data_6FXO # _entry.id 6FXO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FXO pdb_00006fxo 10.2210/pdb6fxo/pdb WWPDB D_1200008652 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-20 2 'Structure model' 2 0 2020-07-22 3 'Structure model' 2 1 2020-09-30 4 'Structure model' 2 2 2024-05-01 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Polymer geometry' ;Dear Deposit-Help, We updated our 6FXO deposit on the initiative of a reviewer. Due to low intensity of data, we decided to truncate resolution to 2.5A. Best, Sara and Dusan ; # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Author supporting evidence' 4 2 'Structure model' 'Data collection' 5 2 'Structure model' 'Database references' 6 2 'Structure model' 'Derived calculations' 7 2 'Structure model' Other 8 2 'Structure model' 'Polymer sequence' 9 2 'Structure model' 'Refinement description' 10 2 'Structure model' 'Source and taxonomy' 11 2 'Structure model' 'Structure summary' 12 3 'Structure model' 'Database references' 13 4 'Structure model' Advisory 14 4 'Structure model' 'Data collection' 15 4 'Structure model' 'Database references' 16 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' cell 3 2 'Structure model' computing 4 2 'Structure model' diffrn 5 2 'Structure model' entity 6 2 'Structure model' entity_poly 7 2 'Structure model' entity_poly_seq 8 2 'Structure model' entity_src_gen 9 2 'Structure model' pdbx_audit_support 10 2 'Structure model' pdbx_distant_solvent_atoms 11 2 'Structure model' pdbx_entry_details 12 2 'Structure model' pdbx_nonpoly_scheme 13 2 'Structure model' pdbx_poly_seq_scheme 14 2 'Structure model' pdbx_struct_assembly 15 2 'Structure model' pdbx_struct_assembly_gen 16 2 'Structure model' pdbx_struct_assembly_prop 17 2 'Structure model' pdbx_struct_sheet_hbond 18 2 'Structure model' pdbx_struct_special_symmetry 19 2 'Structure model' pdbx_unobs_or_zero_occ_residues 20 2 'Structure model' pdbx_validate_rmsd_angle 21 2 'Structure model' pdbx_validate_symm_contact 22 2 'Structure model' pdbx_validate_torsion 23 2 'Structure model' refine 24 2 'Structure model' refine_hist 25 2 'Structure model' refine_ls_shell 26 2 'Structure model' reflns 27 2 'Structure model' reflns_shell 28 2 'Structure model' struct_asym 29 2 'Structure model' struct_conf 30 2 'Structure model' struct_ref_seq 31 2 'Structure model' struct_ref_seq_dif 32 2 'Structure model' struct_sheet 33 2 'Structure model' struct_sheet_order 34 2 'Structure model' struct_sheet_range 35 2 'Structure model' struct_site 36 2 'Structure model' struct_site_gen 37 3 'Structure model' citation 38 3 'Structure model' citation_author 39 4 'Structure model' chem_comp_atom 40 4 'Structure model' chem_comp_bond 41 4 'Structure model' database_2 42 4 'Structure model' pdbx_initial_refinement_model 43 4 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_cell.length_a' 2 2 'Structure model' '_cell.length_b' 3 2 'Structure model' '_diffrn.pdbx_serial_crystal_experiment' 4 2 'Structure model' '_entity.formula_weight' 5 2 'Structure model' '_entity.pdbx_number_of_molecules' 6 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 7 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 8 2 'Structure model' '_entity_src_gen.gene_src_strain' 9 2 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 10 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 11 2 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 12 2 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 13 2 'Structure model' '_pdbx_audit_support.funding_organization' 14 2 'Structure model' '_pdbx_struct_assembly.details' 15 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 16 2 'Structure model' '_pdbx_struct_assembly_prop.value' 17 2 'Structure model' '_refine.B_iso_max' 18 2 'Structure model' '_refine.B_iso_mean' 19 2 'Structure model' '_refine.B_iso_min' 20 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 21 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 22 2 'Structure model' '_refine.details' 23 2 'Structure model' '_refine.ls_R_factor_R_free' 24 2 'Structure model' '_refine.ls_R_factor_R_work' 25 2 'Structure model' '_refine.ls_R_factor_all' 26 2 'Structure model' '_refine.ls_R_factor_obs' 27 2 'Structure model' '_refine.ls_d_res_high' 28 2 'Structure model' '_refine.ls_d_res_low' 29 2 'Structure model' '_refine.ls_number_reflns_R_free' 30 2 'Structure model' '_refine.ls_number_reflns_R_work' 31 2 'Structure model' '_refine.ls_number_reflns_obs' 32 2 'Structure model' '_refine.pdbx_ls_cross_valid_method' 33 2 'Structure model' '_refine.pdbx_method_to_determine_struct' 34 2 'Structure model' '_refine.pdbx_overall_phase_error' 35 2 'Structure model' '_refine.pdbx_stereochemistry_target_values' 36 2 'Structure model' '_refine.solvent_model_details' 37 2 'Structure model' '_refine.solvent_model_param_bsol' 38 2 'Structure model' '_refine.solvent_model_param_ksol' 39 2 'Structure model' '_refine_hist.d_res_high' 40 2 'Structure model' '_refine_hist.d_res_low' 41 2 'Structure model' '_refine_hist.number_atoms_solvent' 42 2 'Structure model' '_refine_hist.number_atoms_total' 43 2 'Structure model' '_refine_hist.pdbx_number_atoms_ligand' 44 2 'Structure model' '_refine_ls_shell.R_factor_R_free' 45 2 'Structure model' '_refine_ls_shell.R_factor_R_work' 46 2 'Structure model' '_refine_ls_shell.d_res_high' 47 2 'Structure model' '_refine_ls_shell.d_res_low' 48 2 'Structure model' '_refine_ls_shell.number_reflns_R_free' 49 2 'Structure model' '_refine_ls_shell.number_reflns_R_work' 50 2 'Structure model' '_refine_ls_shell.number_reflns_all' 51 2 'Structure model' '_refine_ls_shell.number_reflns_obs' 52 2 'Structure model' '_reflns.pdbx_CC_half' 53 2 'Structure model' '_reflns.pdbx_Rrim_I_all' 54 2 'Structure model' '_reflns_shell.meanI_over_sigI_obs' 55 2 'Structure model' '_reflns_shell.number_unique_obs' 56 2 'Structure model' '_reflns_shell.pdbx_CC_half' 57 2 'Structure model' '_reflns_shell.pdbx_Rrim_I_all' 58 2 'Structure model' '_reflns_shell.percent_possible_all' 59 2 'Structure model' '_struct_ref_seq.seq_align_beg' 60 2 'Structure model' '_struct_ref_seq.seq_align_end' 61 3 'Structure model' '_citation.country' 62 3 'Structure model' '_citation.journal_abbrev' 63 3 'Structure model' '_citation.journal_id_CSD' 64 3 'Structure model' '_citation.journal_id_ISSN' 65 3 'Structure model' '_citation.journal_volume' 66 3 'Structure model' '_citation.page_first' 67 3 'Structure model' '_citation.page_last' 68 3 'Structure model' '_citation.pdbx_database_id_DOI' 69 3 'Structure model' '_citation.pdbx_database_id_PubMed' 70 3 'Structure model' '_citation.title' 71 3 'Structure model' '_citation.year' 72 4 'Structure model' '_database_2.pdbx_DOI' 73 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FXO _pdbx_database_status.recvd_initial_deposition_date 2018-03-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pintar, S.' 1 0000-0002-9262-5360 'Turk, D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3642 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 3 _citation.language ? _citation.page_first 178 _citation.page_last 178 _citation.title 'Domain sliding of two Staphylococcus aureus N-acetylglucosaminidases enables their substrate-binding prior to its catalysis.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42003-020-0911-7 _citation.pdbx_database_id_PubMed 32313083 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pintar, S.' 1 ? primary 'Borisek, J.' 2 ? primary 'Usenik, A.' 3 ? primary 'Perdih, A.' 4 0000-0002-6645-9231 primary 'Turk, D.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bifunctional autolysin' 27211.752 1 3.5.1.28,3.2.1.96 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 3 water nat water 18.015 54 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AAELIKYNQTGMTLNQVAQIQAGLQYKPQVQRVPGKWTDANFNDVKHAMDTKRLAQDPALKYQFLRLDQPQNISIDKINQ FLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGADVVNNKVVTNSNTKYHNVFGIAAYDNDPLREG IKYAKQAGWDTVSKAIVGGAKFIGNSYVKAGQNTLYKMRWNPAHPGTHQYATDVDWANINAKIIKGYYDKIGEVGKYFDI PQYK ; _entity_poly.pdbx_seq_one_letter_code_can ;AAELIKYNQTGMTLNQVAQIQAGLQYKPQVQRVPGKWTDANFNDVKHAMDTKRLAQDPALKYQFLRLDQPQNISIDKINQ FLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGADVVNNKVVTNSNTKYHNVFGIAAYDNDPLREG IKYAKQAGWDTVSKAIVGGAKFIGNSYVKAGQNTLYKMRWNPAHPGTHQYATDVDWANINAKIIKGYYDKIGEVGKYFDI PQYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ALA n 1 3 GLU n 1 4 LEU n 1 5 ILE n 1 6 LYS n 1 7 TYR n 1 8 ASN n 1 9 GLN n 1 10 THR n 1 11 GLY n 1 12 MET n 1 13 THR n 1 14 LEU n 1 15 ASN n 1 16 GLN n 1 17 VAL n 1 18 ALA n 1 19 GLN n 1 20 ILE n 1 21 GLN n 1 22 ALA n 1 23 GLY n 1 24 LEU n 1 25 GLN n 1 26 TYR n 1 27 LYS n 1 28 PRO n 1 29 GLN n 1 30 VAL n 1 31 GLN n 1 32 ARG n 1 33 VAL n 1 34 PRO n 1 35 GLY n 1 36 LYS n 1 37 TRP n 1 38 THR n 1 39 ASP n 1 40 ALA n 1 41 ASN n 1 42 PHE n 1 43 ASN n 1 44 ASP n 1 45 VAL n 1 46 LYS n 1 47 HIS n 1 48 ALA n 1 49 MET n 1 50 ASP n 1 51 THR n 1 52 LYS n 1 53 ARG n 1 54 LEU n 1 55 ALA n 1 56 GLN n 1 57 ASP n 1 58 PRO n 1 59 ALA n 1 60 LEU n 1 61 LYS n 1 62 TYR n 1 63 GLN n 1 64 PHE n 1 65 LEU n 1 66 ARG n 1 67 LEU n 1 68 ASP n 1 69 GLN n 1 70 PRO n 1 71 GLN n 1 72 ASN n 1 73 ILE n 1 74 SER n 1 75 ILE n 1 76 ASP n 1 77 LYS n 1 78 ILE n 1 79 ASN n 1 80 GLN n 1 81 PHE n 1 82 LEU n 1 83 LYS n 1 84 GLY n 1 85 LYS n 1 86 GLY n 1 87 VAL n 1 88 LEU n 1 89 GLU n 1 90 ASN n 1 91 GLN n 1 92 GLY n 1 93 ALA n 1 94 ALA n 1 95 PHE n 1 96 ASN n 1 97 LYS n 1 98 ALA n 1 99 ALA n 1 100 GLN n 1 101 MET n 1 102 TYR n 1 103 GLY n 1 104 ILE n 1 105 ASN n 1 106 GLU n 1 107 VAL n 1 108 TYR n 1 109 LEU n 1 110 ILE n 1 111 SER n 1 112 HIS n 1 113 ALA n 1 114 LEU n 1 115 LEU n 1 116 GLU n 1 117 THR n 1 118 GLY n 1 119 ASN n 1 120 GLY n 1 121 THR n 1 122 SER n 1 123 GLN n 1 124 LEU n 1 125 ALA n 1 126 LYS n 1 127 GLY n 1 128 ALA n 1 129 ASP n 1 130 VAL n 1 131 VAL n 1 132 ASN n 1 133 ASN n 1 134 LYS n 1 135 VAL n 1 136 VAL n 1 137 THR n 1 138 ASN n 1 139 SER n 1 140 ASN n 1 141 THR n 1 142 LYS n 1 143 TYR n 1 144 HIS n 1 145 ASN n 1 146 VAL n 1 147 PHE n 1 148 GLY n 1 149 ILE n 1 150 ALA n 1 151 ALA n 1 152 TYR n 1 153 ASP n 1 154 ASN n 1 155 ASP n 1 156 PRO n 1 157 LEU n 1 158 ARG n 1 159 GLU n 1 160 GLY n 1 161 ILE n 1 162 LYS n 1 163 TYR n 1 164 ALA n 1 165 LYS n 1 166 GLN n 1 167 ALA n 1 168 GLY n 1 169 TRP n 1 170 ASP n 1 171 THR n 1 172 VAL n 1 173 SER n 1 174 LYS n 1 175 ALA n 1 176 ILE n 1 177 VAL n 1 178 GLY n 1 179 GLY n 1 180 ALA n 1 181 LYS n 1 182 PHE n 1 183 ILE n 1 184 GLY n 1 185 ASN n 1 186 SER n 1 187 TYR n 1 188 VAL n 1 189 LYS n 1 190 ALA n 1 191 GLY n 1 192 GLN n 1 193 ASN n 1 194 THR n 1 195 LEU n 1 196 TYR n 1 197 LYS n 1 198 MET n 1 199 ARG n 1 200 TRP n 1 201 ASN n 1 202 PRO n 1 203 ALA n 1 204 HIS n 1 205 PRO n 1 206 GLY n 1 207 THR n 1 208 HIS n 1 209 GLN n 1 210 TYR n 1 211 ALA n 1 212 THR n 1 213 ASP n 1 214 VAL n 1 215 ASP n 1 216 TRP n 1 217 ALA n 1 218 ASN n 1 219 ILE n 1 220 ASN n 1 221 ALA n 1 222 LYS n 1 223 ILE n 1 224 ILE n 1 225 LYS n 1 226 GLY n 1 227 TYR n 1 228 TYR n 1 229 ASP n 1 230 LYS n 1 231 ILE n 1 232 GLY n 1 233 GLU n 1 234 VAL n 1 235 GLY n 1 236 LYS n 1 237 TYR n 1 238 PHE n 1 239 ASP n 1 240 ILE n 1 241 PRO n 1 242 GLN n 1 243 TYR n 1 244 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 244 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'atl, nag, SAV1052' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus Mu50' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158878 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ALA 128 127 ? ? ? A A n A 1 129 ASP 129 127 ? ? ? A B n A 1 130 VAL 130 127 ? ? ? A C n A 1 131 VAL 131 127 ? ? ? A D n A 1 132 ASN 132 127 ? ? ? A E n A 1 133 ASN 133 127 ? ? ? A F n A 1 134 LYS 134 127 ? ? ? A G n A 1 135 VAL 135 127 ? ? ? A H n A 1 136 VAL 136 127 ? ? ? A I n A 1 137 THR 137 127 ? ? ? A J n A 1 138 ASN 138 127 ? ? ? A K n A 1 139 SER 139 127 ? ? ? A L n A 1 140 ASN 140 127 ? ? ? A M n A 1 141 THR 141 128 128 THR THR A . n A 1 142 LYS 142 129 129 LYS LYS A . n A 1 143 TYR 143 130 130 TYR TYR A . n A 1 144 HIS 144 131 131 HIS HIS A . n A 1 145 ASN 145 132 132 ASN ASN A . n A 1 146 VAL 146 133 133 VAL VAL A . n A 1 147 PHE 147 134 134 PHE PHE A . n A 1 148 GLY 148 135 135 GLY GLY A . n A 1 149 ILE 149 136 136 ILE ILE A . n A 1 150 ALA 150 137 137 ALA ALA A . n A 1 151 ALA 151 138 138 ALA ALA A . n A 1 152 TYR 152 139 139 TYR TYR A . n A 1 153 ASP 153 140 140 ASP ASP A . n A 1 154 ASN 154 141 141 ASN ASN A . n A 1 155 ASP 155 142 142 ASP ASP A . n A 1 156 PRO 156 143 143 PRO PRO A . n A 1 157 LEU 157 144 144 LEU LEU A . n A 1 158 ARG 158 145 145 ARG ARG A . n A 1 159 GLU 159 146 146 GLU GLU A . n A 1 160 GLY 160 147 147 GLY GLY A . n A 1 161 ILE 161 148 148 ILE ILE A . n A 1 162 LYS 162 149 149 LYS LYS A . n A 1 163 TYR 163 150 150 TYR TYR A . n A 1 164 ALA 164 151 151 ALA ALA A . n A 1 165 LYS 165 152 152 LYS LYS A . n A 1 166 GLN 166 153 153 GLN GLN A . n A 1 167 ALA 167 154 154 ALA ALA A . n A 1 168 GLY 168 155 155 GLY GLY A . n A 1 169 TRP 169 156 156 TRP TRP A . n A 1 170 ASP 170 157 157 ASP ASP A . n A 1 171 THR 171 158 158 THR THR A . n A 1 172 VAL 172 159 159 VAL VAL A . n A 1 173 SER 173 160 160 SER SER A . n A 1 174 LYS 174 161 161 LYS LYS A . n A 1 175 ALA 175 162 162 ALA ALA A . n A 1 176 ILE 176 163 163 ILE ILE A . n A 1 177 VAL 177 164 164 VAL VAL A . n A 1 178 GLY 178 165 165 GLY GLY A . n A 1 179 GLY 179 166 166 GLY GLY A . n A 1 180 ALA 180 167 167 ALA ALA A . n A 1 181 LYS 181 168 168 LYS LYS A . n A 1 182 PHE 182 169 169 PHE PHE A . n A 1 183 ILE 183 170 170 ILE ILE A . n A 1 184 GLY 184 171 171 GLY GLY A . n A 1 185 ASN 185 172 172 ASN ASN A . n A 1 186 SER 186 173 173 SER SER A . n A 1 187 TYR 187 174 174 TYR TYR A . n A 1 188 VAL 188 175 175 VAL VAL A . n A 1 189 LYS 189 176 176 LYS LYS A . n A 1 190 ALA 190 177 177 ALA ALA A . n A 1 191 GLY 191 178 178 GLY GLY A . n A 1 192 GLN 192 179 179 GLN GLN A . n A 1 193 ASN 193 180 180 ASN ASN A . n A 1 194 THR 194 181 181 THR THR A . n A 1 195 LEU 195 182 182 LEU LEU A . n A 1 196 TYR 196 183 183 TYR TYR A . n A 1 197 LYS 197 184 184 LYS LYS A . n A 1 198 MET 198 185 185 MET MET A . n A 1 199 ARG 199 186 186 ARG ARG A . n A 1 200 TRP 200 187 187 TRP TRP A . n A 1 201 ASN 201 188 188 ASN ASN A . n A 1 202 PRO 202 189 189 PRO PRO A . n A 1 203 ALA 203 190 190 ALA ALA A . n A 1 204 HIS 204 191 191 HIS HIS A . n A 1 205 PRO 205 192 192 PRO PRO A . n A 1 206 GLY 206 193 193 GLY GLY A . n A 1 207 THR 207 194 194 THR THR A . n A 1 208 HIS 208 195 195 HIS HIS A . n A 1 209 GLN 209 196 196 GLN GLN A . n A 1 210 TYR 210 197 197 TYR TYR A . n A 1 211 ALA 211 198 198 ALA ALA A . n A 1 212 THR 212 199 199 THR THR A . n A 1 213 ASP 213 200 200 ASP ASP A . n A 1 214 VAL 214 201 201 VAL VAL A . n A 1 215 ASP 215 202 202 ASP ASP A . n A 1 216 TRP 216 203 203 TRP TRP A . n A 1 217 ALA 217 204 204 ALA ALA A . n A 1 218 ASN 218 205 205 ASN ASN A . n A 1 219 ILE 219 206 206 ILE ILE A . n A 1 220 ASN 220 207 207 ASN ASN A . n A 1 221 ALA 221 208 208 ALA ALA A . n A 1 222 LYS 222 209 209 LYS LYS A . n A 1 223 ILE 223 210 210 ILE ILE A . n A 1 224 ILE 224 211 211 ILE ILE A . n A 1 225 LYS 225 212 212 LYS LYS A . n A 1 226 GLY 226 213 213 GLY GLY A . n A 1 227 TYR 227 214 214 TYR TYR A . n A 1 228 TYR 228 215 215 TYR TYR A . n A 1 229 ASP 229 216 216 ASP ASP A . n A 1 230 LYS 230 217 217 LYS LYS A . n A 1 231 ILE 231 218 218 ILE ILE A . n A 1 232 GLY 232 219 219 GLY GLY A . n A 1 233 GLU 233 220 220 GLU GLU A . n A 1 234 VAL 234 221 221 VAL VAL A . n A 1 235 GLY 235 222 222 GLY GLY A . n A 1 236 LYS 236 223 223 LYS LYS A . n A 1 237 TYR 237 224 224 TYR TYR A . n A 1 238 PHE 238 225 225 PHE PHE A . n A 1 239 ASP 239 226 226 ASP ASP A . n A 1 240 ILE 240 227 227 ILE ILE A . n A 1 241 PRO 241 228 228 PRO PRO A . n A 1 242 GLN 242 229 229 GLN GLN A . n A 1 243 TYR 243 230 230 TYR TYR A . n A 1 244 LYS 244 231 231 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 301 265 CL CL A . C 2 CL 1 302 287 CL CL A . D 2 CL 1 303 288 CL CL A . E 3 HOH 1 401 260 HOH HOH A . E 3 HOH 2 402 254 HOH HOH A . E 3 HOH 3 403 255 HOH HOH A . E 3 HOH 4 404 286 HOH HOH A . E 3 HOH 5 405 266 HOH HOH A . E 3 HOH 6 406 278 HOH HOH A . E 3 HOH 7 407 259 HOH HOH A . E 3 HOH 8 408 256 HOH HOH A . E 3 HOH 9 409 272 HOH HOH A . E 3 HOH 10 410 252 HOH HOH A . E 3 HOH 11 411 273 HOH HOH A . E 3 HOH 12 412 245 HOH HOH A . E 3 HOH 13 413 243 HOH HOH A . E 3 HOH 14 414 279 HOH HOH A . E 3 HOH 15 415 276 HOH HOH A . E 3 HOH 16 416 285 HOH HOH A . E 3 HOH 17 417 233 HOH HOH A . E 3 HOH 18 418 261 HOH HOH A . E 3 HOH 19 419 271 HOH HOH A . E 3 HOH 20 420 275 HOH HOH A . E 3 HOH 21 421 282 HOH HOH A . E 3 HOH 22 422 234 HOH HOH A . E 3 HOH 23 423 281 HOH HOH A . E 3 HOH 24 424 280 HOH HOH A . E 3 HOH 25 425 257 HOH HOH A . E 3 HOH 26 426 244 HOH HOH A . E 3 HOH 27 427 235 HOH HOH A . E 3 HOH 28 428 258 HOH HOH A . E 3 HOH 29 429 262 HOH HOH A . E 3 HOH 30 430 274 HOH HOH A . E 3 HOH 31 431 237 HOH HOH A . E 3 HOH 32 432 248 HOH HOH A . E 3 HOH 33 433 236 HOH HOH A . E 3 HOH 34 434 238 HOH HOH A . E 3 HOH 35 435 250 HOH HOH A . E 3 HOH 36 436 270 HOH HOH A . E 3 HOH 37 437 253 HOH HOH A . E 3 HOH 38 438 240 HOH HOH A . E 3 HOH 39 439 249 HOH HOH A . E 3 HOH 40 440 264 HOH HOH A . E 3 HOH 41 441 269 HOH HOH A . E 3 HOH 42 442 277 HOH HOH A . E 3 HOH 43 443 268 HOH HOH A . E 3 HOH 44 444 283 HOH HOH A . E 3 HOH 45 445 239 HOH HOH A . E 3 HOH 46 446 284 HOH HOH A . E 3 HOH 47 447 263 HOH HOH A . E 3 HOH 48 448 246 HOH HOH A . E 3 HOH 49 449 267 HOH HOH A . E 3 HOH 50 450 241 HOH HOH A . E 3 HOH 51 451 242 HOH HOH A . E 3 HOH 52 452 232 HOH HOH A . E 3 HOH 53 453 247 HOH HOH A . E 3 HOH 54 454 251 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLN 80 ? CD ? A GLN 80 CD 2 1 Y 0 A GLN 80 ? OE1 ? A GLN 80 OE1 3 1 Y 0 A GLN 80 ? NE2 ? A GLN 80 NE2 4 1 Y 0 A LYS 83 ? CD ? A LYS 83 CD 5 1 Y 0 A LYS 83 ? CE ? A LYS 83 CE 6 1 Y 0 A LYS 83 ? NZ ? A LYS 83 NZ 7 1 Y 0 A ASP 140 ? CG ? A ASP 153 CG 8 1 Y 0 A ASP 140 ? OD1 ? A ASP 153 OD1 9 1 Y 0 A ASP 140 ? OD2 ? A ASP 153 OD2 10 1 Y 0 A ASN 141 ? CG ? A ASN 154 CG 11 1 Y 0 A ASN 141 ? OD1 ? A ASN 154 OD1 12 1 Y 0 A ASN 141 ? ND2 ? A ASN 154 ND2 13 1 Y 0 A LYS 168 ? CD ? A LYS 181 CD 14 1 Y 0 A LYS 168 ? CE ? A LYS 181 CE 15 1 Y 0 A LYS 168 ? NZ ? A LYS 181 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? MAIN ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6FXO _cell.details ? _cell.formula_units_Z ? _cell.length_a 110.168 _cell.length_a_esd ? _cell.length_b 110.168 _cell.length_b_esd ? _cell.length_c 92.39 _cell.length_c_esd ? _cell.volume 971105.750 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FXO _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FXO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2 M Ammonium sulphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918400 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.918400 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6FXO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.28 _reflns.d_resolution_low 42.39 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15697 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.31 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.091 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.28 _reflns_shell.d_res_low 2.41 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.96 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2453 _reflns_shell.percent_possible_all 99.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.626 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.631 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.033 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.033 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.067 _refine.B_iso_max 0.00 _refine.B_iso_mean 0.00 _refine.B_iso_min 0.00 _refine.correlation_coeff_Fo_to_Fc 0.8908 _refine.correlation_coeff_Fo_to_Fc_free 0.8681 _refine.details 'Instead of Rfree, Rkick was used' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FXO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 35.40 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11943 _refine.ls_number_reflns_R_free 11943 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.00 _refine.ls_percent_reflns_R_free 100.00 _refine.ls_R_factor_all 0.2948 _refine.ls_R_factor_obs 0.2948 _refine.ls_R_factor_R_free 0.3300 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2948 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol 37.98 _refine.solvent_model_param_ksol 0.39 _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model SagB _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details NONE _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 35.40 _refine_hist.number_atoms_solvent 54 _refine_hist.number_atoms_total 1884 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1827 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.54 _refine_ls_shell.number_reflns_all 578 _refine_ls_shell.number_reflns_obs 578 _refine_ls_shell.number_reflns_R_free 578 _refine_ls_shell.number_reflns_R_work 578 _refine_ls_shell.percent_reflns_obs 1.00 _refine_ls_shell.percent_reflns_R_free 100.00 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3526 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2963 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6FXO _struct.title 'Crystal structure of Major Bifunctional Autolysin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FXO _struct_keywords.text 'peptidoglycan hydrolase, GH73, glycoside hydrolase family 73, autolysin, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATL_STAAM _struct_ref.pdbx_db_accession Q931U5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ELIKYNQTGMTLNQVAQIQAGLQYKPQVQRVPGKWTDANFNDVKHAMDTKRLAQDPALKYQFLRLDQPQNISIDKINQFL KGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGADVVNNKVVTNSNTKYHNVFGIAAYDNDPLREGIK YAKQAGWDTVSKAIVGGAKFIGNSYVKAGQNTLYKMRWNPAHPGTHQYATDVDWANINAKIIKGYYDKIGEVGKYFDIPQ YK ; _struct_ref.pdbx_align_begin 1007 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FXO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 244 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q931U5 _struct_ref_seq.db_align_beg 1007 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 231 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FXO ALA A 1 ? UNP Q931U5 ? ? 'expression tag' 1 1 1 6FXO ALA A 2 ? UNP Q931U5 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 350 ? 1 MORE -23 ? 1 'SSA (A^2)' 11860 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 13 ? GLY A 23 ? THR A 13 GLY A 23 1 ? 11 HELX_P HELX_P2 AA2 ASN A 41 ? ASP A 50 ? ASN A 41 ASP A 50 1 ? 10 HELX_P HELX_P3 AA3 ASP A 50 ? ASP A 57 ? ASP A 50 ASP A 57 1 ? 8 HELX_P HELX_P4 AA4 ALA A 59 ? LEU A 65 ? ALA A 59 LEU A 65 5 ? 7 HELX_P HELX_P5 AA5 SER A 74 ? LYS A 83 ? SER A 74 LYS A 83 1 ? 10 HELX_P HELX_P6 AA6 GLN A 91 ? GLY A 103 ? GLN A 91 GLY A 103 1 ? 13 HELX_P HELX_P7 AA7 ASN A 105 ? THR A 117 ? ASN A 105 THR A 117 1 ? 13 HELX_P HELX_P8 AA8 SER A 122 ? GLY A 127 ? SER A 122 GLY A 127 1 ? 6 HELX_P HELX_P9 AA9 LEU A 157 ? ALA A 167 ? LEU A 144 ALA A 154 1 ? 11 HELX_P HELX_P10 AB1 THR A 171 ? LYS A 181 ? THR A 158 LYS A 168 1 ? 11 HELX_P HELX_P11 AB2 THR A 194 ? ASN A 201 ? THR A 181 ASN A 188 1 ? 8 HELX_P HELX_P12 AB3 ASP A 215 ? GLY A 232 ? ASP A 202 GLY A 219 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 4 ? GLN A 9 ? LEU A 4 GLN A 9 AA1 2 TYR A 237 ? GLN A 242 ? TYR A 224 GLN A 229 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ASN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 8 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 8 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 242 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 229 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 301 ? 2 'binding site for residue CL A 301' AC2 Software A CL 302 ? 3 'binding site for residue CL A 302' AC3 Software A CL 303 ? 1 'binding site for residue CL A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLY A 184 ? GLY A 171 . ? 1_555 ? 2 AC1 2 TYR A 187 ? TYR A 174 . ? 1_555 ? 3 AC2 3 ASP A 155 ? ASP A 142 . ? 1_555 ? 4 AC2 3 LEU A 157 ? LEU A 144 . ? 1_555 ? 5 AC2 3 ARG A 158 ? ARG A 145 . ? 1_555 ? 6 AC3 1 ARG A 66 ? ARG A 66 . ? 1_555 ? # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 HD22 A ASN 141 ? ? 1_555 OD1 A ASP 142 ? ? 8_556 1.45 2 1 O A GLU 3 ? ? 1_555 H A TYR 7 ? ? 10_665 1.53 3 1 OD2 A ASP 39 ? ? 1_555 CB A ASP 140 ? ? 11_656 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 12 ? ? -81.54 -155.39 2 1 ASP A 50 ? ? -61.08 85.61 3 1 LEU A 88 ? ? 67.78 -8.70 4 1 ASN A 90 ? ? -106.85 -150.32 5 1 TYR A 139 ? ? -114.22 57.29 6 1 ASP A 140 ? ? -152.86 -104.29 7 1 ASN A 141 ? ? -73.07 -75.66 8 1 TYR A 174 ? ? -122.98 -57.07 # _pdbx_entry_details.entry_id 6FXO _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 127 A A ALA 128 2 1 Y 1 A ASP 127 B A ASP 129 3 1 Y 1 A VAL 127 C A VAL 130 4 1 Y 1 A VAL 127 D A VAL 131 5 1 Y 1 A ASN 127 E A ASN 132 6 1 Y 1 A ASN 127 F A ASN 133 7 1 Y 1 A LYS 127 G A LYS 134 8 1 Y 1 A VAL 127 H A VAL 135 9 1 Y 1 A VAL 127 I A VAL 136 10 1 Y 1 A THR 127 J A THR 137 11 1 Y 1 A ASN 127 K A ASN 138 12 1 Y 1 A SER 127 L A SER 139 13 1 Y 1 A ASN 127 M A ASN 140 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Slovenian Research Agency' _pdbx_audit_support.country Slovenia _pdbx_audit_support.grant_number P1-0048 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details SagB # _atom_sites.entry_id 6FXO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009077 _atom_sites.fract_transf_matrix[1][2] 0.005241 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010481 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010824 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL H N O S # loop_