data_6ETP # _entry.id 6ETP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ETP pdb_00006etp 10.2210/pdb6etp/pdb WWPDB D_1200007163 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-21 2 'Structure model' 1 1 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ETP _pdbx_database_status.recvd_initial_deposition_date 2017-10-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Caterino, M.' 1 0000-0002-8470-0789 'Vergara, A.' 2 0000-0003-4135-0245 'Merlino, A.' 3 0000-0002-1045-7720 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int. J. Biol. Macromol.' _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 1879-0003 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 111 _citation.language ? _citation.page_first 1194 _citation.page_last 1205 _citation.title 'Raman-markers of X-ray radiation damage of proteins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2018.01.135 _citation.pdbx_database_id_PubMed 29374529 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vergara, A.' 1 ? primary 'Caterino, M.' 2 ? primary 'Merlino, A.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Ribonuclease pancreatic' 13708.326 1 3.1.27.5 ? ? ? 2 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 4 ? ? ? ? 3 water nat water 18.015 170 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNase 1,RNase A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_seq_one_letter_code_can ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ISOPROPYL ALCOHOL' IPA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 THR n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 LYS n 1 8 PHE n 1 9 GLU n 1 10 ARG n 1 11 GLN n 1 12 HIS n 1 13 MET n 1 14 ASP n 1 15 SER n 1 16 SER n 1 17 THR n 1 18 SER n 1 19 ALA n 1 20 ALA n 1 21 SER n 1 22 SER n 1 23 SER n 1 24 ASN n 1 25 TYR n 1 26 CYS n 1 27 ASN n 1 28 GLN n 1 29 MET n 1 30 MET n 1 31 LYS n 1 32 SER n 1 33 ARG n 1 34 ASN n 1 35 LEU n 1 36 THR n 1 37 LYS n 1 38 ASP n 1 39 ARG n 1 40 CYS n 1 41 LYS n 1 42 PRO n 1 43 VAL n 1 44 ASN n 1 45 THR n 1 46 PHE n 1 47 VAL n 1 48 HIS n 1 49 GLU n 1 50 SER n 1 51 LEU n 1 52 ALA n 1 53 ASP n 1 54 VAL n 1 55 GLN n 1 56 ALA n 1 57 VAL n 1 58 CYS n 1 59 SER n 1 60 GLN n 1 61 LYS n 1 62 ASN n 1 63 VAL n 1 64 ALA n 1 65 CYS n 1 66 LYS n 1 67 ASN n 1 68 GLY n 1 69 GLN n 1 70 THR n 1 71 ASN n 1 72 CYS n 1 73 TYR n 1 74 GLN n 1 75 SER n 1 76 TYR n 1 77 SER n 1 78 THR n 1 79 MET n 1 80 SER n 1 81 ILE n 1 82 THR n 1 83 ASP n 1 84 CYS n 1 85 ARG n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 SER n 1 90 SER n 1 91 LYS n 1 92 TYR n 1 93 PRO n 1 94 ASN n 1 95 CYS n 1 96 ALA n 1 97 TYR n 1 98 LYS n 1 99 THR n 1 100 THR n 1 101 GLN n 1 102 ALA n 1 103 ASN n 1 104 LYS n 1 105 HIS n 1 106 ILE n 1 107 ILE n 1 108 VAL n 1 109 ALA n 1 110 CYS n 1 111 GLU n 1 112 GLY n 1 113 ASN n 1 114 PRO n 1 115 TYR n 1 116 VAL n 1 117 PRO n 1 118 VAL n 1 119 HIS n 1 120 PHE n 1 121 ASP n 1 122 ALA n 1 123 SER n 1 124 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 124 _entity_src_nat.common_name Bovine _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 VAL 124 124 124 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IPA 1 201 201 IPA IPA A . C 2 IPA 1 202 202 IPA IPA A . D 2 IPA 1 203 203 IPA IPA A . E 2 IPA 1 204 204 IPA IPA A . F 3 HOH 1 301 301 HOH HOH A . F 3 HOH 2 302 302 HOH HOH A . F 3 HOH 3 303 303 HOH HOH A . F 3 HOH 4 304 304 HOH HOH A . F 3 HOH 5 305 305 HOH HOH A . F 3 HOH 6 306 306 HOH HOH A . F 3 HOH 7 307 307 HOH HOH A . F 3 HOH 8 308 308 HOH HOH A . F 3 HOH 9 309 309 HOH HOH A . F 3 HOH 10 310 310 HOH HOH A . F 3 HOH 11 311 311 HOH HOH A . F 3 HOH 12 312 312 HOH HOH A . F 3 HOH 13 313 313 HOH HOH A . F 3 HOH 14 314 314 HOH HOH A . F 3 HOH 15 315 315 HOH HOH A . F 3 HOH 16 316 316 HOH HOH A . F 3 HOH 17 317 317 HOH HOH A . F 3 HOH 18 318 318 HOH HOH A . F 3 HOH 19 319 319 HOH HOH A . F 3 HOH 20 320 320 HOH HOH A . F 3 HOH 21 321 321 HOH HOH A . F 3 HOH 22 322 322 HOH HOH A . F 3 HOH 23 323 323 HOH HOH A . F 3 HOH 24 324 324 HOH HOH A . F 3 HOH 25 325 325 HOH HOH A . F 3 HOH 26 326 326 HOH HOH A . F 3 HOH 27 327 327 HOH HOH A . F 3 HOH 28 328 328 HOH HOH A . F 3 HOH 29 329 329 HOH HOH A . F 3 HOH 30 330 330 HOH HOH A . F 3 HOH 31 331 331 HOH HOH A . F 3 HOH 32 332 332 HOH HOH A . F 3 HOH 33 333 333 HOH HOH A . F 3 HOH 34 334 334 HOH HOH A . F 3 HOH 35 335 335 HOH HOH A . F 3 HOH 36 336 336 HOH HOH A . F 3 HOH 37 337 337 HOH HOH A . F 3 HOH 38 338 338 HOH HOH A . F 3 HOH 39 339 339 HOH HOH A . F 3 HOH 40 340 340 HOH HOH A . F 3 HOH 41 341 341 HOH HOH A . F 3 HOH 42 342 342 HOH HOH A . F 3 HOH 43 343 343 HOH HOH A . F 3 HOH 44 344 344 HOH HOH A . F 3 HOH 45 345 345 HOH HOH A . F 3 HOH 46 346 346 HOH HOH A . F 3 HOH 47 347 347 HOH HOH A . F 3 HOH 48 348 348 HOH HOH A . F 3 HOH 49 349 349 HOH HOH A . F 3 HOH 50 350 350 HOH HOH A . F 3 HOH 51 351 351 HOH HOH A . F 3 HOH 52 352 352 HOH HOH A . F 3 HOH 53 353 353 HOH HOH A . F 3 HOH 54 354 354 HOH HOH A . F 3 HOH 55 355 355 HOH HOH A . F 3 HOH 56 356 356 HOH HOH A . F 3 HOH 57 357 357 HOH HOH A . F 3 HOH 58 358 358 HOH HOH A . F 3 HOH 59 359 359 HOH HOH A . F 3 HOH 60 360 360 HOH HOH A . F 3 HOH 61 361 361 HOH HOH A . F 3 HOH 62 362 362 HOH HOH A . F 3 HOH 63 363 363 HOH HOH A . F 3 HOH 64 364 364 HOH HOH A . F 3 HOH 65 365 365 HOH HOH A . F 3 HOH 66 366 366 HOH HOH A . F 3 HOH 67 367 367 HOH HOH A . F 3 HOH 68 368 368 HOH HOH A . F 3 HOH 69 369 369 HOH HOH A . F 3 HOH 70 370 370 HOH HOH A . F 3 HOH 71 371 371 HOH HOH A . F 3 HOH 72 372 372 HOH HOH A . F 3 HOH 73 373 373 HOH HOH A . F 3 HOH 74 374 374 HOH HOH A . F 3 HOH 75 375 375 HOH HOH A . F 3 HOH 76 376 376 HOH HOH A . F 3 HOH 77 377 377 HOH HOH A . F 3 HOH 78 378 378 HOH HOH A . F 3 HOH 79 379 379 HOH HOH A . F 3 HOH 80 380 380 HOH HOH A . F 3 HOH 81 381 381 HOH HOH A . F 3 HOH 82 382 382 HOH HOH A . F 3 HOH 83 383 383 HOH HOH A . F 3 HOH 84 384 384 HOH HOH A . F 3 HOH 85 385 385 HOH HOH A . F 3 HOH 86 386 386 HOH HOH A . F 3 HOH 87 387 387 HOH HOH A . F 3 HOH 88 388 388 HOH HOH A . F 3 HOH 89 389 389 HOH HOH A . F 3 HOH 90 390 390 HOH HOH A . F 3 HOH 91 391 391 HOH HOH A . F 3 HOH 92 392 392 HOH HOH A . F 3 HOH 93 393 393 HOH HOH A . F 3 HOH 94 394 394 HOH HOH A . F 3 HOH 95 395 395 HOH HOH A . F 3 HOH 96 396 396 HOH HOH A . F 3 HOH 97 397 397 HOH HOH A . F 3 HOH 98 398 398 HOH HOH A . F 3 HOH 99 399 399 HOH HOH A . F 3 HOH 100 400 400 HOH HOH A . F 3 HOH 101 401 401 HOH HOH A . F 3 HOH 102 402 402 HOH HOH A . F 3 HOH 103 403 403 HOH HOH A . F 3 HOH 104 404 404 HOH HOH A . F 3 HOH 105 405 405 HOH HOH A . F 3 HOH 106 406 406 HOH HOH A . F 3 HOH 107 407 407 HOH HOH A . F 3 HOH 108 408 408 HOH HOH A . F 3 HOH 109 409 409 HOH HOH A . F 3 HOH 110 410 410 HOH HOH A . F 3 HOH 111 411 411 HOH HOH A . F 3 HOH 112 412 412 HOH HOH A . F 3 HOH 113 413 413 HOH HOH A . F 3 HOH 114 414 414 HOH HOH A . F 3 HOH 115 415 415 HOH HOH A . F 3 HOH 116 416 416 HOH HOH A . F 3 HOH 117 417 417 HOH HOH A . F 3 HOH 118 418 418 HOH HOH A . F 3 HOH 119 419 419 HOH HOH A . F 3 HOH 120 420 420 HOH HOH A . F 3 HOH 121 421 421 HOH HOH A . F 3 HOH 122 422 422 HOH HOH A . F 3 HOH 123 423 423 HOH HOH A . F 3 HOH 124 424 424 HOH HOH A . F 3 HOH 125 425 425 HOH HOH A . F 3 HOH 126 426 426 HOH HOH A . F 3 HOH 127 427 427 HOH HOH A . F 3 HOH 128 428 428 HOH HOH A . F 3 HOH 129 429 429 HOH HOH A . F 3 HOH 130 430 430 HOH HOH A . F 3 HOH 131 431 431 HOH HOH A . F 3 HOH 132 432 432 HOH HOH A . F 3 HOH 133 433 433 HOH HOH A . F 3 HOH 134 434 434 HOH HOH A . F 3 HOH 135 435 435 HOH HOH A . F 3 HOH 136 436 436 HOH HOH A . F 3 HOH 137 437 437 HOH HOH A . F 3 HOH 138 438 438 HOH HOH A . F 3 HOH 139 439 439 HOH HOH A . F 3 HOH 140 440 440 HOH HOH A . F 3 HOH 141 441 441 HOH HOH A . F 3 HOH 142 442 442 HOH HOH A . F 3 HOH 143 443 443 HOH HOH A . F 3 HOH 144 444 444 HOH HOH A . F 3 HOH 145 445 445 HOH HOH A . F 3 HOH 146 446 446 HOH HOH A . F 3 HOH 147 447 447 HOH HOH A . F 3 HOH 148 448 448 HOH HOH A . F 3 HOH 149 449 449 HOH HOH A . F 3 HOH 150 450 450 HOH HOH A . F 3 HOH 151 451 451 HOH HOH A . F 3 HOH 152 452 452 HOH HOH A . F 3 HOH 153 453 453 HOH HOH A . F 3 HOH 154 454 454 HOH HOH A . F 3 HOH 155 455 455 HOH HOH A . F 3 HOH 156 456 456 HOH HOH A . F 3 HOH 157 457 457 HOH HOH A . F 3 HOH 158 458 458 HOH HOH A . F 3 HOH 159 459 459 HOH HOH A . F 3 HOH 160 460 460 HOH HOH A . F 3 HOH 161 461 461 HOH HOH A . F 3 HOH 162 462 462 HOH HOH A . F 3 HOH 163 463 463 HOH HOH A . F 3 HOH 164 464 464 HOH HOH A . F 3 HOH 165 465 465 HOH HOH A . F 3 HOH 166 466 466 HOH HOH A . F 3 HOH 167 467 467 HOH HOH A . F 3 HOH 168 468 468 HOH HOH A . F 3 HOH 169 469 470 HOH HOH A . F 3 HOH 170 470 469 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? SHELXL ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.entry_id 6ETP _cell.length_a 29.125 _cell.length_b 37.971 _cell.length_c 52.541 _cell.angle_alpha 90.00 _cell.angle_beta 105.83 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ETP _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ETP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIQUID DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Free-interface diffusion of a 10 uL of 30 mg ml-1 protein solution, 20 mM sodium citrate at pH 5.3 agaist 10 ul isopropanol 99.9% isopropanol. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-09-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.7749 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.7749 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 6ETP _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 1.020 _reflns.number_obs 51404 _reflns.number_all ? _reflns.percent_possible_obs 91.9 _reflns.pdbx_Rmerge_I_obs 0.05600 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 8.6500 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.600 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.02 _reflns_shell.d_res_low 1.06 _reflns_shell.percent_possible_all 89.6 _reflns_shell.Rmerge_I_obs 0.43100 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.470 _reflns_shell.pdbx_redundancy 3.40 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 6ETP _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 41368 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 1.02 _refine.ls_percent_reflns_obs 89.6 _refine.ls_R_factor_obs 0.1456 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1401 _refine.ls_R_factor_R_free 0.1780 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 2185 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 1KF3 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 951 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 170 _refine_hist.number_atoms_total 1137 _refine_hist.d_res_high 1.02 _refine_hist.d_res_low 50.00 # _struct.entry_id 6ETP _struct.title 'Atomic resolution structure of RNase A (data collection 6)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ETP _struct_keywords.text 'Raman microspectroscopy, ribonuclease, atomic resolution, radiation damage, photodamage, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNAS1_BOVIN _struct_ref.pdbx_db_accession P61823 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _struct_ref.pdbx_align_begin 27 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ETP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61823 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 460 ? 1 MORE 6 ? 1 'SSA (A^2)' 7030 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? MET A 13 ? THR A 3 MET A 13 1 ? 11 HELX_P HELX_P2 AA2 ASN A 24 ? ARG A 33 ? ASN A 24 ARG A 33 1 ? 10 HELX_P HELX_P3 AA3 SER A 50 ? ALA A 56 ? SER A 50 ALA A 56 1 ? 7 HELX_P HELX_P4 AA4 VAL A 57 ? GLN A 60 ? VAL A 57 GLN A 60 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 26 A CYS 84 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 40 A CYS 95 1_555 ? ? ? ? ? ? ? 2.049 ? ? disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf4 disulf ? ? A CYS 65 SG A ? ? 1_555 A CYS 72 SG A ? A CYS 65 A CYS 72 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf5 disulf ? ? A CYS 65 SG B ? ? 1_555 A CYS 72 SG B ? A CYS 65 A CYS 72 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 1 3.09 2 ASN 113 A . ? ASN 113 A PRO 114 A ? PRO 114 A 1 3.68 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 43 ? VAL A 47 ? VAL A 43 VAL A 47 AA1 2 MET A 79 ? GLU A 86 ? MET A 79 GLU A 86 AA1 3 TYR A 97 ? LYS A 104 ? TYR A 97 LYS A 104 AA2 1 LYS A 61 ? VAL A 63 ? LYS A 61 VAL A 63 AA2 2 CYS A 72 ? GLN A 74 ? CYS A 72 GLN A 74 AA2 3 ILE A 106 ? GLU A 111 ? ILE A 106 GLU A 111 AA2 4 VAL A 116 ? SER A 123 ? VAL A 116 SER A 123 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 44 ? N ASN A 44 O CYS A 84 ? O CYS A 84 AA1 2 3 N ARG A 85 ? N ARG A 85 O LYS A 98 ? O LYS A 98 AA2 1 2 N LYS A 61 ? N LYS A 61 O GLN A 74 ? O GLN A 74 AA2 2 3 N TYR A 73 ? N TYR A 73 O VAL A 108 ? O VAL A 108 AA2 3 4 N ALA A 109 ? N ALA A 109 O VAL A 118 ? O VAL A 118 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A IPA 201 ? 6 'binding site for residue IPA A 201' AC2 Software A IPA 202 ? 2 'binding site for residue IPA A 202' AC3 Software A IPA 203 ? 5 'binding site for residue IPA A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ARG A 33 ? ARG A 33 . ? 1_655 ? 2 AC1 6 LYS A 61 ? LYS A 61 . ? 1_555 ? 3 AC1 6 VAL A 63 ? VAL A 63 . ? 1_555 ? 4 AC1 6 GLN A 74 ? GLN A 74 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 319 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 352 . ? 1_555 ? 7 AC2 2 GLN A 101 ? GLN A 101 . ? 1_555 ? 8 AC2 2 ASN A 103 ? ASN A 103 . ? 1_555 ? 9 AC3 5 ARG A 85 ? ARG A 85 . ? 1_555 ? 10 AC3 5 GLU A 86 ? GLU A 86 . ? 1_555 ? 11 AC3 5 LYS A 98 ? LYS A 98 . ? 1_555 ? 12 AC3 5 HOH F . ? HOH A 317 . ? 1_555 ? 13 AC3 5 HOH F . ? HOH A 431 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 123.50 120.30 3.20 0.50 N 2 1 N A CYS 72 ? ? CA A CYS 72 ? A CB A CYS 72 ? A 121.28 110.80 10.48 1.50 N 3 1 CA A CYS 72 ? B CB A CYS 72 ? B SG A CYS 72 ? B 102.01 114.00 -11.99 1.80 N 4 1 CD A ARG 85 ? ? NE A ARG 85 ? ? CZ A ARG 85 ? ? 134.94 123.60 11.34 1.40 N 5 1 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 124.27 120.30 3.97 0.50 N 6 1 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH2 A ARG 85 ? ? 116.96 120.30 -3.34 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 60 ? ? -105.77 -138.41 2 1 ASN A 71 ? ? -97.02 35.73 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 470 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.99 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 IPA C1 C N N 183 IPA C2 C N N 184 IPA C3 C N N 185 IPA O2 O N N 186 IPA H11 H N N 187 IPA H12 H N N 188 IPA H13 H N N 189 IPA H2 H N N 190 IPA H31 H N N 191 IPA H32 H N N 192 IPA H33 H N N 193 IPA HO2 H N N 194 LEU N N N N 195 LEU CA C N S 196 LEU C C N N 197 LEU O O N N 198 LEU CB C N N 199 LEU CG C N N 200 LEU CD1 C N N 201 LEU CD2 C N N 202 LEU OXT O N N 203 LEU H H N N 204 LEU H2 H N N 205 LEU HA H N N 206 LEU HB2 H N N 207 LEU HB3 H N N 208 LEU HG H N N 209 LEU HD11 H N N 210 LEU HD12 H N N 211 LEU HD13 H N N 212 LEU HD21 H N N 213 LEU HD22 H N N 214 LEU HD23 H N N 215 LEU HXT H N N 216 LYS N N N N 217 LYS CA C N S 218 LYS C C N N 219 LYS O O N N 220 LYS CB C N N 221 LYS CG C N N 222 LYS CD C N N 223 LYS CE C N N 224 LYS NZ N N N 225 LYS OXT O N N 226 LYS H H N N 227 LYS H2 H N N 228 LYS HA H N N 229 LYS HB2 H N N 230 LYS HB3 H N N 231 LYS HG2 H N N 232 LYS HG3 H N N 233 LYS HD2 H N N 234 LYS HD3 H N N 235 LYS HE2 H N N 236 LYS HE3 H N N 237 LYS HZ1 H N N 238 LYS HZ2 H N N 239 LYS HZ3 H N N 240 LYS HXT H N N 241 MET N N N N 242 MET CA C N S 243 MET C C N N 244 MET O O N N 245 MET CB C N N 246 MET CG C N N 247 MET SD S N N 248 MET CE C N N 249 MET OXT O N N 250 MET H H N N 251 MET H2 H N N 252 MET HA H N N 253 MET HB2 H N N 254 MET HB3 H N N 255 MET HG2 H N N 256 MET HG3 H N N 257 MET HE1 H N N 258 MET HE2 H N N 259 MET HE3 H N N 260 MET HXT H N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TYR N N N N 333 TYR CA C N S 334 TYR C C N N 335 TYR O O N N 336 TYR CB C N N 337 TYR CG C Y N 338 TYR CD1 C Y N 339 TYR CD2 C Y N 340 TYR CE1 C Y N 341 TYR CE2 C Y N 342 TYR CZ C Y N 343 TYR OH O N N 344 TYR OXT O N N 345 TYR H H N N 346 TYR H2 H N N 347 TYR HA H N N 348 TYR HB2 H N N 349 TYR HB3 H N N 350 TYR HD1 H N N 351 TYR HD2 H N N 352 TYR HE1 H N N 353 TYR HE2 H N N 354 TYR HH H N N 355 TYR HXT H N N 356 VAL N N N N 357 VAL CA C N S 358 VAL C C N N 359 VAL O O N N 360 VAL CB C N N 361 VAL CG1 C N N 362 VAL CG2 C N N 363 VAL OXT O N N 364 VAL H H N N 365 VAL H2 H N N 366 VAL HA H N N 367 VAL HB H N N 368 VAL HG11 H N N 369 VAL HG12 H N N 370 VAL HG13 H N N 371 VAL HG21 H N N 372 VAL HG22 H N N 373 VAL HG23 H N N 374 VAL HXT H N N 375 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 IPA C1 C2 sing N N 173 IPA C1 H11 sing N N 174 IPA C1 H12 sing N N 175 IPA C1 H13 sing N N 176 IPA C2 C3 sing N N 177 IPA C2 O2 sing N N 178 IPA C2 H2 sing N N 179 IPA C3 H31 sing N N 180 IPA C3 H32 sing N N 181 IPA C3 H33 sing N N 182 IPA O2 HO2 sing N N 183 LEU N CA sing N N 184 LEU N H sing N N 185 LEU N H2 sing N N 186 LEU CA C sing N N 187 LEU CA CB sing N N 188 LEU CA HA sing N N 189 LEU C O doub N N 190 LEU C OXT sing N N 191 LEU CB CG sing N N 192 LEU CB HB2 sing N N 193 LEU CB HB3 sing N N 194 LEU CG CD1 sing N N 195 LEU CG CD2 sing N N 196 LEU CG HG sing N N 197 LEU CD1 HD11 sing N N 198 LEU CD1 HD12 sing N N 199 LEU CD1 HD13 sing N N 200 LEU CD2 HD21 sing N N 201 LEU CD2 HD22 sing N N 202 LEU CD2 HD23 sing N N 203 LEU OXT HXT sing N N 204 LYS N CA sing N N 205 LYS N H sing N N 206 LYS N H2 sing N N 207 LYS CA C sing N N 208 LYS CA CB sing N N 209 LYS CA HA sing N N 210 LYS C O doub N N 211 LYS C OXT sing N N 212 LYS CB CG sing N N 213 LYS CB HB2 sing N N 214 LYS CB HB3 sing N N 215 LYS CG CD sing N N 216 LYS CG HG2 sing N N 217 LYS CG HG3 sing N N 218 LYS CD CE sing N N 219 LYS CD HD2 sing N N 220 LYS CD HD3 sing N N 221 LYS CE NZ sing N N 222 LYS CE HE2 sing N N 223 LYS CE HE3 sing N N 224 LYS NZ HZ1 sing N N 225 LYS NZ HZ2 sing N N 226 LYS NZ HZ3 sing N N 227 LYS OXT HXT sing N N 228 MET N CA sing N N 229 MET N H sing N N 230 MET N H2 sing N N 231 MET CA C sing N N 232 MET CA CB sing N N 233 MET CA HA sing N N 234 MET C O doub N N 235 MET C OXT sing N N 236 MET CB CG sing N N 237 MET CB HB2 sing N N 238 MET CB HB3 sing N N 239 MET CG SD sing N N 240 MET CG HG2 sing N N 241 MET CG HG3 sing N N 242 MET SD CE sing N N 243 MET CE HE1 sing N N 244 MET CE HE2 sing N N 245 MET CE HE3 sing N N 246 MET OXT HXT sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TYR N CA sing N N 317 TYR N H sing N N 318 TYR N H2 sing N N 319 TYR CA C sing N N 320 TYR CA CB sing N N 321 TYR CA HA sing N N 322 TYR C O doub N N 323 TYR C OXT sing N N 324 TYR CB CG sing N N 325 TYR CB HB2 sing N N 326 TYR CB HB3 sing N N 327 TYR CG CD1 doub Y N 328 TYR CG CD2 sing Y N 329 TYR CD1 CE1 sing Y N 330 TYR CD1 HD1 sing N N 331 TYR CD2 CE2 doub Y N 332 TYR CD2 HD2 sing N N 333 TYR CE1 CZ doub Y N 334 TYR CE1 HE1 sing N N 335 TYR CE2 CZ sing Y N 336 TYR CE2 HE2 sing N N 337 TYR CZ OH sing N N 338 TYR OH HH sing N N 339 TYR OXT HXT sing N N 340 VAL N CA sing N N 341 VAL N H sing N N 342 VAL N H2 sing N N 343 VAL CA C sing N N 344 VAL CA CB sing N N 345 VAL CA HA sing N N 346 VAL C O doub N N 347 VAL C OXT sing N N 348 VAL CB CG1 sing N N 349 VAL CB CG2 sing N N 350 VAL CB HB sing N N 351 VAL CG1 HG11 sing N N 352 VAL CG1 HG12 sing N N 353 VAL CG1 HG13 sing N N 354 VAL CG2 HG21 sing N N 355 VAL CG2 HG22 sing N N 356 VAL CG2 HG23 sing N N 357 VAL OXT HXT sing N N 358 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1KF3 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6ETP _atom_sites.fract_transf_matrix[1][1] 0.034335 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009735 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026336 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019783 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_