 LYS n 1 170 ILE n 1 171 LYS n 1 172 TYR n 1 173 ASN n 1 174 PRO n 1 175 PHE n 1 176 ALA n 1 177 LYS n 1 178 ALA n 1 179 PHE n 1 180 LEU n 1 181 ASP n 1 182 ALA n 1 183 LYS n 1 184 GLU n 1 185 ARG n 1 186 SER n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n 1 191 HIS n 1 192 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0WN non-polymer . 'N-{4-[(3-chloro-4-fluorophenyl)amino]-7-[(3S)-tetrahydrofuran-3-yloxy]quinazolin-6-yl}-4-(dimethylamino)butanamide' 'Afatinib, bound form' 'C24 H27 Cl F N5 O3' 487.954 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 39 ? ? ? A . n A 1 2 GLY 2 40 ? ? ? A . n A 1 3 GLU 3 41 41 GLU GLU A . n A 1 4 LEU 4 42 42 LEU LEU A . n A 1 5 ARG 5 43 43 ARG ARG A . n A 1 6 VAL 6 44 44 VAL VAL A . n A 1 7 GLY 7 45 45 GLY GLY A . n A 1 8 LEU 8 46 46 LEU LEU A . n A 1 9 GLU 9 47 47 GLU GLU A . n A 1 10 GLU 10 48 48 GLU GLU A . n A 1 11 SER 11 49 49 SER SER A . n A 1 12 GLU 12 50 50 GLU GLU A . n A 1 13 LEU 13 51 51 LEU LEU A . n A 1 14 TRP 14 52 52 TRP TRP A . n A 1 15 LEU 15 53 53 LEU LEU A . n A 1 16 ARG 16 54 54 ARG ARG A . n A 1 17 PHE 17 55 55 PHE PHE A . n A 1 18 LYS 18 56 56 LYS LYS A . n A 1 19 GLU 19 57 57 GLU GLU A . n A 1 20 LEU 20 58 58 LEU LEU A . n A 1 21 THR 21 59 59 THR THR A . n A 1 22 ASN 22 60 60 ASN ASN A . n A 1 23 GLU 23 61 61 GLU GLU A . n A 1 24 MET 24 62 62 MET MET A . n A 1 25 ILE 25 63 63 ILE ILE A . n A 1 26 VAL 26 64 64 VAL VAL A . n A 1 27 THR 27 65 65 THR THR A . n A 1 28 LYS 28 66 66 LYS LYS A . n A 1 29 ASN 29 67 67 ASN ASN A . n A 1 30 GLY 30 68 68 GLY GLY A . n A 1 31 ARG 31 69 69 ARG ARG A . n A 1 32 ARG 32 70 70 ARG ARG A . n A 1 33 MET 33 71 71 MET MET A . n A 1 34 PHE 34 72 72 PHE PHE A . n A 1 35 PRO 35 73 73 PRO PRO A . n A 1 36 VAL 36 74 74 VAL VAL A . n A 1 37 LEU 37 75 75 LEU LEU A . n A 1 38 LYS 38 76 76 LYS LYS A . n A 1 39 VAL 39 77 77 VAL VAL A . n A 1 40 ASN 40 78 78 ASN ASN A . n A 1 41 VAL 41 79 79 VAL VAL A . n A 1 42 SER 42 80 80 SER SER A . n A 1 43 GLY 43 81 81 GLY GLY A . n A 1 44 LEU 44 82 82 LEU LEU A . n A 1 45 ASP 45 83 83 ASP ASP A . n A 1 46 PRO 46 84 84 PRO PRO A . n A 1 47 ASN 47 85 85 ASN ASN A . n A 1 48 ALA 48 86 86 ALA ALA A . n A 1 49 MET 49 87 87 MET MET A . n A 1 50 TYR 50 88 88 TYR TYR A . n A 1 51 SER 51 89 89 SER SER A . n A 1 52 PHE 52 90 90 PHE PHE A . n A 1 53 LEU 53 91 91 LEU LEU A . n A 1 54 LEU 54 92 92 LEU LEU A . n A 1 55 ASP 55 93 93 ASP ASP A . n A 1 56 PHE 56 94 94 PHE PHE A . n A 1 57 VAL 57 95 95 VAL VAL A . n A 1 58 ALA 58 96 96 ALA ALA A . n A 1 59 ALA 59 97 97 ALA ALA A . n A 1 60 ASP 60 98 98 ASP ASP A . n A 1 61 ASN 61 99 99 ASN ASN A . n A 1 62 HIS 62 100 100 HIS HIS A . n A 1 63 ARG 63 101 101 ARG ARG A . n A 1 64 TRP 64 102 102 TRP TRP A . n A 1 65 LYS 65 103 103 LYS LYS A . n A 1 66 TYR 66 104 104 TYR TYR A . n A 1 67 VAL 67 105 105 VAL VAL A . n A 1 68 ASN 68 106 106 ASN ASN A . n A 1 69 GLY 69 107 107 GLY GLY A . n A 1 70 GLU 70 108 108 GLU GLU A . n A 1 71 TRP 71 109 109 TRP TRP A . n A 1 72 VAL 72 110 110 VAL VAL A . n A 1 73 PRO 73 111 111 PRO PRO A . n A 1 74 GLY 74 112 112 GLY GLY A . n A 1 75 GLY 75 113 113 GLY GLY A . n A 1 76 LYS 76 114 114 LYS LYS A . n A 1 77 PRO 77 115 115 PRO PRO A . n A 1 78 GLU 78 116 116 GLU GLU A . n A 1 79 PRO 79 117 117 PRO PRO A . n A 1 80 GLN 80 118 118 GLN GLN A . n A 1 81 ALA 81 119 119 ALA ALA A . n A 1 82 PRO 82 120 120 PRO PRO A . n A 1 83 SER 83 121 121 SER SER A . n A 1 84 CYS 84 122 122 CYS CYS A . n A 1 85 VAL 85 123 123 VAL VAL A . n A 1 86 TYR 86 124 124 TYR TYR A . n A 1 87 ILE 87 125 125 ILE ILE A . n A 1 88 HIS 88 126 126 HIS HIS A . n A 1 89 PRO 89 127 127 PRO PRO A . n A 1 90 ASP 90 128 128 ASP ASP A . n A 1 91 SER 91 129 129 SER SER A . n A 1 92 PRO 92 130 130 PRO PRO A . n A 1 93 ASN 93 131 131 ASN ASN A . n A 1 94 PHE 94 132 132 PHE PHE A . n A 1 95 GLY 95 133 133 GLY GLY A . n A 1 96 ALA 96 134 134 ALA ALA A . n A 1 97 HIS 97 135 135 HIS HIS A . n A 1 98 TRP 98 136 136 TRP TRP A . n A 1 99 MET 99 137 137 MET MET A . n A 1 100 LYS 100 138 138 LYS LYS A . n A 1 101 ALA 101 139 139 ALA ALA A . n A 1 102 PRO 102 140 140 PRO PRO A . n A 1 103 VAL 103 141 141 VAL VAL A . n A 1 104 SER 104 142 142 SER SER A . n A 1 105 PHE 105 143 143 PHE PHE A . n A 1 106 SER 106 144 144 SER SER A . n A 1 107 LYS 107 145 145 LYS LYS A . n A 1 108 VAL 108 146 146 VAL VAL A . n A 1 109 LYS 109 147 147 LYS LYS A . n A 1 110 LEU 110 148 148 LEU LEU A . n A 1 111 THR 111 149 149 THR THR A . n A 1 112 ASN 112 150 150 ASN ASN A . n A 1 113 LYS 113 151 151 LYS LYS A . n A 1 114 LEU 114 152 152 LEU LEU A . n A 1 115 ASN 115 153 153 ASN ASN A . n A 1 116 GLY 116 154 154 GLY GLY A . n A 1 117 GLY 117 155 155 GLY GLY A . n A 1 118 GLY 118 156 156 GLY GLY A . n A 1 119 GLN 119 157 157 GLN GLN A . n A 1 120 ILE 120 158 158 ILE ILE A . n A 1 121 MET 121 159 159 MET MET A . n A 1 122 LEU 122 160 160 LEU LEU A . n A 1 123 ASN 123 161 161 ASN ASN A . n A 1 124 SER 124 162 162 SER SER A . n A 1 125 LEU 125 163 163 LEU LEU A . n A 1 126 HIS 126 164 164 HIS HIS A . n A 1 127 LYS 127 165 165 LYS LYS A . n A 1 128 TYR 128 166 166 TYR TYR A . n A 1 129 GLU 129 167 167 GLU GLU A . n A 1 130 PRO 130 168 168 PRO PRO A . n A 1 131 ARG 131 169 169 ARG ARG A . n A 1 132 ILE 132 170 170 ILE ILE A . n A 1 133 HIS 133 171 171 HIS HIS A . n A 1 134 ILE 134 172 172 ILE ILE A . n A 1 135 VAL 135 173 173 VAL VAL A . n A 1 136 ARG 136 174 174 ARG ARG A . n A 1 137 VAL 137 175 175 VAL VAL A . n A 1 138 GLY 138 176 ? ? ? A . n A 1 139 ASP 139 177 ? ? ? A . n A 1 140 PRO 140 178 ? ? ? A . n A 1 141 GLN 141 179 ? ? ? A . n A 1 142 ARG 142 180 180 ARG ARG A . n A 1 143 MET 143 181 181 MET MET A . n A 1 144 ILE 144 182 182 ILE ILE A . n A 1 145 THR 145 183 183 THR THR A . n A 1 146 SER 146 184 184 SER SER A . n A 1 147 HIS 147 185 185 HIS HIS A . n A 1 148 CYS 148 186 186 CYS CYS A . n A 1 149 PHE 149 187 187 PHE PHE A . n A 1 150 PRO 150 188 188 PRO PRO A . n A 1 151 GLU 151 189 189 GLU GLU A . n A 1 152 THR 152 190 190 THR THR A . n A 1 153 GLN 153 191 191 GLN GLN A . n A 1 154 PHE 154 192 192 PHE PHE A . n A 1 155 ILE 155 193 193 ILE ILE A . n A 1 156 ALA 156 194 194 ALA ALA A . n A 1 157 VAL 157 195 195 VAL VAL A . n A 1 158 THR 158 196 196 THR THR A . n A 1 159 ALA 159 197 197 ALA ALA A . n A 1 160 TYR 160 198 198 TYR TYR A . n A 1 161 GLN 161 199 199 GLN GLN A . n A 1 162 ASN 162 200 200 ASN ASN A . n A 1 163 GLU 163 201 201 GLU GLU A . n A 1 164 GLU 164 202 202 GLU GLU A . n A 1 165 ILE 165 203 203 ILE ILE A . n A 1 166 THR 166 204 204 THR THR A . n A 1 167 ALA 167 205 205 ALA ALA A . n A 1 168 LEU 168 206 206 LEU LEU A . n A 1 169 LYS 169 207 207 LYS LYS A . n A 1 170 ILE 170 208 208 ILE ILE A . n A 1 171 LYS 171 209 209 LYS LYS A . n A 1 172 TYR 172 210 210 TYR TYR A . n A 1 173 ASN 173 211 211 ASN ASN A . n A 1 174 PRO 174 212 212 PRO PRO A . n A 1 175 PHE 175 213 213 PHE PHE A . n A 1 176 ALA 176 214 214 ALA ALA A . n A 1 177 LYS 177 215 215 LYS LYS A . n A 1 178 ALA 178 216 216 ALA ALA A . n A 1 179 PHE 179 217 217 PHE PHE A . n A 1 180 LEU 180 218 218 LEU LEU A . n A 1 181 ASP 181 220 ? ? ? A . n A 1 182 ALA 182 221 ? ? ? A . n A 1 183 LYS 183 222 ? ? ? A . n A 1 184 GLU 184 223 ? ? ? A . n A 1 185 ARG 185 224 ? ? ? A . n A 1 186 SER 186 225 ? ? ? A . n A 1 187 HIS 187 226 226 HIS HIS A . n A 1 188 HIS 188 227 227 HIS HIS A . n A 1 189 HIS 189 228 228 HIS HIS A . n A 1 190 HIS 190 229 229 HIS HIS A . n A 1 191 HIS 191 230 230 HIS HIS A . n A 1 192 HIS 192 231 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 1 ZN ZN A . C 3 0WN 1 302 1 0WN AFT A . D 4 HOH 1 401 1 HOH HOH A . D 4 HOH 2 402 63 HOH HOH A . D 4 HOH 3 403 56 HOH HOH A . D 4 HOH 4 404 28 HOH HOH A . D 4 HOH 5 405 37 HOH HOH A . D 4 HOH 6 406 45 HOH HOH A . D 4 HOH 7 407 22 HOH HOH A . D 4 HOH 8 408 7 HOH HOH A . D 4 HOH 9 409 29 HOH HOH A . D 4 HOH 10 410 14 HOH HOH A . D 4 HOH 11 411 61 HOH HOH A . D 4 HOH 12 412 13 HOH HOH A . D 4 HOH 13 413 52 HOH HOH A . D 4 HOH 14 414 8 HOH HOH A . D 4 HOH 15 415 15 HOH HOH A . D 4 HOH 16 416 67 HOH HOH A . D 4 HOH 17 417 20 HOH HOH A . D 4 HOH 18 418 19 HOH HOH A . D 4 HOH 19 419 44 HOH HOH A . D 4 HOH 20 420 62 HOH HOH A . D 4 HOH 21 421 17 HOH HOH A . D 4 HOH 22 422 6 HOH HOH A . D 4 HOH 23 423 41 HOH HOH A . D 4 HOH 24 424 36 HOH HOH A . D 4 HOH 25 425 2 HOH HOH A . D 4 HOH 26 426 71 HOH HOH A . D 4 HOH 27 427 64 HOH HOH A . D 4 HOH 28 428 70 HOH HOH A . D 4 HOH 29 429 40 HOH HOH A . D 4 HOH 30 430 31 HOH HOH A . D 4 HOH 31 431 11 HOH HOH A . D 4 HOH 32 432 68 HOH HOH A . D 4 HOH 33 433 73 HOH HOH A . D 4 HOH 34 434 30 HOH HOH A . D 4 HOH 35 435 25 HOH HOH A . D 4 HOH 36 436 9 HOH HOH A . D 4 HOH 37 437 5 HOH HOH A . D 4 HOH 38 438 43 HOH HOH A . D 4 HOH 39 439 50 HOH HOH A . D 4 HOH 40 440 4 HOH HOH A . D 4 HOH 41 441 23 HOH HOH A . D 4 HOH 42 442 21 HOH HOH A . D 4 HOH 43 443 24 HOH HOH A . D 4 HOH 44 444 53 HOH HOH A . D 4 HOH 45 445 27 HOH HOH A . D 4 HOH 46 446 3 HOH HOH A . D 4 HOH 47 447 18 HOH HOH A . D 4 HOH 48 448 16 HOH HOH A . D 4 HOH 49 449 49 HOH HOH A . D 4 HOH 50 450 54 HOH HOH A . D 4 HOH 51 451 60 HOH HOH A . D 4 HOH 52 452 47 HOH HOH A . D 4 HOH 53 453 58 HOH HOH A . D 4 HOH 54 454 39 HOH HOH A . D 4 HOH 55 455 33 HOH HOH A . D 4 HOH 56 456 12 HOH HOH A . D 4 HOH 57 457 48 HOH HOH A . D 4 HOH 58 458 55 HOH HOH A . D 4 HOH 59 459 59 HOH HOH A . D 4 HOH 60 460 57 HOH HOH A . D 4 HOH 61 461 46 HOH HOH A . D 4 HOH 62 462 10 HOH HOH A . D 4 HOH 63 463 32 HOH HOH A . D 4 HOH 64 464 69 HOH HOH A . D 4 HOH 65 465 72 HOH HOH A . D 4 HOH 66 466 38 HOH HOH A . D 4 HOH 67 467 74 HOH HOH A . D 4 HOH 68 468 51 HOH HOH A . D 4 HOH 69 469 35 HOH HOH A . D 4 HOH 70 470 34 HOH HOH A . D 4 HOH 71 471 66 HOH HOH A . D 4 HOH 72 472 42 HOH HOH A . D 4 HOH 73 473 65 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 41 ? CG ? A GLU 3 CG 2 1 Y 1 A GLU 41 ? CD ? A GLU 3 CD 3 1 Y 1 A GLU 41 ? OE1 ? A GLU 3 OE1 4 1 Y 1 A GLU 41 ? OE2 ? A GLU 3 OE2 5 1 Y 1 A GLU 57 ? CG ? A GLU 19 CG 6 1 Y 1 A GLU 57 ? CD ? A GLU 19 CD 7 1 Y 1 A GLU 57 ? OE1 ? A GLU 19 OE1 8 1 Y 1 A GLU 57 ? OE2 ? A GLU 19 OE2 9 1 Y 1 A LYS 66 ? CG ? A LYS 28 CG 10 1 Y 1 A LYS 66 ? CD ? A LYS 28 CD 11 1 Y 1 A LYS 66 ? CE ? A LYS 28 CE 12 1 Y 1 A LYS 66 ? NZ ? A LYS 28 NZ 13 1 Y 1 A LYS 114 ? CG ? A LYS 76 CG 14 1 Y 1 A LYS 114 ? CD ? A LYS 76 CD 15 1 Y 1 A LYS 114 ? CE ? A LYS 76 CE 16 1 Y 1 A LYS 114 ? NZ ? A LYS 76 NZ 17 1 Y 1 A GLU 116 ? CG ? A GLU 78 CG 18 1 Y 1 A GLU 116 ? CD ? A GLU 78 CD 19 1 Y 1 A GLU 116 ? OE1 ? A GLU 78 OE1 20 1 Y 1 A GLU 116 ? OE2 ? A GLU 78 OE2 21 1 Y 1 A GLN 118 ? CG ? A GLN 80 CG 22 1 Y 1 A GLN 118 ? CD ? A GLN 80 CD 23 1 Y 1 A GLN 118 ? OE1 ? A GLN 80 OE1 24 1 Y 1 A GLN 118 ? NE2 ? A GLN 80 NE2 25 1 Y 1 A LYS 151 ? CG ? A LYS 113 CG 26 1 Y 1 A LYS 151 ? CD ? A LYS 113 CD 27 1 Y 1 A LYS 151 ? CE ? A LYS 113 CE 28 1 Y 1 A LYS 151 ? NZ ? A LYS 113 NZ 29 1 Y 1 A ARG 174 ? CG ? A ARG 136 CG 30 1 Y 1 A ARG 174 ? CD ? A ARG 136 CD 31 1 Y 1 A ARG 174 ? NE ? A ARG 136 NE 32 1 Y 1 A ARG 174 ? CZ ? A ARG 136 CZ 33 1 Y 1 A ARG 174 ? NH1 ? A ARG 136 NH1 34 1 Y 1 A ARG 174 ? NH2 ? A ARG 136 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 0.7.3 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ZU8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.107 _cell.length_a_esd ? _cell.length_b 49.269 _cell.length_b_esd ? _cell.length_c 83.740 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZU8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZU8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Mes Ph 6.0, 0.2 M Ammonium Chloride, 20 % PEG 6000, 10 % Ethylene Glycol.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6ZU8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.950 _reflns.d_resolution_low 83.740 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13591 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.700 _reflns.pdbx_Rmerge_I_obs 0.088 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 13.6 _reflns.pdbx_netI_over_sigmaI 13.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.093 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.950 _reflns_shell.d_res_low 2.000 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 937 _reflns_shell.percent_possible_all 99.700 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.593 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.800 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.681 _reflns_shell.pdbx_Rpim_I_all 0.526 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.816 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 102.860 _refine.B_iso_mean 49.4751 _refine.B_iso_min 27.150 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ZU8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9500 _refine.ls_d_res_low 42.4600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13511 _refine.ls_number_reflns_R_free 653 _refine.ls_number_reflns_R_work 12858 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7000 _refine.ls_percent_reflns_R_free 4.8300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2196 _refine.ls_R_factor_R_free 0.2602 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2177 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6f59 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.3500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9500 _refine_hist.d_res_low 42.4600 _refine_hist.number_atoms_solvent 73 _refine_hist.number_atoms_total 1532 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 179 _refine_hist.pdbx_B_iso_mean_ligand 45.10 _refine_hist.pdbx_B_iso_mean_solvent 49.12 _refine_hist.pdbx_number_atoms_protein 1424 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9500 2.1000 2631 . 127 2504 99.0000 . . . 0.4157 0.0000 0.3298 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.1000 2.3100 2667 . 126 2541 100.0000 . . . 0.3260 0.0000 0.2726 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.3100 2.6500 2661 . 131 2530 100.0000 . . . 0.2981 0.0000 0.2331 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.6500 3.3300 2713 . 143 2570 100.0000 . . . 0.2713 0.0000 0.2185 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.3300 42.4600 2839 . 126 2713 100.0000 . . . 0.2186 0.0000 0.1952 . . . . . . . 5 . . . # _struct.entry_id 6ZU8 _struct.title 'Crystal structure of human Brachyury G177D variant in complex with Afatinib' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZU8 _struct_keywords.text 'Brachyury, TBXT, Afatinib, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRAC_HUMAN _struct_ref.pdbx_db_accession O15178 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQN EEITALKIKYNPFAKAFLDAKERS ; _struct_ref.pdbx_align_begin 41 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ZU8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15178 _struct_ref_seq.db_align_beg 41 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 224 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 41 _struct_ref_seq.pdbx_auth_seq_align_end 225 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6ZU8 MET A 1 ? UNP O15178 ? ? 'initiating methionine' 39 1 1 6ZU8 GLY A 2 ? UNP O15178 ? ? 'expression tag' 40 2 1 6ZU8 ASP A 139 ? UNP O15178 GLY 177 conflict 177 3 1 6ZU8 HIS A 187 ? UNP O15178 ? ? 'expression tag' 226 4 1 6ZU8 HIS A 188 ? UNP O15178 ? ? 'expression tag' 227 5 1 6ZU8 HIS A 189 ? UNP O15178 ? ? 'expression tag' 228 6 1 6ZU8 HIS A 190 ? UNP O15178 ? ? 'expression tag' 229 7 1 6ZU8 HIS A 191 ? UNP O15178 ? ? 'expression tag' 230 8 1 6ZU8 HIS A 192 ? UNP O15178 ? ? 'expression tag' 231 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 70 ? 1 MORE -20 ? 1 'SSA (A^2)' 10120 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 10 ? LEU A 20 ? GLU A 48 LEU A 58 1 ? 11 HELX_P HELX_P2 AA2 GLY A 95 ? LYS A 100 ? GLY A 133 LYS A 138 1 ? 6 HELX_P HELX_P3 AA3 PRO A 150 ? GLN A 153 ? PRO A 188 GLN A 191 5 ? 4 HELX_P HELX_P4 AA4 ASN A 162 ? ASN A 173 ? ASN A 200 ASN A 211 1 ? 12 HELX_P HELX_P5 AA5 ASN A 173 ? PHE A 179 ? ASN A 211 PHE A 217 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A CYS 84 SG ? ? ? 1_555 C 0WN . C30 ? ? A CYS 122 A 0WN 302 1_555 ? ? ? ? ? ? ? 1.685 ? ? metalc1 metalc ? ? A GLU 129 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 167 A ZN 301 1_555 ? ? ? ? ? ? ? 1.933 ? ? metalc2 metalc ? ? A CYS 148 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 186 A ZN 301 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc3 metalc ? ? A HIS 187 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 226 A ZN 301 4_555 ? ? ? ? ? ? ? 2.114 ? ? metalc4 metalc ? ? A HIS 189 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 228 A ZN 301 4_555 ? ? ? ? ? ? ? 2.217 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 129 ? A GLU 167 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 148 ? A CYS 186 ? 1_555 100.1 ? 2 OE2 ? A GLU 129 ? A GLU 167 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 187 ? A HIS 226 ? 1_555 48.5 ? 3 SG ? A CYS 148 ? A CYS 186 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 187 ? A HIS 226 ? 1_555 143.5 ? 4 OE2 ? A GLU 129 ? A GLU 167 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 189 ? A HIS 228 ? 1_555 52.2 ? 5 SG ? A CYS 148 ? A CYS 186 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 189 ? A HIS 228 ? 1_555 146.8 ? 6 NE2 ? A HIS 187 ? A HIS 226 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 189 ? A HIS 228 ? 1_555 3.7 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 34 A . ? PHE 72 A PRO 35 A ? PRO 73 A 1 -2.85 2 SER 91 A . ? SER 129 A PRO 92 A ? PRO 130 A 1 -6.35 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 3 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 5 ? LEU A 8 ? ARG A 43 LEU A 46 AA1 2 LYS A 38 ? SER A 42 ? LYS A 76 SER A 80 AA1 3 VAL A 103 ? SER A 104 ? VAL A 141 SER A 142 AA2 1 GLU A 23 ? ILE A 25 ? GLU A 61 ILE A 63 AA2 2 PHE A 154 ? VAL A 157 ? PHE A 192 VAL A 195 AA2 3 LYS A 127 ? ARG A 136 ? LYS A 165 ARG A 174 AA2 4 MET A 49 ? ALA A 58 ? MET A 87 ALA A 96 AA2 5 ASN A 93 ? PHE A 94 ? ASN A 131 PHE A 132 AA3 1 TYR A 86 ? ILE A 87 ? TYR A 124 ILE A 125 AA3 2 MET A 49 ? ALA A 58 ? MET A 87 ALA A 96 AA3 3 LYS A 127 ? ARG A 136 ? LYS A 165 ARG A 174 AA3 4 ILE A 144 ? CYS A 148 ? ILE A 182 CYS A 186 AA4 1 ARG A 31 ? ARG A 32 ? ARG A 69 ARG A 70 AA4 2 LYS A 109 ? THR A 111 ? LYS A 147 THR A 149 AA4 3 GLN A 119 ? MET A 121 ? GLN A 157 MET A 159 AA5 1 ARG A 63 ? VAL A 67 ? ARG A 101 VAL A 105 AA5 2 GLU A 70 ? GLY A 74 ? GLU A 108 GLY A 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 5 ? N ARG A 43 O SER A 42 ? O SER A 80 AA1 2 3 N VAL A 39 ? N VAL A 77 O VAL A 103 ? O VAL A 141 AA2 1 2 N MET A 24 ? N MET A 62 O VAL A 157 ? O VAL A 195 AA2 2 3 O PHE A 154 ? O PHE A 192 N TYR A 128 ? N TYR A 166 AA2 3 4 O HIS A 133 ? O HIS A 171 N LEU A 53 ? N LEU A 91 AA2 4 5 N TYR A 50 ? N TYR A 88 O ASN A 93 ? O ASN A 131 AA3 1 2 O TYR A 86 ? O TYR A 124 N LEU A 54 ? N LEU A 92 AA3 2 3 N LEU A 53 ? N LEU A 91 O HIS A 133 ? O HIS A 171 AA3 3 4 N ILE A 132 ? N ILE A 170 O HIS A 147 ? O HIS A 185 AA4 1 2 N ARG A 31 ? N ARG A 69 O LEU A 110 ? O LEU A 148 AA4 2 3 N THR A 111 ? N THR A 149 O ILE A 120 ? O ILE A 158 AA5 1 2 N LYS A 65 ? N LYS A 103 O VAL A 72 ? O VAL A 110 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 153 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 59 ? ? 66.05 108.55 2 1 PHE A 143 ? ? -109.78 40.90 3 1 LYS A 151 ? ? -146.21 -76.79 # _pdbx_entry_details.entry_id 6ZU8 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 39 ? A MET 1 2 1 Y 1 A GLY 40 ? A GLY 2 3 1 Y 1 A GLY 176 ? A GLY 138 4 1 Y 1 A ASP 177 ? A ASP 139 5 1 Y 1 A PRO 178 ? A PRO 140 6 1 Y 1 A GLN 179 ? A GLN 141 7 1 Y 1 A ASP 220 ? A ASP 181 8 1 Y 1 A ALA 221 ? A ALA 182 9 1 Y 1 A LYS 222 ? A LYS 183 10 1 Y 1 A GLU 223 ? A GLU 184 11 1 Y 1 A ARG 224 ? A ARG 185 12 1 Y 1 A SER 225 ? A SER 186 13 1 Y 1 A HIS 231 ? A HIS 192 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0WN C1 C Y N 1 0WN N2 N Y N 2 0WN N3 N Y N 3 0WN C4 C Y N 4 0WN C5 C Y N 5 0WN C6 C Y N 6 0WN C7 C Y N 7 0WN C8 C Y N 8 0WN C9 C Y N 9 0WN C10 C Y N 10 0WN N11 N N N 11 0WN C12 C Y N 12 0WN C13 C Y N 13 0WN C14 C Y N 14 0WN C15 C Y N 15 0WN C16 C Y N 16 0WN C17 C Y N 17 0WN F18 F N N 18 0WN CL1 CL N N 19 0WN O20 O N N 20 0WN C21 C N S 21 0WN C22 C N N 22 0WN O23 O N N 23 0WN C24 C N N 24 0WN C25 C N N 25 0WN N26 N N N 26 0WN C27 C N N 27 0WN C28 C N N 28 0WN O29 O N N 29 0WN C30 C N N 30 0WN C31 C N N 31 0WN N32 N N N 32 0WN C33 C N N 33 0WN C34 C N N 34 0WN H1 H N N 35 0WN H2 H N N 36 0WN H3 H N N 37 0WN H4 H N N 38 0WN H5 H N N 39 0WN H6 H N N 40 0WN H7 H N N 41 0WN H8 H N N 42 0WN H9 H N N 43 0WN H10 H N N 44 0WN H11 H N N 45 0WN H12 H N N 46 0WN H13 H N N 47 0WN H14 H N N 48 0WN H15 H N N 49 0WN H16 H N N 50 0WN H17 H N N 51 0WN H18 H N N 52 0WN H19 H N N 53 0WN H20 H N N 54 0WN H21 H N N 55 0WN H23 H N N 56 0WN H24 H N N 57 0WN H25 H N N 58 0WN H26 H N N 59 0WN H27 H N N 60 0WN H28 H N N 61 ALA N N N N 62 ALA CA C N S 63 ALA C C N N 64 ALA O O N N 65 ALA CB C N N 66 ALA OXT O N N 67 ALA H H N N 68 ALA H2 H N N 69 ALA HA H N N 70 ALA HB1 H N N 71 ALA HB2 H N N 72 ALA HB3 H N N 73 ALA HXT H N N 74 ARG N N N N 75 ARG CA C N S 76 ARG C C N N 77 ARG O O N N 78 ARG CB C N N 79 ARG CG C N N 80 ARG CD C N N 81 ARG NE N N N 82 ARG CZ C N N 83 ARG NH1 N N N 84 ARG NH2 N N N 85 ARG OXT O N N 86 ARG H H N N 87 ARG H2 H N N 88 ARG HA H N N 89 ARG HB2 H N N 90 ARG HB3 H N N 91 ARG HG2 H N N 92 ARG HG3 H N N 93 ARG HD2 H N N 94 ARG HD3 H N N 95 ARG HE H N N 96 ARG HH11 H N N 97 ARG HH12 H N N 98 ARG HH21 H N N 99 ARG HH22 H N N 100 ARG HXT H N N 101 ASN N N N N 102 ASN CA C N S 103 ASN C C N N 104 ASN O O N N 105 ASN CB C N N 106 ASN CG C N N 107 ASN OD1 O N N 108 ASN ND2 N N N 109 ASN OXT O N N 110 ASN H H N N 111 ASN H2 H N N 112 ASN HA H N N 113 ASN HB2 H N N 114 ASN HB3 H N N 115 ASN HD21 H N N 116 ASN HD22 H N N 117 ASN HXT H N N 118 ASP N N N N 119 ASP CA C N S 120 ASP C C N N 121 ASP O O N N 122 ASP CB C N N 123 ASP CG C N N 124 ASP OD1 O N N 125 ASP OD2 O N N 126 ASP OXT O N N 127 ASP H H N N 128 ASP H2 H N N 129 ASP HA H N N 130 ASP HB2 H N N 131 ASP HB3 H N N 132 ASP HD2 H N N 133 ASP HXT H N N 134 CYS N N N N 135 CYS CA C N R 136 CYS C C N N 137 CYS O O N N 138 CYS CB C N N 139 CYS SG S N N 140 CYS OXT O N N 141 CYS H H N N 142 CYS H2 H N N 143 CYS HA H N N 144 CYS HB2 H N N 145 CYS HB3 H N N 146 CYS HG H N N 147 CYS HXT H N N 148 GLN N N N N 149 GLN CA C N S 150 GLN C C N N 151 GLN O O N N 152 GLN CB C N N 153 GLN CG C N N 154 GLN CD C N N 155 GLN OE1 O N N 156 GLN NE2 N N N 157 GLN OXT O N N 158 GLN H H N N 159 GLN H2 H N N 160 GLN HA H N N 161 GLN HB2 H N N 162 GLN HB3 H N N 163 GLN HG2 H N N 164 GLN HG3 H N N 165 GLN HE21 H N N 166 GLN HE22 H N N 167 GLN HXT H N N 168 GLU N N N N 169 GLU CA C N S 170 GLU C C N N 171 GLU O O N N 172 GLU CB C N N 173 GLU CG C N N 174 GLU CD C N N 175 GLU OE1 O N N 176 GLU OE2 O N N 177 GLU OXT O N N 178 GLU H H N N 179 GLU H2 H N N 180 GLU HA H N N 181 GLU HB2 H N N 182 GLU HB3 H N N 183 GLU HG2 H N N 184 GLU HG3 H N N 185 GLU HE2 H N N 186 GLU HXT H N N 187 GLY N N N N 188 GLY CA C N N 189 GLY C C N N 190 GLY O O N N 191 GLY OXT O N N 192 GLY H H N N 193 GLY H2 H N N 194 GLY HA2 H N N 195 GLY HA3 H N N 196 GLY HXT H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 HOH O O N N 219 HOH H1 H N N 220 HOH H2 H N N 221 ILE N N N N 222 ILE CA C N S 223 ILE C C N N 224 ILE O O N N 225 ILE CB C N S 226 ILE CG1 C N N 227 ILE CG2 C N N 228 ILE CD1 C N N 229 ILE OXT O N N 230 ILE H H N N 231 ILE H2 H N N 232 ILE HA H N N 233 ILE HB H N N 234 ILE HG12 H N N 235 ILE HG13 H N N 236 ILE HG21 H N N 237 ILE HG22 H N N 238 ILE HG23 H N N 239 ILE HD11 H N N 240 ILE HD12 H N N 241 ILE HD13 H N N 242 ILE HXT H N N 243 LEU N N N N 244 LEU CA C N S 245 LEU C C N N 246 LEU O O N N 247 LEU CB C N N 248 LEU CG C N N 249 LEU CD1 C N N 250 LEU CD2 C N N 251 LEU OXT O N N 252 LEU H H N N 253 LEU H2 H N N 254 LEU HA H N N 255 LEU HB2 H N N 256 LEU HB3 H N N 257 LEU HG H N N 258 LEU HD11 H N N 259 LEU HD12 H N N 260 LEU HD13 H N N 261 LEU HD21 H N N 262 LEU HD22 H N N 263 LEU HD23 H N N 264 LEU HXT H N N 265 LYS N N N N 266 LYS CA C N S 267 LYS C C N N 268 LYS O O N N 269 LYS CB C N N 270 LYS CG C N N 271 LYS CD C N N 272 LYS CE C N N 273 LYS NZ N N N 274 LYS OXT O N N 275 LYS H H N N 276 LYS H2 H N N 277 LYS HA H N N 278 LYS HB2 H N N 279 LYS HB3 H N N 280 LYS HG2 H N N 281 LYS HG3 H N N 282 LYS HD2 H N N 283 LYS HD3 H N N 284 LYS HE2 H N N 285 LYS HE3 H N N 286 LYS HZ1 H N N 287 LYS HZ2 H N N 288 LYS HZ3 H N N 289 LYS HXT H N N 290 MET N N N N 291 MET CA C N S 292 MET C C N N 293 MET O O N N 294 MET CB C N N 295 MET CG C N N 296 MET SD S N N 297 MET CE C N N 298 MET OXT O N N 299 MET H H N N 300 MET H2 H N N 301 MET HA H N N 302 MET HB2 H N N 303 MET HB3 H N N 304 MET HG2 H N N 305 MET HG3 H N N 306 MET HE1 H N N 307 MET HE2 H N N 308 MET HE3 H N N 309 MET HXT H N N 310 PHE N N N N 311 PHE CA C N S 312 PHE C C N N 313 PHE O O N N 314 PHE CB C N N 315 PHE CG C Y N 316 PHE CD1 C Y N 317 PHE CD2 C Y N 318 PHE CE1 C Y N 319 PHE CE2 C Y N 320 PHE CZ C Y N 321 PHE OXT O N N 322 PHE H H N N 323 PHE H2 H N N 324 PHE HA H N N 325 PHE HB2 H N N 326 PHE HB3 H N N 327 PHE HD1 H N N 328 PHE HD2 H N N 329 PHE HE1 H N N 330 PHE HE2 H N N 331 PHE HZ H N N 332 PHE HXT H N N 333 PRO N N N N 334 PRO CA C N S 335 PRO C C N N 336 PRO O O N N 337 PRO CB C N N 338 PRO CG C N N 339 PRO CD C N N 340 PRO OXT O N N 341 PRO H H N N 342 PRO HA H N N 343 PRO HB2 H N N 344 PRO HB3 H N N 345 PRO HG2 H N N 346 PRO HG3 H N N 347 PRO HD2 H N N 348 PRO HD3 H N N 349 PRO HXT H N N 350 SER N N N N 351 SER CA C N S 352 SER C C N N 353 SER O O N N 354 SER CB C N N 355 SER OG O N N 356 SER OXT O N N 357 SER H H N N 358 SER H2 H N N 359 SER HA H N N 360 SER HB2 H N N 361 SER HB3 H N N 362 SER HG H N N 363 SER HXT H N N 364 THR N N N N 365 THR CA C N S 366 THR C C N N 367 THR O O N N 368 THR CB C N R 369 THR OG1 O N N 370 THR CG2 C N N 371 THR OXT O N N 372 THR H H N N 373 THR H2 H N N 374 THR HA H N N 375 THR HB H N N 376 THR HG1 H N N 377 THR HG21 H N N 378 THR HG22 H N N 379 THR HG23 H N N 380 THR HXT H N N 381 TRP N N N N 382 TRP CA C N S 383 TRP C C N N 384 TRP O O N N 385 TRP CB C N N 386 TRP CG C Y N 387 TRP CD1 C Y N 388 TRP CD2 C Y N 389 TRP NE1 N Y N 390 TRP CE2 C Y N 391 TRP CE3 C Y N 392 TRP CZ2 C Y N 393 TRP CZ3 C Y N 394 TRP CH2 C Y N 395 TRP OXT O N N 396 TRP H H N N 397 TRP H2 H N N 398 TRP HA H N N 399 TRP HB2 H N N 400 TRP HB3 H N N 401 TRP HD1 H N N 402 TRP HE1 H N N 403 TRP HE3 H N N 404 TRP HZ2 H N N 405 TRP HZ3 H N N 406 TRP HH2 H N N 407 TRP HXT H N N 408 TYR N N N N 409 TYR CA C N S 410 TYR C C N N 411 TYR O O N N 412 TYR CB C N N 413 TYR CG C Y N 414 TYR CD1 C Y N 415 TYR CD2 C Y N 416 TYR CE1 C Y N 417 TYR CE2 C Y N 418 TYR CZ C Y N 419 TYR OH O N N 420 TYR OXT O N N 421 TYR H H N N 422 TYR H2 H N N 423 TYR HA H N N 424 TYR HB2 H N N 425 TYR HB3 H N N 426 TYR HD1 H N N 427 TYR HD2 H N N 428 TYR HE1 H N N 429 TYR HE2 H N N 430 TYR HH H N N 431 TYR HXT H N N 432 VAL N N N N 433 VAL CA C N S 434 VAL C C N N 435 VAL O O N N 436 VAL CB C N N 437 VAL CG1 C N N 438 VAL CG2 C N N 439 VAL OXT O N N 440 VAL H H N N 441 VAL H2 H N N 442 VAL HA H N N 443 VAL HB H N N 444 VAL HG11 H N N 445 VAL HG12 H N N 446 VAL HG13 H N N 447 VAL HG21 H N N 448 VAL HG22 H N N 449 VAL HG23 H N N 450 VAL HXT H N N 451 ZN ZN ZN N N 452 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0WN F18 C13 sing N N 1 0WN C13 C15 doub Y N 2 0WN C13 C12 sing Y N 3 0WN CL1 C12 sing N N 4 0WN C15 C17 sing Y N 5 0WN C12 C14 doub Y N 6 0WN C17 C16 doub Y N 7 0WN C14 C16 sing Y N 8 0WN C16 N11 sing N N 9 0WN N11 C4 sing N N 10 0WN N2 C4 doub Y N 11 0WN N2 C1 sing Y N 12 0WN C4 C6 sing Y N 13 0WN C1 N3 doub Y N 14 0WN C6 C8 doub Y N 15 0WN C6 C5 sing Y N 16 0WN C33 N32 sing N N 17 0WN C8 C7 sing Y N 18 0WN N3 C5 sing Y N 19 0WN C5 C10 doub Y N 20 0WN O29 C27 doub N N 21 0WN N32 C34 sing N N 22 0WN N32 C31 sing N N 23 0WN C7 N26 sing N N 24 0WN C7 C9 doub Y N 25 0WN C10 C9 sing Y N 26 0WN C27 N26 sing N N 27 0WN C27 C28 sing N N 28 0WN C9 O20 sing N N 29 0WN C31 C30 sing N N 30 0WN C30 C28 sing N N 31 0WN O20 C21 sing N N 32 0WN C22 C21 sing N N 33 0WN C22 O23 sing N N 34 0WN C21 C25 sing N N 35 0WN O23 C24 sing N N 36 0WN C25 C24 sing N N 37 0WN C1 H1 sing N N 38 0WN C8 H2 sing N N 39 0WN C10 H3 sing N N 40 0WN N11 H4 sing N N 41 0WN C14 H5 sing N N 42 0WN C15 H6 sing N N 43 0WN C17 H7 sing N N 44 0WN C21 H8 sing N N 45 0WN C22 H9 sing N N 46 0WN C22 H10 sing N N 47 0WN C24 H11 sing N N 48 0WN C24 H12 sing N N 49 0WN C25 H13 sing N N 50 0WN C25 H14 sing N N 51 0WN N26 H15 sing N N 52 0WN C28 H16 sing N N 53 0WN C28 H17 sing N N 54 0WN C30 H18 sing N N 55 0WN C30 H19 sing N N 56 0WN C31 H20 sing N N 57 0WN C31 H21 sing N N 58 0WN C33 H23 sing N N 59 0WN C33 H24 sing N N 60 0WN C33 H25 sing N N 61 0WN C34 H26 sing N N 62 0WN C34 H27 sing N N 63 0WN C34 H28 sing N N 64 ALA N CA sing N N 65 ALA N H sing N N 66 ALA N H2 sing N N 67 ALA CA C sing N N 68 ALA CA CB sing N N 69 ALA CA HA sing N N 70 ALA C O doub N N 71 ALA C OXT sing N N 72 ALA CB HB1 sing N N 73 ALA CB HB2 sing N N 74 ALA CB HB3 sing N N 75 ALA OXT HXT sing N N 76 ARG N CA sing N N 77 ARG N H sing N N 78 ARG N H2 sing N N 79 ARG CA C sing N N 80 ARG CA CB sing N N 81 ARG CA HA sing N N 82 ARG C O doub N N 83 ARG C OXT sing N N 84 ARG CB CG sing N N 85 ARG CB HB2 sing N N 86 ARG CB HB3 sing N N 87 ARG CG CD sing N N 88 ARG CG HG2 sing N N 89 ARG CG HG3 sing N N 90 ARG CD NE sing N N 91 ARG CD HD2 sing N N 92 ARG CD HD3 sing N N 93 ARG NE CZ sing N N 94 ARG NE HE sing N N 95 ARG CZ NH1 sing N N 96 ARG CZ NH2 doub N N 97 ARG NH1 HH11 sing N N 98 ARG NH1 HH12 sing N N 99 ARG NH2 HH21 sing N N 100 ARG NH2 HH22 sing N N 101 ARG OXT HXT sing N N 102 ASN N CA sing N N 103 ASN N H sing N N 104 ASN N H2 sing N N 105 ASN CA C sing N N 106 ASN CA CB sing N N 107 ASN CA HA sing N N 108 ASN C O doub N N 109 ASN C OXT sing N N 110 ASN CB CG sing N N 111 ASN CB HB2 sing N N 112 ASN CB HB3 sing N N 113 ASN CG OD1 doub N N 114 ASN CG ND2 sing N N 115 ASN ND2 HD21 sing N N 116 ASN ND2 HD22 sing N N 117 ASN OXT HXT sing N N 118 ASP N CA sing N N 119 ASP N H sing N N 120 ASP N H2 sing N N 121 ASP CA C sing N N 122 ASP CA CB sing N N 123 ASP CA HA sing N N 124 ASP C O doub N N 125 ASP C OXT sing N N 126 ASP CB CG sing N N 127 ASP CB HB2 sing N N 128 ASP CB HB3 sing N N 129 ASP CG OD1 doub N N 130 ASP CG OD2 sing N N 131 ASP OD2 HD2 sing N N 132 ASP OXT HXT sing N N 133 CYS N CA sing N N 134 CYS N H sing N N 135 CYS N H2 sing N N 136 CYS CA C sing N N 137 CYS CA CB sing N N 138 CYS CA HA sing N N 139 CYS C O doub N N 140 CYS C OXT sing N N 141 CYS CB SG sing N N 142 CYS CB HB2 sing N N 143 CYS CB HB3 sing N N 144 CYS SG HG sing N N 145 CYS OXT HXT sing N N 146 GLN N CA sing N N 147 GLN N H sing N N 148 GLN N H2 sing N N 149 GLN CA C sing N N 150 GLN CA CB sing N N 151 GLN CA HA sing N N 152 GLN C O doub N N 153 GLN C OXT sing N N 154 GLN CB CG sing N N 155 GLN CB HB2 sing N N 156 GLN CB HB3 sing N N 157 GLN CG CD sing N N 158 GLN CG HG2 sing N N 159 GLN CG HG3 sing N N 160 GLN CD OE1 doub N N 161 GLN CD NE2 sing N N 162 GLN NE2 HE21 sing N N 163 GLN NE2 HE22 sing N N 164 GLN OXT HXT sing N N 165 GLU N CA sing N N 166 GLU N H sing N N 167 GLU N H2 sing N N 168 GLU CA C sing N N 169 GLU CA CB sing N N 170 GLU CA HA sing N N 171 GLU C O doub N N 172 GLU C OXT sing N N 173 GLU CB CG sing N N 174 GLU CB HB2 sing N N 175 GLU CB HB3 sing N N 176 GLU CG CD sing N N 177 GLU CG HG2 sing N N 178 GLU CG HG3 sing N N 179 GLU CD OE1 doub N N 180 GLU CD OE2 sing N N 181 GLU OE2 HE2 sing N N 182 GLU OXT HXT sing N N 183 GLY N CA sing N N 184 GLY N H sing N N 185 GLY N H2 sing N N 186 GLY CA C sing N N 187 GLY CA HA2 sing N N 188 GLY CA HA3 sing N N 189 GLY C O doub N N 190 GLY C OXT sing N N 191 GLY OXT HXT sing N N 192 HIS N CA sing N N 193 HIS N H sing N N 194 HIS N H2 sing N N 195 HIS CA C sing N N 196 HIS CA CB sing N N 197 HIS CA HA sing N N 198 HIS C O doub N N 199 HIS C OXT sing N N 200 HIS CB CG sing N N 201 HIS CB HB2 sing N N 202 HIS CB HB3 sing N N 203 HIS CG ND1 sing Y N 204 HIS CG CD2 doub Y N 205 HIS ND1 CE1 doub Y N 206 HIS ND1 HD1 sing N N 207 HIS CD2 NE2 sing Y N 208 HIS CD2 HD2 sing N N 209 HIS CE1 NE2 sing Y N 210 HIS CE1 HE1 sing N N 211 HIS NE2 HE2 sing N N 212 HIS OXT HXT sing N N 213 HOH O H1 sing N N 214 HOH O H2 sing N N 215 ILE N CA sing N N 216 ILE N H sing N N 217 ILE N H2 sing N N 218 ILE CA C sing N N 219 ILE CA CB sing N N 220 ILE CA HA sing N N 221 ILE C O doub N N 222 ILE C OXT sing N N 223 ILE CB CG1 sing N N 224 ILE CB CG2 sing N N 225 ILE CB HB sing N N 226 ILE CG1 CD1 sing N N 227 ILE CG1 HG12 sing N N 228 ILE CG1 HG13 sing N N 229 ILE CG2 HG21 sing N N 230 ILE CG2 HG22 sing N N 231 ILE CG2 HG23 sing N N 232 ILE CD1 HD11 sing N N 233 ILE CD1 HD12 sing N N 234 ILE CD1 HD13 sing N N 235 ILE OXT HXT sing N N 236 LEU N CA sing N N 237 LEU N H sing N N 238 LEU N H2 sing N N 239 LEU CA C sing N N 240 LEU CA CB sing N N 241 LEU CA HA sing N N 242 LEU C O doub N N 243 LEU C OXT sing N N 244 LEU CB CG sing N N 245 LEU CB HB2 sing N N 246 LEU CB HB3 sing N N 247 LEU CG CD1 sing N N 248 LEU CG CD2 sing N N 249 LEU CG HG sing N N 250 LEU CD1 HD11 sing N N 251 LEU CD1 HD12 sing N N 252 LEU CD1 HD13 sing N N 253 LEU CD2 HD21 sing N N 254 LEU CD2 HD22 sing N N 255 LEU CD2 HD23 sing N N 256 LEU OXT HXT sing N N 257 LYS N CA sing N N 258 LYS N H sing N N 259 LYS N H2 sing N N 260 LYS CA C sing N N 261 LYS CA CB sing N N 262 LYS CA HA sing N N 263 LYS C O doub N N 264 LYS C OXT sing N N 265 LYS CB CG sing N N 266 LYS CB HB2 sing N N 267 LYS CB HB3 sing N N 268 LYS CG CD sing N N 269 LYS CG HG2 sing N N 270 LYS CG HG3 sing N N 271 LYS CD CE sing N N 272 LYS CD HD2 sing N N 273 LYS CD HD3 sing N N 274 LYS CE NZ sing N N 275 LYS CE HE2 sing N N 276 LYS CE HE3 sing N N 277 LYS NZ HZ1 sing N N 278 LYS NZ HZ2 sing N N 279 LYS NZ HZ3 sing N N 280 LYS OXT HXT sing N N 281 MET N CA sing N N 282 MET N H sing N N 283 MET N H2 sing N N 284 MET CA C sing N N 285 MET CA CB sing N N 286 MET CA HA sing N N 287 MET C O doub N N 288 MET C OXT sing N N 289 MET CB CG sing N N 290 MET CB HB2 sing N N 291 MET CB HB3 sing N N 292 MET CG SD sing N N 293 MET CG HG2 sing N N 294 MET CG HG3 sing N N 295 MET SD CE sing N N 296 MET CE HE1 sing N N 297 MET CE HE2 sing N N 298 MET CE HE3 sing N N 299 MET OXT HXT sing N N 300 PHE N CA sing N N 301 PHE N H sing N N 302 PHE N H2 sing N N 303 PHE CA C sing N N 304 PHE CA CB sing N N 305 PHE CA HA sing N N 306 PHE C O doub N N 307 PHE C OXT sing N N 308 PHE CB CG sing N N 309 PHE CB HB2 sing N N 310 PHE CB HB3 sing N N 311 PHE CG CD1 doub Y N 312 PHE CG CD2 sing Y N 313 PHE CD1 CE1 sing Y N 314 PHE CD1 HD1 sing N N 315 PHE CD2 CE2 doub Y N 316 PHE CD2 HD2 sing N N 317 PHE CE1 CZ doub Y N 318 PHE CE1 HE1 sing N N 319 PHE CE2 CZ sing Y N 320 PHE CE2 HE2 sing N N 321 PHE CZ HZ sing N N 322 PHE OXT HXT sing N N 323 PRO N CA sing N N 324 PRO N CD sing N N 325 PRO N H sing N N 326 PRO CA C sing N N 327 PRO CA CB sing N N 328 PRO CA HA sing N N 329 PRO C O doub N N 330 PRO C OXT sing N N 331 PRO CB CG sing N N 332 PRO CB HB2 sing N N 333 PRO CB HB3 sing N N 334 PRO CG CD sing N N 335 PRO CG HG2 sing N N 336 PRO CG HG3 sing N N 337 PRO CD HD2 sing N N 338 PRO CD HD3 sing N N 339 PRO OXT HXT sing N N 340 SER N CA sing N N 341 SER N H sing N N 342 SER N H2 sing N N 343 SER CA C sing N N 344 SER CA CB sing N N 345 SER CA HA sing N N 346 SER C O doub N N 347 SER C OXT sing N N 348 SER CB OG sing N N 349 SER CB HB2 sing N N 350 SER CB HB3 sing N N 351 SER OG HG sing N N 352 SER OXT HXT sing N N 353 THR N CA sing N N 354 THR N H sing N N 355 THR N H2 sing N N 356 THR CA C sing N N 357 THR CA CB sing N N 358 THR CA HA sing N N 359 THR C O doub N N 360 THR C OXT sing N N 361 THR CB OG1 sing N N 362 THR CB CG2 sing N N 363 THR CB HB sing N N 364 THR OG1 HG1 sing N N 365 THR CG2 HG21 sing N N 366 THR CG2 HG22 sing N N 367 THR CG2 HG23 sing N N 368 THR OXT HXT sing N N 369 TRP N CA sing N N 370 TRP N H sing N N 371 TRP N H2 sing N N 372 TRP CA C sing N N 373 TRP CA CB sing N N 374 TRP CA HA sing N N 375 TRP C O doub N N 376 TRP C OXT sing N N 377 TRP CB CG sing N N 378 TRP CB HB2 sing N N 379 TRP CB HB3 sing N N 380 TRP CG CD1 doub Y N 381 TRP CG CD2 sing Y N 382 TRP CD1 NE1 sing Y N 383 TRP CD1 HD1 sing N N 384 TRP CD2 CE2 doub Y N 385 TRP CD2 CE3 sing Y N 386 TRP NE1 CE2 sing Y N 387 TRP NE1 HE1 sing N N 388 TRP CE2 CZ2 sing Y N 389 TRP CE3 CZ3 doub Y N 390 TRP CE3 HE3 sing N N 391 TRP CZ2 CH2 doub Y N 392 TRP CZ2 HZ2 sing N N 393 TRP CZ3 CH2 sing Y N 394 TRP CZ3 HZ3 sing N N 395 TRP CH2 HH2 sing N N 396 TRP OXT HXT sing N N 397 TYR N CA sing N N 398 TYR N H sing N N 399 TYR N H2 sing N N 400 TYR CA C sing N N 401 TYR CA CB sing N N 402 TYR CA HA sing N N 403 TYR C O doub N N 404 TYR C OXT sing N N 405 TYR CB CG sing N N 406 TYR CB HB2 sing N N 407 TYR CB HB3 sing N N 408 TYR CG CD1 doub Y N 409 TYR CG CD2 sing Y N 410 TYR CD1 CE1 sing Y N 411 TYR CD1 HD1 sing N N 412 TYR CD2 CE2 doub Y N 413 TYR CD2 HD2 sing N N 414 TYR CE1 CZ doub Y N 415 TYR CE1 HE1 sing N N 416 TYR CE2 CZ sing Y N 417 TYR CE2 HE2 sing N N 418 TYR CZ OH sing N N 419 TYR OH HH sing N N 420 TYR OXT HXT sing N N 421 VAL N CA sing N N 422 VAL N H sing N N 423 VAL N H2 sing N N 424 VAL CA C sing N N 425 VAL CA CB sing N N 426 VAL CA HA sing N N 427 VAL C O doub N N 428 VAL C OXT sing N N 429 VAL CB CG1 sing N N 430 VAL CB CG2 sing N N 431 VAL CB HB sing N N 432 VAL CG1 HG11 sing N N 433 VAL CG1 HG12 sing N N 434 VAL CG1 HG13 sing N N 435 VAL CG2 HG21 sing N N 436 VAL CG2 HG22 sing N N 437 VAL CG2 HG23 sing N N 438 VAL OXT HXT sing N N 439 # _pdbx_audit_support.funding_organization 'The Mark Foundation' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 0WN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 0WN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6F59 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6ZU8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023198 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020297 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011942 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F N O S ZN # loop_