data_6HY7 # _entry.id 6HY7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6HY7 pdb_00006hy7 10.2210/pdb6hy7/pdb WWPDB D_1200012510 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-22 2 'Structure model' 1 1 2019-06-05 3 'Structure model' 1 2 2019-08-21 4 'Structure model' 1 3 2020-07-29 5 'Structure model' 1 4 2024-01-24 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' diffrn_source 5 4 'Structure model' chem_comp 6 4 'Structure model' entity 7 4 'Structure model' pdbx_chem_comp_identifier 8 4 'Structure model' pdbx_entity_nonpoly 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_site 11 4 'Structure model' struct_site_gen 12 5 'Structure model' chem_comp 13 5 'Structure model' chem_comp_atom 14 5 'Structure model' chem_comp_bond 15 5 'Structure model' database_2 16 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 8 4 'Structure model' '_chem_comp.name' 9 4 'Structure model' '_chem_comp.type' 10 4 'Structure model' '_entity.pdbx_description' 11 4 'Structure model' '_pdbx_entity_nonpoly.name' 12 4 'Structure model' '_struct_conn.pdbx_role' 13 5 'Structure model' '_chem_comp.pdbx_synonyms' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HY7 _pdbx_database_status.recvd_initial_deposition_date 2018-10-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Giastas, P.' 1 0000-0002-3490-8223 'Zouridakis, M.' 2 0000-0001-9760-1838 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Pharmacol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1663-9812 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 474 _citation.page_last 474 _citation.title ;Crystal Structure of the Monomeric Extracellular Domain of alpha 9 Nicotinic Receptor Subunit in Complex With alpha-Conotoxin RgIA: Molecular Dynamics Insights Into RgIA Binding to alpha 9 alpha 10 Nicotinic Receptors. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fphar.2019.00474 _citation.pdbx_database_id_PubMed 31118896 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zouridakis, M.' 1 ? primary 'Papakyriakou, A.' 2 ? primary 'Ivanov, I.A.' 3 ? primary 'Kasheverov, I.E.' 4 ? primary 'Tsetlin, V.' 5 ? primary 'Tzartos, S.' 6 ? primary 'Giastas, P.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Neuronal acetylcholine receptor subunit alpha-9' 25307.029 1 ? ? ? 'alpha9 nAChR' 2 polymer syn 'Alpha-conotoxin RgIA' 1577.883 1 ? ? ? 'alpha conotoxin RgIA' 3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 4 non-polymer man 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nicotinic acetylcholine receptor subunit alpha-9,NACHR alpha-9' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSI RIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDI FNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSHHHHHH ; ;ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSI RIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDI FNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSHHHHHH ; A ? 2 'polypeptide(L)' no yes 'GCCSDPRCRYRC(AAR)' GCCSDPRCRYRCR B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 4 1,2-ETHANEDIOL EDO 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 GLY n 1 4 LYS n 1 5 TYR n 1 6 ALA n 1 7 GLN n 1 8 LYS n 1 9 LEU n 1 10 PHE n 1 11 ASN n 1 12 ASP n 1 13 LEU n 1 14 PHE n 1 15 GLU n 1 16 ASP n 1 17 TYR n 1 18 SER n 1 19 ASN n 1 20 ALA n 1 21 LEU n 1 22 ARG n 1 23 PRO n 1 24 VAL n 1 25 GLU n 1 26 ASP n 1 27 THR n 1 28 ASP n 1 29 LYS n 1 30 VAL n 1 31 LEU n 1 32 ASN n 1 33 VAL n 1 34 THR n 1 35 LEU n 1 36 GLN n 1 37 ILE n 1 38 THR n 1 39 LEU n 1 40 SER n 1 41 GLN n 1 42 ILE n 1 43 LYS n 1 44 ASP n 1 45 MET n 1 46 ASP n 1 47 GLU n 1 48 ARG n 1 49 ASN n 1 50 GLN n 1 51 ILE n 1 52 LEU n 1 53 THR n 1 54 ALA n 1 55 TYR n 1 56 LEU n 1 57 TRP n 1 58 ILE n 1 59 ARG n 1 60 GLN n 1 61 ILE n 1 62 TRP n 1 63 HIS n 1 64 ASP n 1 65 ALA n 1 66 TYR n 1 67 LEU n 1 68 THR n 1 69 TRP n 1 70 ASP n 1 71 ARG n 1 72 ASP n 1 73 GLN n 1 74 TYR n 1 75 ASP n 1 76 GLY n 1 77 LEU n 1 78 ASP n 1 79 SER n 1 80 ILE n 1 81 ARG n 1 82 ILE n 1 83 PRO n 1 84 SER n 1 85 ASP n 1 86 LEU n 1 87 VAL n 1 88 TRP n 1 89 ARG n 1 90 PRO n 1 91 ASP n 1 92 ILE n 1 93 VAL n 1 94 LEU n 1 95 TYR n 1 96 ASN n 1 97 LYS n 1 98 ALA n 1 99 ASP n 1 100 ASP n 1 101 GLU n 1 102 SER n 1 103 SER n 1 104 GLU n 1 105 PRO n 1 106 VAL n 1 107 ASN n 1 108 THR n 1 109 ASN n 1 110 VAL n 1 111 VAL n 1 112 LEU n 1 113 ARG n 1 114 TYR n 1 115 ASP n 1 116 GLY n 1 117 LEU n 1 118 ILE n 1 119 THR n 1 120 TRP n 1 121 ASP n 1 122 ALA n 1 123 PRO n 1 124 ALA n 1 125 ILE n 1 126 THR n 1 127 LYS n 1 128 SER n 1 129 SER n 1 130 CYS n 1 131 VAL n 1 132 VAL n 1 133 ASP n 1 134 VAL n 1 135 THR n 1 136 TYR n 1 137 PHE n 1 138 PRO n 1 139 PHE n 1 140 ASP n 1 141 ASN n 1 142 GLN n 1 143 GLN n 1 144 CYS n 1 145 ASN n 1 146 LEU n 1 147 THR n 1 148 PHE n 1 149 GLY n 1 150 SER n 1 151 TRP n 1 152 THR n 1 153 TYR n 1 154 ASN n 1 155 GLY n 1 156 ASN n 1 157 GLN n 1 158 VAL n 1 159 ASP n 1 160 ILE n 1 161 PHE n 1 162 ASN n 1 163 ALA n 1 164 LEU n 1 165 ASP n 1 166 SER n 1 167 GLY n 1 168 ASP n 1 169 LEU n 1 170 SER n 1 171 ASP n 1 172 PHE n 1 173 ILE n 1 174 GLU n 1 175 ASP n 1 176 VAL n 1 177 GLU n 1 178 TRP n 1 179 GLU n 1 180 VAL n 1 181 HIS n 1 182 GLY n 1 183 MET n 1 184 PRO n 1 185 ALA n 1 186 VAL n 1 187 LYS n 1 188 ASN n 1 189 VAL n 1 190 ILE n 1 191 SER n 1 192 TYR n 1 193 GLY n 1 194 CYS n 1 195 CYS n 1 196 SER n 1 197 GLU n 1 198 PRO n 1 199 TYR n 1 200 PRO n 1 201 ASP n 1 202 VAL n 1 203 THR n 1 204 PHE n 1 205 THR n 1 206 LEU n 1 207 LEU n 1 208 LEU n 1 209 LYS n 1 210 ARG n 1 211 ARG n 1 212 SER n 1 213 HIS n 1 214 HIS n 1 215 HIS n 1 216 HIS n 1 217 HIS n 1 218 HIS n 2 1 GLY n 2 2 CYS n 2 3 CYS n 2 4 SER n 2 5 ASP n 2 6 PRO n 2 7 ARG n 2 8 CYS n 2 9 ARG n 2 10 TYR n 2 11 ARG n 2 12 CYS n 2 13 AAR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 218 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CHRNA9, NACHRA9' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain X33 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPicZa _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'Conus regius' _pdbx_entity_src_syn.organism_common_name 'Crown cone' _pdbx_entity_src_syn.ncbi_taxonomy_id 101314 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AAR 'L-peptide linking' n ARGININEAMIDE ? 'C6 H16 N5 O 1' 174.224 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 SER 102 102 ? ? ? A . n A 1 103 SER 103 103 ? ? ? A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 TRP 151 151 151 TRP TRP A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 TRP 178 178 178 TRP TRP A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 CYS 195 195 195 CYS CYS A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 HIS 213 213 213 HIS HIS A . n A 1 214 HIS 214 214 ? ? ? A . n A 1 215 HIS 215 215 ? ? ? A . n A 1 216 HIS 216 216 ? ? ? A . n A 1 217 HIS 217 217 ? ? ? A . n A 1 218 HIS 218 218 ? ? ? A . n B 2 1 GLY 1 1 1 GLY GLY B . n B 2 2 CYS 2 2 2 CYS CYS B . n B 2 3 CYS 3 3 3 CYS CYS B . n B 2 4 SER 4 4 4 SER SER B . n B 2 5 ASP 5 5 5 ASP ASP B . n B 2 6 PRO 6 6 6 PRO PRO B . n B 2 7 ARG 7 7 7 ARG ARG B . n B 2 8 CYS 8 8 8 CYS CYS B . n B 2 9 ARG 9 9 9 ARG ARG B . n B 2 10 TYR 10 10 10 TYR TYR B . n B 2 11 ARG 11 11 11 ARG ARG B . n B 2 12 CYS 12 12 12 CYS CYS B . n B 2 13 AAR 13 13 13 AAR LIG B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NAG 1 301 1216 NAG NAG A . D 3 NAG 1 302 1217 NAG NAG A . E 4 EDO 1 303 1 EDO EDO A . F 5 HOH 1 401 13 HOH HOH A . F 5 HOH 2 402 51 HOH HOH A . F 5 HOH 3 403 35 HOH HOH A . F 5 HOH 4 404 26 HOH HOH A . F 5 HOH 5 405 31 HOH HOH A . F 5 HOH 6 406 18 HOH HOH A . F 5 HOH 7 407 9 HOH HOH A . F 5 HOH 8 408 17 HOH HOH A . F 5 HOH 9 409 2 HOH HOH A . F 5 HOH 10 410 46 HOH HOH A . F 5 HOH 11 411 6 HOH HOH A . F 5 HOH 12 412 45 HOH HOH A . F 5 HOH 13 413 7 HOH HOH A . F 5 HOH 14 414 20 HOH HOH A . F 5 HOH 15 415 12 HOH HOH A . F 5 HOH 16 416 53 HOH HOH A . F 5 HOH 17 417 11 HOH HOH A . F 5 HOH 18 418 52 HOH HOH A . F 5 HOH 19 419 54 HOH HOH A . F 5 HOH 20 420 40 HOH HOH A . F 5 HOH 21 421 34 HOH HOH A . F 5 HOH 22 422 55 HOH HOH A . F 5 HOH 23 423 30 HOH HOH A . F 5 HOH 24 424 33 HOH HOH A . F 5 HOH 25 425 1 HOH HOH A . F 5 HOH 26 426 10 HOH HOH A . F 5 HOH 27 427 3 HOH HOH A . F 5 HOH 28 428 15 HOH HOH A . F 5 HOH 29 429 38 HOH HOH A . F 5 HOH 30 430 44 HOH HOH A . F 5 HOH 31 431 4 HOH HOH A . F 5 HOH 32 432 5 HOH HOH A . F 5 HOH 33 433 24 HOH HOH A . F 5 HOH 34 434 37 HOH HOH A . F 5 HOH 35 435 32 HOH HOH A . F 5 HOH 36 436 47 HOH HOH A . F 5 HOH 37 437 42 HOH HOH A . F 5 HOH 38 438 19 HOH HOH A . F 5 HOH 39 439 43 HOH HOH A . F 5 HOH 40 440 48 HOH HOH A . F 5 HOH 41 441 28 HOH HOH A . F 5 HOH 42 442 14 HOH HOH A . F 5 HOH 43 443 50 HOH HOH A . F 5 HOH 44 444 41 HOH HOH A . F 5 HOH 45 445 25 HOH HOH A . F 5 HOH 46 446 29 HOH HOH A . F 5 HOH 47 447 27 HOH HOH A . F 5 HOH 48 448 39 HOH HOH A . G 5 HOH 1 101 21 HOH HOH B . G 5 HOH 2 102 22 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 99 ? CB ? A ASP 99 CB 2 1 Y 1 A ASP 99 ? CG ? A ASP 99 CG 3 1 Y 1 A ASP 99 ? OD1 ? A ASP 99 OD1 4 1 Y 1 A ASP 99 ? OD2 ? A ASP 99 OD2 5 1 Y 1 A ASP 100 ? CB ? A ASP 100 CB 6 1 Y 1 A ASP 100 ? CG ? A ASP 100 CG 7 1 Y 1 A ASP 100 ? OD1 ? A ASP 100 OD1 8 1 Y 1 A ASP 100 ? OD2 ? A ASP 100 OD2 9 1 Y 1 A GLU 101 ? CB ? A GLU 101 CB 10 1 Y 1 A GLU 101 ? CG ? A GLU 101 CG 11 1 Y 1 A GLU 101 ? CD ? A GLU 101 CD 12 1 Y 1 A GLU 101 ? OE1 ? A GLU 101 OE1 13 1 Y 1 A GLU 101 ? OE2 ? A GLU 101 OE2 14 1 Y 1 A GLU 104 ? CB ? A GLU 104 CB 15 1 Y 1 A GLU 104 ? CG ? A GLU 104 CG 16 1 Y 1 A GLU 104 ? CD ? A GLU 104 CD 17 1 Y 1 A GLU 104 ? OE1 ? A GLU 104 OE1 18 1 Y 1 A GLU 104 ? OE2 ? A GLU 104 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6HY7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.646 _cell.length_a_esd ? _cell.length_b 82.530 _cell.length_b_esd ? _cell.length_c 49.474 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HY7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HY7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 10000, 100mM Hepes' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-05-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6HY7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.260 _reflns.d_resolution_low 42.434 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12622 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.87 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.26 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 1.19 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.26 _reflns_shell.d_res_low 2.36 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HY7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.260 _refine.ls_d_res_low 42.434 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23319 _refine.ls_number_reflns_R_free 1175 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.87 _refine.ls_percent_reflns_R_free 5.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1962 _refine.ls_R_factor_R_free 0.2492 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1932 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.19 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4UXU _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.21 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.41 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.260 _refine_hist.d_res_low 42.434 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 1889 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1835 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1907 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.053 ? 2605 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.979 ? 1125 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.057 ? 285 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 338 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2597 2.3625 . . 137 2574 92.00 . . . 0.4247 . 0.3367 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3625 2.4871 . . 149 2773 100.00 . . . 0.3815 . 0.3045 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4871 2.6429 . . 144 2784 100.00 . . . 0.3036 . 0.2579 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6429 2.8469 . . 154 2796 100.00 . . . 0.2459 . 0.2240 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8469 3.1333 . . 150 2796 100.00 . . . 0.2943 . 0.2158 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1333 3.5865 . . 147 2819 100.00 . . . 0.2685 . 0.1879 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5865 4.5178 . . 146 2803 100.00 . . . 0.1996 . 0.1585 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5178 42.4410 . . 148 2799 100.00 . . . 0.2155 . 0.1629 . . . . . . . . . . # _struct.entry_id 6HY7 _struct.title 'Crystal structure of alpha9 nAChR extracellular domain in complex with alpha-conotoxin RgIA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HY7 _struct_keywords.text 'alpha9, ion channel, nAChR, acetylcholine, conotoxin, RgIA, antagonist, toxin' _struct_keywords.pdbx_keywords TOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ACHA9_HUMAN Q9UGM1 ? 1 ;ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSI RIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDI FNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRS ; 26 2 UNP CA1A_CONRE P0C1D0 ? 2 GCCSDPRCRYRCR 20 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6HY7 A 1 ? 212 ? Q9UGM1 26 ? 237 ? 1 212 2 2 6HY7 B 1 ? 13 ? P0C1D0 20 ? 32 ? 1 13 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HY7 HIS A 213 ? UNP Q9UGM1 ? ? 'expression tag' 213 1 1 6HY7 HIS A 214 ? UNP Q9UGM1 ? ? 'expression tag' 214 2 1 6HY7 HIS A 215 ? UNP Q9UGM1 ? ? 'expression tag' 215 3 1 6HY7 HIS A 216 ? UNP Q9UGM1 ? ? 'expression tag' 216 4 1 6HY7 HIS A 217 ? UNP Q9UGM1 ? ? 'expression tag' 217 5 1 6HY7 HIS A 218 ? UNP Q9UGM1 ? ? 'expression tag' 218 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1880 ? 1 MORE 9 ? 1 'SSA (A^2)' 12790 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Functional inhibition of alpha9-containing nAChRs upon alpha-conotoxin RgIA addition' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? GLU A 15 ? ASP A 2 GLU A 15 1 ? 14 HELX_P HELX_P2 AA2 ASP A 70 ? TYR A 74 ? ASP A 70 TYR A 74 5 ? 5 HELX_P HELX_P3 AA3 ASP A 85 ? VAL A 87 ? ASP A 85 VAL A 87 5 ? 3 HELX_P HELX_P4 AA4 GLY B 1 ? ASP B 5 ? GLY B 1 ASP B 5 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 194 SG ? ? ? 1_555 A CYS 195 SG ? ? A CYS 194 A CYS 195 1_555 ? ? ? ? ? ? ? 2.067 ? ? disulf2 disulf ? ? B CYS 2 SG ? ? ? 1_555 B CYS 8 SG ? ? B CYS 2 B CYS 8 1_555 ? ? ? ? ? ? ? 2.052 ? ? disulf3 disulf ? ? B CYS 3 SG ? ? ? 1_555 B CYS 12 SG ? ? B CYS 3 B CYS 12 1_555 ? ? ? ? ? ? ? 2.047 ? ? covale1 covale one ? A ASN 32 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 32 A NAG 301 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation covale2 covale one ? A ASN 145 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 145 A NAG 302 1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation covale3 covale both ? B CYS 12 C ? ? ? 1_555 B AAR 13 N ? ? B CYS 12 B AAR 13 1_555 ? ? ? ? ? ? ? 1.329 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 137 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 137 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 138 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 138 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.81 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 4 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 158 ? ASN A 162 ? VAL A 158 ASN A 162 A 2 LEU A 31 ? ILE A 42 ? LEU A 31 ILE A 42 A 3 ILE A 51 ? HIS A 63 ? ILE A 51 HIS A 63 A 4 LEU A 117 ? SER A 129 ? LEU A 117 SER A 129 A 5 ASN A 109 ? ARG A 113 ? ASN A 109 ARG A 113 A 6 SER A 79 ? PRO A 83 ? SER A 79 PRO A 83 B 1 ASP A 44 ? ASP A 46 ? ASP A 44 ASP A 46 B 2 ILE A 51 ? THR A 53 ? ILE A 51 THR A 53 C 1 ILE A 92 ? LEU A 94 ? ILE A 92 LEU A 94 C 2 ASN A 141 ? SER A 150 ? ASN A 141 SER A 150 C 3 TYR A 199 ? ARG A 210 ? TYR A 199 ARG A 210 C 4 TRP A 178 ? ILE A 190 ? TRP A 178 ILE A 190 D 1 CYS A 130 ? ASP A 133 ? CYS A 130 ASP A 133 D 2 ASN A 141 ? CYS A 144 ? ASN A 141 CYS A 144 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 130 ? ? SG A CYS 144 ? ? 1.68 2 1 N A ASP 91 ? ? O A HOH 401 ? ? 1.95 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD1 B TYR 10 ? ? CE1 B TYR 10 ? ? 1.489 1.389 0.100 0.015 N 2 1 CE1 B TYR 10 ? ? CZ B TYR 10 ? ? 1.270 1.381 -0.111 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 67 ? ? -107.36 46.13 2 1 TYR A 74 ? ? -141.59 46.30 3 1 SER A 79 ? ? -176.47 136.99 4 1 ASN A 96 ? B -92.03 43.83 5 1 ASP A 140 ? ? -150.81 74.81 6 1 MET A 183 ? ? -142.26 59.67 7 1 CYS B 8 ? ? -115.06 -98.37 8 1 ARG B 9 ? ? 51.46 -87.65 9 1 ARG B 11 ? ? -179.84 -16.03 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id AAR _pdbx_struct_mod_residue.label_seq_id 13 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id AAR _pdbx_struct_mod_residue.auth_seq_id 13 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ARG _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 67.6098 13.2357 73.0118 0.4624 ? 0.0563 ? -0.0748 ? 0.3860 ? 0.1041 ? 0.3505 ? 0.5228 ? 0.4832 ? -0.2678 ? 0.4617 ? -0.3197 ? 0.2898 ? -0.0316 ? -0.2325 ? -0.1215 ? 0.6959 ? 0.0642 ? 0.2177 ? 0.2956 ? -0.2096 ? -0.0157 ? 2 'X-RAY DIFFRACTION' ? refined 73.7436 20.4667 57.9758 0.3470 ? 0.0518 ? 0.0375 ? 0.3121 ? -0.0304 ? 0.3372 ? 0.6982 ? -0.0506 ? 0.2308 ? 1.6279 ? -0.2772 ? 0.2650 ? 0.1131 ? -0.0687 ? -0.1707 ? -0.2150 ? 0.0710 ? -0.2395 ? 0.3195 ? 0.1497 ? 0.0001 ? 3 'X-RAY DIFFRACTION' ? refined 70.8167 27.6604 50.6058 0.3051 ? 0.0166 ? 0.0448 ? 0.3302 ? -0.0257 ? 0.3367 ? -0.0306 ? 0.0525 ? 0.0697 ? 1.1551 ? -0.0734 ? 0.8268 ? -0.1148 ? 0.0098 ? -0.0038 ? -0.1601 ? 0.0595 ? -0.2142 ? 0.1856 ? -0.0370 ? -0.0001 ? 4 'X-RAY DIFFRACTION' ? refined 75.2237 34.0925 46.8283 0.2666 ? -0.0093 ? 0.0509 ? 0.2943 ? -0.0208 ? 0.3450 ? 0.5215 ? 0.0771 ? 0.6843 ? 0.4837 ? -0.6981 ? 1.6917 ? -0.0156 ? 0.1131 ? 0.1431 ? -0.1435 ? 0.0218 ? -0.1600 ? 0.1825 ? 0.2015 ? -0.0000 ? 5 'X-RAY DIFFRACTION' ? refined 50.1525 30.3403 53.3105 0.6669 ? -0.0507 ? -0.1110 ? 0.4466 ? -0.0558 ? 0.6410 ? 0.1359 ? -0.0115 ? 0.1180 ? -0.0005 ? 0.0197 ? 0.0776 ? -0.3296 ? -0.4419 ? 0.7194 ? -0.3803 ? -0.0246 ? 0.9025 ? -0.7106 ? 0.7931 ? 0.0002 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 2 through 30 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 31 through 94 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 95 through 162 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 163 through 213 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 1 through 13 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A SER 102 ? A SER 102 3 1 Y 1 A SER 103 ? A SER 103 4 1 Y 1 A HIS 214 ? A HIS 214 5 1 Y 1 A HIS 215 ? A HIS 215 6 1 Y 1 A HIS 216 ? A HIS 216 7 1 Y 1 A HIS 217 ? A HIS 217 8 1 Y 1 A HIS 218 ? A HIS 218 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal AAR N N N N 1 AAR CA C N S 2 AAR CB C N N 3 AAR CG C N N 4 AAR CD C N N 5 AAR NE N N N 6 AAR CZ C N N 7 AAR NH1 N N N 8 AAR NH2 N N N 9 AAR C C N N 10 AAR O O N N 11 AAR NT N N N 12 AAR H H N N 13 AAR H2 H N N 14 AAR HA H N N 15 AAR HB2 H N N 16 AAR HB3 H N N 17 AAR HG2 H N N 18 AAR HG3 H N N 19 AAR HD2 H N N 20 AAR HD3 H N N 21 AAR HE H N N 22 AAR HH11 H N N 23 AAR HH12 H N N 24 AAR HH21 H N N 25 AAR HH22 H N N 26 AAR HNT1 H N N 27 AAR HNT2 H N N 28 ALA N N N N 29 ALA CA C N S 30 ALA C C N N 31 ALA O O N N 32 ALA CB C N N 33 ALA OXT O N N 34 ALA H H N N 35 ALA H2 H N N 36 ALA HA H N N 37 ALA HB1 H N N 38 ALA HB2 H N N 39 ALA HB3 H N N 40 ALA HXT H N N 41 ARG N N N N 42 ARG CA C N S 43 ARG C C N N 44 ARG O O N N 45 ARG CB C N N 46 ARG CG C N N 47 ARG CD C N N 48 ARG NE N N N 49 ARG CZ C N N 50 ARG NH1 N N N 51 ARG NH2 N N N 52 ARG OXT O N N 53 ARG H H N N 54 ARG H2 H N N 55 ARG HA H N N 56 ARG HB2 H N N 57 ARG HB3 H N N 58 ARG HG2 H N N 59 ARG HG3 H N N 60 ARG HD2 H N N 61 ARG HD3 H N N 62 ARG HE H N N 63 ARG HH11 H N N 64 ARG HH12 H N N 65 ARG HH21 H N N 66 ARG HH22 H N N 67 ARG HXT H N N 68 ASN N N N N 69 ASN CA C N S 70 ASN C C N N 71 ASN O O N N 72 ASN CB C N N 73 ASN CG C N N 74 ASN OD1 O N N 75 ASN ND2 N N N 76 ASN OXT O N N 77 ASN H H N N 78 ASN H2 H N N 79 ASN HA H N N 80 ASN HB2 H N N 81 ASN HB3 H N N 82 ASN HD21 H N N 83 ASN HD22 H N N 84 ASN HXT H N N 85 ASP N N N N 86 ASP CA C N S 87 ASP C C N N 88 ASP O O N N 89 ASP CB C N N 90 ASP CG C N N 91 ASP OD1 O N N 92 ASP OD2 O N N 93 ASP OXT O N N 94 ASP H H N N 95 ASP H2 H N N 96 ASP HA H N N 97 ASP HB2 H N N 98 ASP HB3 H N N 99 ASP HD2 H N N 100 ASP HXT H N N 101 CYS N N N N 102 CYS CA C N R 103 CYS C C N N 104 CYS O O N N 105 CYS CB C N N 106 CYS SG S N N 107 CYS OXT O N N 108 CYS H H N N 109 CYS H2 H N N 110 CYS HA H N N 111 CYS HB2 H N N 112 CYS HB3 H N N 113 CYS HG H N N 114 CYS HXT H N N 115 EDO C1 C N N 116 EDO O1 O N N 117 EDO C2 C N N 118 EDO O2 O N N 119 EDO H11 H N N 120 EDO H12 H N N 121 EDO HO1 H N N 122 EDO H21 H N N 123 EDO H22 H N N 124 EDO HO2 H N N 125 GLN N N N N 126 GLN CA C N S 127 GLN C C N N 128 GLN O O N N 129 GLN CB C N N 130 GLN CG C N N 131 GLN CD C N N 132 GLN OE1 O N N 133 GLN NE2 N N N 134 GLN OXT O N N 135 GLN H H N N 136 GLN H2 H N N 137 GLN HA H N N 138 GLN HB2 H N N 139 GLN HB3 H N N 140 GLN HG2 H N N 141 GLN HG3 H N N 142 GLN HE21 H N N 143 GLN HE22 H N N 144 GLN HXT H N N 145 GLU N N N N 146 GLU CA C N S 147 GLU C C N N 148 GLU O O N N 149 GLU CB C N N 150 GLU CG C N N 151 GLU CD C N N 152 GLU OE1 O N N 153 GLU OE2 O N N 154 GLU OXT O N N 155 GLU H H N N 156 GLU H2 H N N 157 GLU HA H N N 158 GLU HB2 H N N 159 GLU HB3 H N N 160 GLU HG2 H N N 161 GLU HG3 H N N 162 GLU HE2 H N N 163 GLU HXT H N N 164 GLY N N N N 165 GLY CA C N N 166 GLY C C N N 167 GLY O O N N 168 GLY OXT O N N 169 GLY H H N N 170 GLY H2 H N N 171 GLY HA2 H N N 172 GLY HA3 H N N 173 GLY HXT H N N 174 HIS N N N N 175 HIS CA C N S 176 HIS C C N N 177 HIS O O N N 178 HIS CB C N N 179 HIS CG C Y N 180 HIS ND1 N Y N 181 HIS CD2 C Y N 182 HIS CE1 C Y N 183 HIS NE2 N Y N 184 HIS OXT O N N 185 HIS H H N N 186 HIS H2 H N N 187 HIS HA H N N 188 HIS HB2 H N N 189 HIS HB3 H N N 190 HIS HD1 H N N 191 HIS HD2 H N N 192 HIS HE1 H N N 193 HIS HE2 H N N 194 HIS HXT H N N 195 HOH O O N N 196 HOH H1 H N N 197 HOH H2 H N N 198 ILE N N N N 199 ILE CA C N S 200 ILE C C N N 201 ILE O O N N 202 ILE CB C N S 203 ILE CG1 C N N 204 ILE CG2 C N N 205 ILE CD1 C N N 206 ILE OXT O N N 207 ILE H H N N 208 ILE H2 H N N 209 ILE HA H N N 210 ILE HB H N N 211 ILE HG12 H N N 212 ILE HG13 H N N 213 ILE HG21 H N N 214 ILE HG22 H N N 215 ILE HG23 H N N 216 ILE HD11 H N N 217 ILE HD12 H N N 218 ILE HD13 H N N 219 ILE HXT H N N 220 LEU N N N N 221 LEU CA C N S 222 LEU C C N N 223 LEU O O N N 224 LEU CB C N N 225 LEU CG C N N 226 LEU CD1 C N N 227 LEU CD2 C N N 228 LEU OXT O N N 229 LEU H H N N 230 LEU H2 H N N 231 LEU HA H N N 232 LEU HB2 H N N 233 LEU HB3 H N N 234 LEU HG H N N 235 LEU HD11 H N N 236 LEU HD12 H N N 237 LEU HD13 H N N 238 LEU HD21 H N N 239 LEU HD22 H N N 240 LEU HD23 H N N 241 LEU HXT H N N 242 LYS N N N N 243 LYS CA C N S 244 LYS C C N N 245 LYS O O N N 246 LYS CB C N N 247 LYS CG C N N 248 LYS CD C N N 249 LYS CE C N N 250 LYS NZ N N N 251 LYS OXT O N N 252 LYS H H N N 253 LYS H2 H N N 254 LYS HA H N N 255 LYS HB2 H N N 256 LYS HB3 H N N 257 LYS HG2 H N N 258 LYS HG3 H N N 259 LYS HD2 H N N 260 LYS HD3 H N N 261 LYS HE2 H N N 262 LYS HE3 H N N 263 LYS HZ1 H N N 264 LYS HZ2 H N N 265 LYS HZ3 H N N 266 LYS HXT H N N 267 MET N N N N 268 MET CA C N S 269 MET C C N N 270 MET O O N N 271 MET CB C N N 272 MET CG C N N 273 MET SD S N N 274 MET CE C N N 275 MET OXT O N N 276 MET H H N N 277 MET H2 H N N 278 MET HA H N N 279 MET HB2 H N N 280 MET HB3 H N N 281 MET HG2 H N N 282 MET HG3 H N N 283 MET HE1 H N N 284 MET HE2 H N N 285 MET HE3 H N N 286 MET HXT H N N 287 NAG C1 C N R 288 NAG C2 C N R 289 NAG C3 C N R 290 NAG C4 C N S 291 NAG C5 C N R 292 NAG C6 C N N 293 NAG C7 C N N 294 NAG C8 C N N 295 NAG N2 N N N 296 NAG O1 O N N 297 NAG O3 O N N 298 NAG O4 O N N 299 NAG O5 O N N 300 NAG O6 O N N 301 NAG O7 O N N 302 NAG H1 H N N 303 NAG H2 H N N 304 NAG H3 H N N 305 NAG H4 H N N 306 NAG H5 H N N 307 NAG H61 H N N 308 NAG H62 H N N 309 NAG H81 H N N 310 NAG H82 H N N 311 NAG H83 H N N 312 NAG HN2 H N N 313 NAG HO1 H N N 314 NAG HO3 H N N 315 NAG HO4 H N N 316 NAG HO6 H N N 317 PHE N N N N 318 PHE CA C N S 319 PHE C C N N 320 PHE O O N N 321 PHE CB C N N 322 PHE CG C Y N 323 PHE CD1 C Y N 324 PHE CD2 C Y N 325 PHE CE1 C Y N 326 PHE CE2 C Y N 327 PHE CZ C Y N 328 PHE OXT O N N 329 PHE H H N N 330 PHE H2 H N N 331 PHE HA H N N 332 PHE HB2 H N N 333 PHE HB3 H N N 334 PHE HD1 H N N 335 PHE HD2 H N N 336 PHE HE1 H N N 337 PHE HE2 H N N 338 PHE HZ H N N 339 PHE HXT H N N 340 PRO N N N N 341 PRO CA C N S 342 PRO C C N N 343 PRO O O N N 344 PRO CB C N N 345 PRO CG C N N 346 PRO CD C N N 347 PRO OXT O N N 348 PRO H H N N 349 PRO HA H N N 350 PRO HB2 H N N 351 PRO HB3 H N N 352 PRO HG2 H N N 353 PRO HG3 H N N 354 PRO HD2 H N N 355 PRO HD3 H N N 356 PRO HXT H N N 357 SER N N N N 358 SER CA C N S 359 SER C C N N 360 SER O O N N 361 SER CB C N N 362 SER OG O N N 363 SER OXT O N N 364 SER H H N N 365 SER H2 H N N 366 SER HA H N N 367 SER HB2 H N N 368 SER HB3 H N N 369 SER HG H N N 370 SER HXT H N N 371 THR N N N N 372 THR CA C N S 373 THR C C N N 374 THR O O N N 375 THR CB C N R 376 THR OG1 O N N 377 THR CG2 C N N 378 THR OXT O N N 379 THR H H N N 380 THR H2 H N N 381 THR HA H N N 382 THR HB H N N 383 THR HG1 H N N 384 THR HG21 H N N 385 THR HG22 H N N 386 THR HG23 H N N 387 THR HXT H N N 388 TRP N N N N 389 TRP CA C N S 390 TRP C C N N 391 TRP O O N N 392 TRP CB C N N 393 TRP CG C Y N 394 TRP CD1 C Y N 395 TRP CD2 C Y N 396 TRP NE1 N Y N 397 TRP CE2 C Y N 398 TRP CE3 C Y N 399 TRP CZ2 C Y N 400 TRP CZ3 C Y N 401 TRP CH2 C Y N 402 TRP OXT O N N 403 TRP H H N N 404 TRP H2 H N N 405 TRP HA H N N 406 TRP HB2 H N N 407 TRP HB3 H N N 408 TRP HD1 H N N 409 TRP HE1 H N N 410 TRP HE3 H N N 411 TRP HZ2 H N N 412 TRP HZ3 H N N 413 TRP HH2 H N N 414 TRP HXT H N N 415 TYR N N N N 416 TYR CA C N S 417 TYR C C N N 418 TYR O O N N 419 TYR CB C N N 420 TYR CG C Y N 421 TYR CD1 C Y N 422 TYR CD2 C Y N 423 TYR CE1 C Y N 424 TYR CE2 C Y N 425 TYR CZ C Y N 426 TYR OH O N N 427 TYR OXT O N N 428 TYR H H N N 429 TYR H2 H N N 430 TYR HA H N N 431 TYR HB2 H N N 432 TYR HB3 H N N 433 TYR HD1 H N N 434 TYR HD2 H N N 435 TYR HE1 H N N 436 TYR HE2 H N N 437 TYR HH H N N 438 TYR HXT H N N 439 VAL N N N N 440 VAL CA C N S 441 VAL C C N N 442 VAL O O N N 443 VAL CB C N N 444 VAL CG1 C N N 445 VAL CG2 C N N 446 VAL OXT O N N 447 VAL H H N N 448 VAL H2 H N N 449 VAL HA H N N 450 VAL HB H N N 451 VAL HG11 H N N 452 VAL HG12 H N N 453 VAL HG13 H N N 454 VAL HG21 H N N 455 VAL HG22 H N N 456 VAL HG23 H N N 457 VAL HXT H N N 458 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal AAR N CA sing N N 1 AAR N H sing N N 2 AAR N H2 sing N N 3 AAR CA CB sing N N 4 AAR CA C sing N N 5 AAR CA HA sing N N 6 AAR CB CG sing N N 7 AAR CB HB2 sing N N 8 AAR CB HB3 sing N N 9 AAR CG CD sing N N 10 AAR CG HG2 sing N N 11 AAR CG HG3 sing N N 12 AAR CD NE sing N N 13 AAR CD HD2 sing N N 14 AAR CD HD3 sing N N 15 AAR NE CZ sing N N 16 AAR NE HE sing N N 17 AAR CZ NH1 sing N N 18 AAR CZ NH2 doub N N 19 AAR NH1 HH11 sing N N 20 AAR NH1 HH12 sing N N 21 AAR NH2 HH21 sing N N 22 AAR NH2 HH22 sing N N 23 AAR C O doub N N 24 AAR C NT sing N N 25 AAR NT HNT1 sing N N 26 AAR NT HNT2 sing N N 27 ALA N CA sing N N 28 ALA N H sing N N 29 ALA N H2 sing N N 30 ALA CA C sing N N 31 ALA CA CB sing N N 32 ALA CA HA sing N N 33 ALA C O doub N N 34 ALA C OXT sing N N 35 ALA CB HB1 sing N N 36 ALA CB HB2 sing N N 37 ALA CB HB3 sing N N 38 ALA OXT HXT sing N N 39 ARG N CA sing N N 40 ARG N H sing N N 41 ARG N H2 sing N N 42 ARG CA C sing N N 43 ARG CA CB sing N N 44 ARG CA HA sing N N 45 ARG C O doub N N 46 ARG C OXT sing N N 47 ARG CB CG sing N N 48 ARG CB HB2 sing N N 49 ARG CB HB3 sing N N 50 ARG CG CD sing N N 51 ARG CG HG2 sing N N 52 ARG CG HG3 sing N N 53 ARG CD NE sing N N 54 ARG CD HD2 sing N N 55 ARG CD HD3 sing N N 56 ARG NE CZ sing N N 57 ARG NE HE sing N N 58 ARG CZ NH1 sing N N 59 ARG CZ NH2 doub N N 60 ARG NH1 HH11 sing N N 61 ARG NH1 HH12 sing N N 62 ARG NH2 HH21 sing N N 63 ARG NH2 HH22 sing N N 64 ARG OXT HXT sing N N 65 ASN N CA sing N N 66 ASN N H sing N N 67 ASN N H2 sing N N 68 ASN CA C sing N N 69 ASN CA CB sing N N 70 ASN CA HA sing N N 71 ASN C O doub N N 72 ASN C OXT sing N N 73 ASN CB CG sing N N 74 ASN CB HB2 sing N N 75 ASN CB HB3 sing N N 76 ASN CG OD1 doub N N 77 ASN CG ND2 sing N N 78 ASN ND2 HD21 sing N N 79 ASN ND2 HD22 sing N N 80 ASN OXT HXT sing N N 81 ASP N CA sing N N 82 ASP N H sing N N 83 ASP N H2 sing N N 84 ASP CA C sing N N 85 ASP CA CB sing N N 86 ASP CA HA sing N N 87 ASP C O doub N N 88 ASP C OXT sing N N 89 ASP CB CG sing N N 90 ASP CB HB2 sing N N 91 ASP CB HB3 sing N N 92 ASP CG OD1 doub N N 93 ASP CG OD2 sing N N 94 ASP OD2 HD2 sing N N 95 ASP OXT HXT sing N N 96 CYS N CA sing N N 97 CYS N H sing N N 98 CYS N H2 sing N N 99 CYS CA C sing N N 100 CYS CA CB sing N N 101 CYS CA HA sing N N 102 CYS C O doub N N 103 CYS C OXT sing N N 104 CYS CB SG sing N N 105 CYS CB HB2 sing N N 106 CYS CB HB3 sing N N 107 CYS SG HG sing N N 108 CYS OXT HXT sing N N 109 EDO C1 O1 sing N N 110 EDO C1 C2 sing N N 111 EDO C1 H11 sing N N 112 EDO C1 H12 sing N N 113 EDO O1 HO1 sing N N 114 EDO C2 O2 sing N N 115 EDO C2 H21 sing N N 116 EDO C2 H22 sing N N 117 EDO O2 HO2 sing N N 118 GLN N CA sing N N 119 GLN N H sing N N 120 GLN N H2 sing N N 121 GLN CA C sing N N 122 GLN CA CB sing N N 123 GLN CA HA sing N N 124 GLN C O doub N N 125 GLN C OXT sing N N 126 GLN CB CG sing N N 127 GLN CB HB2 sing N N 128 GLN CB HB3 sing N N 129 GLN CG CD sing N N 130 GLN CG HG2 sing N N 131 GLN CG HG3 sing N N 132 GLN CD OE1 doub N N 133 GLN CD NE2 sing N N 134 GLN NE2 HE21 sing N N 135 GLN NE2 HE22 sing N N 136 GLN OXT HXT sing N N 137 GLU N CA sing N N 138 GLU N H sing N N 139 GLU N H2 sing N N 140 GLU CA C sing N N 141 GLU CA CB sing N N 142 GLU CA HA sing N N 143 GLU C O doub N N 144 GLU C OXT sing N N 145 GLU CB CG sing N N 146 GLU CB HB2 sing N N 147 GLU CB HB3 sing N N 148 GLU CG CD sing N N 149 GLU CG HG2 sing N N 150 GLU CG HG3 sing N N 151 GLU CD OE1 doub N N 152 GLU CD OE2 sing N N 153 GLU OE2 HE2 sing N N 154 GLU OXT HXT sing N N 155 GLY N CA sing N N 156 GLY N H sing N N 157 GLY N H2 sing N N 158 GLY CA C sing N N 159 GLY CA HA2 sing N N 160 GLY CA HA3 sing N N 161 GLY C O doub N N 162 GLY C OXT sing N N 163 GLY OXT HXT sing N N 164 HIS N CA sing N N 165 HIS N H sing N N 166 HIS N H2 sing N N 167 HIS CA C sing N N 168 HIS CA CB sing N N 169 HIS CA HA sing N N 170 HIS C O doub N N 171 HIS C OXT sing N N 172 HIS CB CG sing N N 173 HIS CB HB2 sing N N 174 HIS CB HB3 sing N N 175 HIS CG ND1 sing Y N 176 HIS CG CD2 doub Y N 177 HIS ND1 CE1 doub Y N 178 HIS ND1 HD1 sing N N 179 HIS CD2 NE2 sing Y N 180 HIS CD2 HD2 sing N N 181 HIS CE1 NE2 sing Y N 182 HIS CE1 HE1 sing N N 183 HIS NE2 HE2 sing N N 184 HIS OXT HXT sing N N 185 HOH O H1 sing N N 186 HOH O H2 sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 NAG C1 C2 sing N N 273 NAG C1 O1 sing N N 274 NAG C1 O5 sing N N 275 NAG C1 H1 sing N N 276 NAG C2 C3 sing N N 277 NAG C2 N2 sing N N 278 NAG C2 H2 sing N N 279 NAG C3 C4 sing N N 280 NAG C3 O3 sing N N 281 NAG C3 H3 sing N N 282 NAG C4 C5 sing N N 283 NAG C4 O4 sing N N 284 NAG C4 H4 sing N N 285 NAG C5 C6 sing N N 286 NAG C5 O5 sing N N 287 NAG C5 H5 sing N N 288 NAG C6 O6 sing N N 289 NAG C6 H61 sing N N 290 NAG C6 H62 sing N N 291 NAG C7 C8 sing N N 292 NAG C7 N2 sing N N 293 NAG C7 O7 doub N N 294 NAG C8 H81 sing N N 295 NAG C8 H82 sing N N 296 NAG C8 H83 sing N N 297 NAG N2 HN2 sing N N 298 NAG O1 HO1 sing N N 299 NAG O3 HO3 sing N N 300 NAG O4 HO4 sing N N 301 NAG O6 HO6 sing N N 302 PHE N CA sing N N 303 PHE N H sing N N 304 PHE N H2 sing N N 305 PHE CA C sing N N 306 PHE CA CB sing N N 307 PHE CA HA sing N N 308 PHE C O doub N N 309 PHE C OXT sing N N 310 PHE CB CG sing N N 311 PHE CB HB2 sing N N 312 PHE CB HB3 sing N N 313 PHE CG CD1 doub Y N 314 PHE CG CD2 sing Y N 315 PHE CD1 CE1 sing Y N 316 PHE CD1 HD1 sing N N 317 PHE CD2 CE2 doub Y N 318 PHE CD2 HD2 sing N N 319 PHE CE1 CZ doub Y N 320 PHE CE1 HE1 sing N N 321 PHE CE2 CZ sing Y N 322 PHE CE2 HE2 sing N N 323 PHE CZ HZ sing N N 324 PHE OXT HXT sing N N 325 PRO N CA sing N N 326 PRO N CD sing N N 327 PRO N H sing N N 328 PRO CA C sing N N 329 PRO CA CB sing N N 330 PRO CA HA sing N N 331 PRO C O doub N N 332 PRO C OXT sing N N 333 PRO CB CG sing N N 334 PRO CB HB2 sing N N 335 PRO CB HB3 sing N N 336 PRO CG CD sing N N 337 PRO CG HG2 sing N N 338 PRO CG HG3 sing N N 339 PRO CD HD2 sing N N 340 PRO CD HD3 sing N N 341 PRO OXT HXT sing N N 342 SER N CA sing N N 343 SER N H sing N N 344 SER N H2 sing N N 345 SER CA C sing N N 346 SER CA CB sing N N 347 SER CA HA sing N N 348 SER C O doub N N 349 SER C OXT sing N N 350 SER CB OG sing N N 351 SER CB HB2 sing N N 352 SER CB HB3 sing N N 353 SER OG HG sing N N 354 SER OXT HXT sing N N 355 THR N CA sing N N 356 THR N H sing N N 357 THR N H2 sing N N 358 THR CA C sing N N 359 THR CA CB sing N N 360 THR CA HA sing N N 361 THR C O doub N N 362 THR C OXT sing N N 363 THR CB OG1 sing N N 364 THR CB CG2 sing N N 365 THR CB HB sing N N 366 THR OG1 HG1 sing N N 367 THR CG2 HG21 sing N N 368 THR CG2 HG22 sing N N 369 THR CG2 HG23 sing N N 370 THR OXT HXT sing N N 371 TRP N CA sing N N 372 TRP N H sing N N 373 TRP N H2 sing N N 374 TRP CA C sing N N 375 TRP CA CB sing N N 376 TRP CA HA sing N N 377 TRP C O doub N N 378 TRP C OXT sing N N 379 TRP CB CG sing N N 380 TRP CB HB2 sing N N 381 TRP CB HB3 sing N N 382 TRP CG CD1 doub Y N 383 TRP CG CD2 sing Y N 384 TRP CD1 NE1 sing Y N 385 TRP CD1 HD1 sing N N 386 TRP CD2 CE2 doub Y N 387 TRP CD2 CE3 sing Y N 388 TRP NE1 CE2 sing Y N 389 TRP NE1 HE1 sing N N 390 TRP CE2 CZ2 sing Y N 391 TRP CE3 CZ3 doub Y N 392 TRP CE3 HE3 sing N N 393 TRP CZ2 CH2 doub Y N 394 TRP CZ2 HZ2 sing N N 395 TRP CZ3 CH2 sing Y N 396 TRP CZ3 HZ3 sing N N 397 TRP CH2 HH2 sing N N 398 TRP OXT HXT sing N N 399 TYR N CA sing N N 400 TYR N H sing N N 401 TYR N H2 sing N N 402 TYR CA C sing N N 403 TYR CA CB sing N N 404 TYR CA HA sing N N 405 TYR C O doub N N 406 TYR C OXT sing N N 407 TYR CB CG sing N N 408 TYR CB HB2 sing N N 409 TYR CB HB3 sing N N 410 TYR CG CD1 doub Y N 411 TYR CG CD2 sing Y N 412 TYR CD1 CE1 sing Y N 413 TYR CD1 HD1 sing N N 414 TYR CD2 CE2 doub Y N 415 TYR CD2 HD2 sing N N 416 TYR CE1 CZ doub Y N 417 TYR CE1 HE1 sing N N 418 TYR CE2 CZ sing Y N 419 TYR CE2 HE2 sing N N 420 TYR CZ OH sing N N 421 TYR OH HH sing N N 422 TYR OXT HXT sing N N 423 VAL N CA sing N N 424 VAL N H sing N N 425 VAL N H2 sing N N 426 VAL CA C sing N N 427 VAL CA CB sing N N 428 VAL CA HA sing N N 429 VAL C O doub N N 430 VAL C OXT sing N N 431 VAL CB CG1 sing N N 432 VAL CB CG2 sing N N 433 VAL CB HB sing N N 434 VAL CG1 HG11 sing N N 435 VAL CG1 HG12 sing N N 436 VAL CG1 HG13 sing N N 437 VAL CG2 HG21 sing N N 438 VAL CG2 HG22 sing N N 439 VAL CG2 HG23 sing N N 440 VAL OXT HXT sing N N 441 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4UXU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6HY7 _atom_sites.fract_transf_matrix[1][1] 0.015712 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012117 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020213 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_