data_6IY0 # _entry.id 6IY0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.327 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6IY0 WWPDB D_1300009966 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IY0 _pdbx_database_status.recvd_initial_deposition_date 2018-12-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jeong, S.' 1 0000-0002-5746-7117 'Ha, N.-C.' 2 0000-0003-4813-748X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country KR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Microbiol Biotechnol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1738-8872 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 500 _citation.page_last 505 _citation.title 'Crystal Structure of SAV0927 and Its Functional Implications.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.4014/jmb.1812.12040 _citation.pdbx_database_id_PubMed 30786702 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jeong, S.' 1 ? primary 'Kim, H.J.' 2 ? primary 'Ha, N.C.' 3 ? primary 'Kwon, A.R.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.35 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6IY0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 128.181 _cell.length_a_esd ? _cell.length_b 76.754 _cell.length_b_esd ? _cell.length_c 43.571 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 20 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IY0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man SAV0927 11450.040 10 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 12 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ID(MSE)YLYDDNEESQVQFVGFVGEHSRYDL(MSE)LVHTNRHYGKTLVLN(MSE)QTNKFGIIGTDDLKEEGY IAHILGVNAEEGDEITEYLNEVIHLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MIDMYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLKEEGYIAHILGVNAEEGDEIT EYLNEVIHLEHHHHHH ; _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H,I,J _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ILE n 1 3 ASP n 1 4 MSE n 1 5 TYR n 1 6 LEU n 1 7 TYR n 1 8 ASP n 1 9 ASP n 1 10 ASN n 1 11 GLU n 1 12 GLU n 1 13 SER n 1 14 GLN n 1 15 VAL n 1 16 GLN n 1 17 PHE n 1 18 VAL n 1 19 GLY n 1 20 PHE n 1 21 VAL n 1 22 GLY n 1 23 GLU n 1 24 HIS n 1 25 SER n 1 26 ARG n 1 27 TYR n 1 28 ASP n 1 29 LEU n 1 30 MSE n 1 31 LEU n 1 32 VAL n 1 33 HIS n 1 34 THR n 1 35 ASN n 1 36 ARG n 1 37 HIS n 1 38 TYR n 1 39 GLY n 1 40 LYS n 1 41 THR n 1 42 LEU n 1 43 VAL n 1 44 LEU n 1 45 ASN n 1 46 MSE n 1 47 GLN n 1 48 THR n 1 49 ASN n 1 50 LYS n 1 51 PHE n 1 52 GLY n 1 53 ILE n 1 54 ILE n 1 55 GLY n 1 56 THR n 1 57 ASP n 1 58 ASP n 1 59 LEU n 1 60 LYS n 1 61 GLU n 1 62 GLU n 1 63 GLY n 1 64 TYR n 1 65 ILE n 1 66 ALA n 1 67 HIS n 1 68 ILE n 1 69 LEU n 1 70 GLY n 1 71 VAL n 1 72 ASN n 1 73 ALA n 1 74 GLU n 1 75 GLU n 1 76 GLY n 1 77 ASP n 1 78 GLU n 1 79 ILE n 1 80 THR n 1 81 GLU n 1 82 TYR n 1 83 LEU n 1 84 ASN n 1 85 GLU n 1 86 VAL n 1 87 ILE n 1 88 HIS n 1 89 LEU n 1 90 GLU n 1 91 HIS n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n 1 96 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 96 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SAV0927 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Mu50 / ATCC 700699' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158878 _entity_src_gen.pdbx_gene_src_variant Mu50 _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700699 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0H3JQV2_STAAM _struct_ref.pdbx_db_accession A0A0H3JQV2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIDMYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLKEEGYIAHILGVNAEEGDEIT EYLNEVIH ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6IY0 A 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 2 1 6IY0 B 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 3 1 6IY0 C 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 4 1 6IY0 D 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 5 1 6IY0 E 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 6 1 6IY0 F 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 7 1 6IY0 G 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 8 1 6IY0 H 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 9 1 6IY0 I 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 10 1 6IY0 J 1 ? 88 ? A0A0H3JQV2 1 ? 88 ? 1 88 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6IY0 LEU A 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 1 1 6IY0 GLU A 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 2 1 6IY0 HIS A 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 3 1 6IY0 HIS A 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 4 1 6IY0 HIS A 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 5 1 6IY0 HIS A 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 6 1 6IY0 HIS A 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 7 1 6IY0 HIS A 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 8 2 6IY0 LEU B 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 9 2 6IY0 GLU B 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 10 2 6IY0 HIS B 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 11 2 6IY0 HIS B 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 12 2 6IY0 HIS B 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 13 2 6IY0 HIS B 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 14 2 6IY0 HIS B 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 15 2 6IY0 HIS B 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 16 3 6IY0 LEU C 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 17 3 6IY0 GLU C 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 18 3 6IY0 HIS C 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 19 3 6IY0 HIS C 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 20 3 6IY0 HIS C 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 21 3 6IY0 HIS C 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 22 3 6IY0 HIS C 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 23 3 6IY0 HIS C 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 24 4 6IY0 LEU D 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 25 4 6IY0 GLU D 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 26 4 6IY0 HIS D 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 27 4 6IY0 HIS D 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 28 4 6IY0 HIS D 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 29 4 6IY0 HIS D 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 30 4 6IY0 HIS D 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 31 4 6IY0 HIS D 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 32 5 6IY0 LEU E 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 33 5 6IY0 GLU E 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 34 5 6IY0 HIS E 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 35 5 6IY0 HIS E 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 36 5 6IY0 HIS E 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 37 5 6IY0 HIS E 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 38 5 6IY0 HIS E 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 39 5 6IY0 HIS E 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 40 6 6IY0 LEU F 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 41 6 6IY0 GLU F 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 42 6 6IY0 HIS F 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 43 6 6IY0 HIS F 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 44 6 6IY0 HIS F 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 45 6 6IY0 HIS F 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 46 6 6IY0 HIS F 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 47 6 6IY0 HIS F 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 48 7 6IY0 LEU G 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 49 7 6IY0 GLU G 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 50 7 6IY0 HIS G 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 51 7 6IY0 HIS G 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 52 7 6IY0 HIS G 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 53 7 6IY0 HIS G 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 54 7 6IY0 HIS G 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 55 7 6IY0 HIS G 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 56 8 6IY0 LEU H 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 57 8 6IY0 GLU H 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 58 8 6IY0 HIS H 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 59 8 6IY0 HIS H 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 60 8 6IY0 HIS H 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 61 8 6IY0 HIS H 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 62 8 6IY0 HIS H 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 63 8 6IY0 HIS H 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 64 9 6IY0 LEU I 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 65 9 6IY0 GLU I 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 66 9 6IY0 HIS I 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 67 9 6IY0 HIS I 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 68 9 6IY0 HIS I 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 69 9 6IY0 HIS I 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 70 9 6IY0 HIS I 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 71 9 6IY0 HIS I 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 72 10 6IY0 LEU J 89 ? UNP A0A0H3JQV2 ? ? 'expression tag' 89 73 10 6IY0 GLU J 90 ? UNP A0A0H3JQV2 ? ? 'expression tag' 90 74 10 6IY0 HIS J 91 ? UNP A0A0H3JQV2 ? ? 'expression tag' 91 75 10 6IY0 HIS J 92 ? UNP A0A0H3JQV2 ? ? 'expression tag' 92 76 10 6IY0 HIS J 93 ? UNP A0A0H3JQV2 ? ? 'expression tag' 93 77 10 6IY0 HIS J 94 ? UNP A0A0H3JQV2 ? ? 'expression tag' 94 78 10 6IY0 HIS J 95 ? UNP A0A0H3JQV2 ? ? 'expression tag' 95 79 10 6IY0 HIS J 96 ? UNP A0A0H3JQV2 ? ? 'expression tag' 96 80 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IY0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.1 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Tris-HCl pH 7.5, ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IY0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 29554 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 6.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1495 _reflns_shell.percent_possible_all 99.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.397 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IY0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 28.799 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29255 _refine.ls_number_reflns_R_free 2011 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.21 _refine.ls_percent_reflns_R_free 6.87 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2395 _refine.ls_R_factor_R_free 0.2781 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2366 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.18 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.52 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.30 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 5913 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 5926 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 28.799 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 6016 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.518 ? 8112 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 2.445 ? 3662 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 894 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 1054 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4901 2.5523 . . 132 1859 92.00 . . . 0.3059 . 0.2518 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5523 2.6213 . . 141 1898 97.00 . . . 0.3211 . 0.2412 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6213 2.6984 . . 151 1935 98.00 . . . 0.3385 . 0.2526 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6984 2.7854 . . 141 1902 99.00 . . . 0.3140 . 0.2608 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7854 2.8848 . . 145 1978 99.00 . . . 0.2827 . 0.2568 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8848 3.0002 . . 147 1921 99.00 . . . 0.3297 . 0.2589 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0002 3.1366 . . 143 1999 100.00 . . . 0.3047 . 0.2409 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1366 3.3018 . . 147 1963 100.00 . . . 0.2661 . 0.2294 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3018 3.5083 . . 141 1955 100.00 . . . 0.2893 . 0.2337 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5083 3.7786 . . 142 1967 99.00 . . . 0.2464 . 0.2126 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7786 4.1579 . . 142 1970 100.00 . . . 0.2654 . 0.2207 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1579 4.7572 . . 147 1992 99.00 . . . 0.2282 . 0.1923 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7572 5.9847 . . 154 1976 99.00 . . . 0.2438 . 0.2344 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.9847 28.8005 . . 138 1929 94.00 . . . 0.3106 . 0.2917 . . . . . . . . . . # _struct.entry_id 6IY0 _struct.title 'Crystal structure of conserved hypothetical protein SAV0927 from Staphylococcus aureus subsp. aureus Mu50' _struct.pdbx_descriptor SAV0927 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IY0 _struct_keywords.text 'DUF3055, SAV0927, Staphylococcus aureus, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? I N N 1 ? J N N 1 ? K N N 2 ? L N N 3 ? M N N 3 ? N N N 3 ? O N N 3 ? P N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 34 ? TYR A 38 ? THR A 34 TYR A 38 5 ? 5 HELX_P HELX_P2 AA2 TYR A 64 ? LEU A 69 ? TYR A 64 LEU A 69 1 ? 6 HELX_P HELX_P3 AA3 ASN A 72 ? VAL A 86 ? ASN A 72 VAL A 86 1 ? 15 HELX_P HELX_P4 AA4 ASN B 35 ? TYR B 38 ? ASN B 35 TYR B 38 5 ? 4 HELX_P HELX_P5 AA5 ILE B 65 ? LEU B 69 ? ILE B 65 LEU B 69 1 ? 5 HELX_P HELX_P6 AA6 GLY B 76 ? ASN B 84 ? GLY B 76 ASN B 84 1 ? 9 HELX_P HELX_P7 AA7 THR C 34 ? TYR C 38 ? THR C 34 TYR C 38 5 ? 5 HELX_P HELX_P8 AA8 GLY C 55 ? LYS C 60 ? GLY C 55 LYS C 60 5 ? 6 HELX_P HELX_P9 AA9 GLY C 63 ? GLY C 70 ? GLY C 63 GLY C 70 1 ? 8 HELX_P HELX_P10 AB1 ASN C 72 ? GLU C 85 ? ASN C 72 GLU C 85 1 ? 14 HELX_P HELX_P11 AB2 GLY D 55 ? GLU D 61 ? GLY D 55 GLU D 61 1 ? 7 HELX_P HELX_P12 AB3 GLY D 63 ? GLY D 70 ? GLY D 63 GLY D 70 1 ? 8 HELX_P HELX_P13 AB4 ASN D 72 ? VAL D 86 ? ASN D 72 VAL D 86 1 ? 15 HELX_P HELX_P14 AB5 THR E 34 ? TYR E 38 ? THR E 34 TYR E 38 5 ? 5 HELX_P HELX_P15 AB6 GLY E 63 ? GLY E 70 ? GLY E 63 GLY E 70 1 ? 8 HELX_P HELX_P16 AB7 ASN E 72 ? ILE E 87 ? ASN E 72 ILE E 87 1 ? 16 HELX_P HELX_P17 AB8 THR F 34 ? TYR F 38 ? THR F 34 TYR F 38 5 ? 5 HELX_P HELX_P18 AB9 ASP F 57 ? GLU F 61 ? ASP F 57 GLU F 61 5 ? 5 HELX_P HELX_P19 AC1 GLY F 63 ? LEU F 69 ? GLY F 63 LEU F 69 1 ? 7 HELX_P HELX_P20 AC2 ASN F 72 ? ILE F 87 ? ASN F 72 ILE F 87 1 ? 16 HELX_P HELX_P21 AC3 THR G 34 ? TYR G 38 ? THR G 34 TYR G 38 5 ? 5 HELX_P HELX_P22 AC4 GLY G 63 ? GLY G 70 ? GLY G 63 GLY G 70 1 ? 8 HELX_P HELX_P23 AC5 ASN G 72 ? ILE G 87 ? ASN G 72 ILE G 87 1 ? 16 HELX_P HELX_P24 AC6 GLY H 55 ? GLU H 61 ? GLY H 55 GLU H 61 1 ? 7 HELX_P HELX_P25 AC7 GLY H 63 ? GLY H 70 ? GLY H 63 GLY H 70 1 ? 8 HELX_P HELX_P26 AC8 ASN H 72 ? ILE H 87 ? ASN H 72 ILE H 87 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LEU 29 C ? ? ? 1_555 A MSE 30 N ? ? A LEU 29 A MSE 30 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A MSE 30 C ? ? ? 1_555 A LEU 31 N ? ? A MSE 30 A LEU 31 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale both ? A ASN 45 C ? ? ? 1_555 A MSE 46 N ? ? A ASN 45 A MSE 46 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale both ? A MSE 46 C ? ? ? 1_555 A GLN 47 N ? ? A MSE 46 A GLN 47 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale both ? B ASP 3 C ? ? ? 1_555 B MSE 4 N ? ? B ASP 3 B MSE 4 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale both ? B MSE 4 C ? ? ? 1_555 B TYR 5 N ? ? B MSE 4 B TYR 5 1_555 ? ? ? ? ? ? ? 1.332 ? covale7 covale both ? B LEU 29 C ? ? ? 1_555 B MSE 30 N ? ? B LEU 29 B MSE 30 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale both ? B MSE 30 C ? ? ? 1_555 B LEU 31 N ? ? B MSE 30 B LEU 31 1_555 ? ? ? ? ? ? ? 1.328 ? covale9 covale both ? B ASN 45 C ? ? ? 1_555 B MSE 46 N ? ? B ASN 45 B MSE 46 1_555 ? ? ? ? ? ? ? 1.329 ? covale10 covale both ? B MSE 46 C ? ? ? 1_555 B GLN 47 N ? ? B MSE 46 B GLN 47 1_555 ? ? ? ? ? ? ? 1.333 ? covale11 covale both ? C ASP 3 C ? ? ? 1_555 C MSE 4 N ? ? C ASP 3 C MSE 4 1_555 ? ? ? ? ? ? ? 1.329 ? covale12 covale both ? C MSE 4 C ? ? ? 1_555 C TYR 5 N ? ? C MSE 4 C TYR 5 1_555 ? ? ? ? ? ? ? 1.328 ? covale13 covale both ? C LEU 29 C ? ? ? 1_555 C MSE 30 N ? ? C LEU 29 C MSE 30 1_555 ? ? ? ? ? ? ? 1.324 ? covale14 covale both ? C MSE 30 C ? ? ? 1_555 C LEU 31 N ? ? C MSE 30 C LEU 31 1_555 ? ? ? ? ? ? ? 1.326 ? covale15 covale both ? C ASN 45 C ? ? ? 1_555 C MSE 46 N ? ? C ASN 45 C MSE 46 1_555 ? ? ? ? ? ? ? 1.331 ? covale16 covale both ? C MSE 46 C ? ? ? 1_555 C GLN 47 N ? ? C MSE 46 C GLN 47 1_555 ? ? ? ? ? ? ? 1.331 ? covale17 covale both ? D MSE 1 C ? ? ? 1_555 D ILE 2 N ? ? D MSE 1 D ILE 2 1_555 ? ? ? ? ? ? ? 1.328 ? covale18 covale both ? D ASP 3 C ? ? ? 1_555 D MSE 4 N ? ? D ASP 3 D MSE 4 1_555 ? ? ? ? ? ? ? 1.328 ? covale19 covale both ? D MSE 4 C ? ? ? 1_555 D TYR 5 N ? ? D MSE 4 D TYR 5 1_555 ? ? ? ? ? ? ? 1.329 ? covale20 covale both ? D LEU 29 C ? ? ? 1_555 D MSE 30 N ? ? D LEU 29 D MSE 30 1_555 ? ? ? ? ? ? ? 1.328 ? covale21 covale both ? D MSE 30 C ? ? ? 1_555 D LEU 31 N ? ? D MSE 30 D LEU 31 1_555 ? ? ? ? ? ? ? 1.326 ? covale22 covale both ? D ASN 45 C ? ? ? 1_555 D MSE 46 N ? ? D ASN 45 D MSE 46 1_555 ? ? ? ? ? ? ? 1.329 ? covale23 covale both ? D MSE 46 C ? ? ? 1_555 D GLN 47 N ? ? D MSE 46 D GLN 47 1_555 ? ? ? ? ? ? ? 1.333 ? covale24 covale both ? E MSE 1 C ? ? ? 1_555 E ILE 2 N ? ? E MSE 1 E ILE 2 1_555 ? ? ? ? ? ? ? 1.330 ? covale25 covale both ? E ASP 3 C ? ? ? 1_555 E MSE 4 N ? ? E ASP 3 E MSE 4 1_555 ? ? ? ? ? ? ? 1.329 ? covale26 covale both ? E MSE 4 C ? ? ? 1_555 E TYR 5 N ? ? E MSE 4 E TYR 5 1_555 ? ? ? ? ? ? ? 1.332 ? covale27 covale both ? E LEU 29 C ? ? ? 1_555 E MSE 30 N ? ? E LEU 29 E MSE 30 1_555 ? ? ? ? ? ? ? 1.328 ? covale28 covale both ? E MSE 30 C ? ? ? 1_555 E LEU 31 N ? ? E MSE 30 E LEU 31 1_555 ? ? ? ? ? ? ? 1.328 ? covale29 covale both ? E ASN 45 C ? ? ? 1_555 E MSE 46 N ? ? E ASN 45 E MSE 46 1_555 ? ? ? ? ? ? ? 1.333 ? covale30 covale both ? E MSE 46 C ? ? ? 1_555 E GLN 47 N ? ? E MSE 46 E GLN 47 1_555 ? ? ? ? ? ? ? 1.330 ? covale31 covale both ? F MSE 1 C ? ? ? 1_555 F ILE 2 N ? ? F MSE 1 F ILE 2 1_555 ? ? ? ? ? ? ? 1.329 ? covale32 covale both ? F ASP 3 C ? ? ? 1_555 F MSE 4 N ? ? F ASP 3 F MSE 4 1_555 ? ? ? ? ? ? ? 1.328 ? covale33 covale both ? F MSE 4 C ? ? ? 1_555 F TYR 5 N ? ? F MSE 4 F TYR 5 1_555 ? ? ? ? ? ? ? 1.332 ? covale34 covale both ? F LEU 29 C ? ? ? 1_555 F MSE 30 N ? ? F LEU 29 F MSE 30 1_555 ? ? ? ? ? ? ? 1.326 ? covale35 covale both ? F MSE 30 C ? ? ? 1_555 F LEU 31 N ? ? F MSE 30 F LEU 31 1_555 ? ? ? ? ? ? ? 1.329 ? covale36 covale both ? F ASN 45 C ? ? ? 1_555 F MSE 46 N ? ? F ASN 45 F MSE 46 1_555 ? ? ? ? ? ? ? 1.328 ? covale37 covale both ? F MSE 46 C ? ? ? 1_555 F GLN 47 N ? ? F MSE 46 F GLN 47 1_555 ? ? ? ? ? ? ? 1.332 ? covale38 covale both ? G ASP 3 C ? ? ? 1_555 G MSE 4 N ? ? G ASP 3 G MSE 4 1_555 ? ? ? ? ? ? ? 1.329 ? covale39 covale both ? G MSE 4 C ? ? ? 1_555 G TYR 5 N ? ? G MSE 4 G TYR 5 1_555 ? ? ? ? ? ? ? 1.330 ? covale40 covale both ? G LEU 29 C ? ? ? 1_555 G MSE 30 N ? ? G LEU 29 G MSE 30 1_555 ? ? ? ? ? ? ? 1.327 ? covale41 covale both ? G MSE 30 C ? ? ? 1_555 G LEU 31 N ? ? G MSE 30 G LEU 31 1_555 ? ? ? ? ? ? ? 1.327 ? covale42 covale both ? G ASN 45 C ? ? ? 1_555 G MSE 46 N ? ? G ASN 45 G MSE 46 1_555 ? ? ? ? ? ? ? 1.329 ? covale43 covale both ? G MSE 46 C ? ? ? 1_555 G GLN 47 N ? ? G MSE 46 G GLN 47 1_555 ? ? ? ? ? ? ? 1.329 ? covale44 covale both ? H MSE 1 C ? ? ? 1_555 H ILE 2 N ? ? H MSE 1 H ILE 2 1_555 ? ? ? ? ? ? ? 1.326 ? covale45 covale both ? H ASP 3 C ? ? ? 1_555 H MSE 4 N ? ? H ASP 3 H MSE 4 1_555 ? ? ? ? ? ? ? 1.328 ? covale46 covale both ? H MSE 4 C ? ? ? 1_555 H TYR 5 N ? ? H MSE 4 H TYR 5 1_555 ? ? ? ? ? ? ? 1.330 ? covale47 covale both ? H LEU 29 C ? ? ? 1_555 H MSE 30 N ? ? H LEU 29 H MSE 30 1_555 ? ? ? ? ? ? ? 1.328 ? covale48 covale both ? H MSE 30 C ? ? ? 1_555 H LEU 31 N ? ? H MSE 30 H LEU 31 1_555 ? ? ? ? ? ? ? 1.330 ? covale49 covale both ? H ASN 45 C ? ? ? 1_555 H MSE 46 N ? ? H ASN 45 H MSE 46 1_555 ? ? ? ? ? ? ? 1.333 ? covale50 covale both ? H MSE 46 C ? ? ? 1_555 H GLN 47 N ? ? H MSE 46 H GLN 47 1_555 ? ? ? ? ? ? ? 1.327 ? covale51 covale both ? I LEU 29 C ? ? ? 1_555 I MSE 30 N ? ? I LEU 29 I MSE 30 1_555 ? ? ? ? ? ? ? 1.329 ? covale52 covale both ? I MSE 30 C ? ? ? 1_555 I LEU 31 N ? ? I MSE 30 I LEU 31 1_555 ? ? ? ? ? ? ? 1.331 ? covale53 covale both ? J LEU 29 C ? ? ? 1_555 J MSE 30 N ? ? J LEU 29 J MSE 30 1_555 ? ? ? ? ? ? ? 1.328 ? covale54 covale both ? J MSE 30 C ? ? ? 1_555 J LEU 31 N ? ? J MSE 30 J LEU 31 1_555 ? ? ? ? ? ? ? 1.331 ? covale55 covale both ? J ASN 45 C ? ? ? 1_555 J MSE 46 N ? ? J ASN 45 J MSE 46 1_555 ? ? ? ? ? ? ? 1.329 ? covale56 covale both ? J MSE 46 C ? ? ? 1_555 J GLN 47 N ? ? J MSE 46 J GLN 47 1_555 ? ? ? ? ? ? ? 1.338 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 8 ? AA3 ? 8 ? AA4 ? 8 ? AA5 ? 4 ? AA6 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA4 7 8 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 50 ? ILE A 54 ? LYS A 50 ILE A 54 AA1 2 THR A 41 ? ASN A 45 ? THR A 41 ASN A 45 AA1 3 TYR A 27 ? HIS A 33 ? TYR A 27 HIS A 33 AA1 4 ASP A 8 ? PHE A 20 ? ASP A 8 PHE A 20 AA1 5 TYR B 5 ? PHE B 20 ? TYR B 5 PHE B 20 AA1 6 TYR B 27 ? HIS B 33 ? TYR B 27 HIS B 33 AA1 7 THR B 41 ? ASN B 45 ? THR B 41 ASN B 45 AA1 8 LYS B 50 ? ILE B 54 ? LYS B 50 ILE B 54 AA2 1 LYS C 50 ? ILE C 54 ? LYS C 50 ILE C 54 AA2 2 THR C 41 ? ASN C 45 ? THR C 41 ASN C 45 AA2 3 ARG C 26 ? HIS C 33 ? ARG C 26 HIS C 33 AA2 4 MSE C 4 ? GLY C 22 ? MSE C 4 GLY C 22 AA2 5 ILE D 2 ? VAL D 21 ? ILE D 2 VAL D 21 AA2 6 TYR D 27 ? HIS D 33 ? TYR D 27 HIS D 33 AA2 7 THR D 41 ? ASN D 45 ? THR D 41 ASN D 45 AA2 8 PHE D 51 ? ILE D 54 ? PHE D 51 ILE D 54 AA3 1 PHE E 51 ? ILE E 54 ? PHE E 51 ILE E 54 AA3 2 THR E 41 ? ASN E 45 ? THR E 41 ASN E 45 AA3 3 ARG E 26 ? HIS E 33 ? ARG E 26 HIS E 33 AA3 4 ILE E 2 ? GLY E 22 ? ILE E 2 GLY E 22 AA3 5 ILE F 2 ? GLY F 22 ? ILE F 2 GLY F 22 AA3 6 ARG F 26 ? HIS F 33 ? ARG F 26 HIS F 33 AA3 7 THR F 41 ? ASN F 45 ? THR F 41 ASN F 45 AA3 8 LYS F 50 ? ILE F 54 ? LYS F 50 ILE F 54 AA4 1 LYS G 50 ? ILE G 54 ? LYS G 50 ILE G 54 AA4 2 THR G 41 ? ASN G 45 ? THR G 41 ASN G 45 AA4 3 ARG G 26 ? HIS G 33 ? ARG G 26 HIS G 33 AA4 4 MSE G 4 ? GLY G 22 ? MSE G 4 GLY G 22 AA4 5 ILE H 2 ? VAL H 21 ? ILE H 2 VAL H 21 AA4 6 ARG H 26 ? HIS H 33 ? ARG H 26 HIS H 33 AA4 7 THR H 41 ? ASN H 45 ? THR H 41 ASN H 45 AA4 8 LYS H 50 ? ILE H 54 ? LYS H 50 ILE H 54 AA5 1 TYR I 7 ? GLU I 12 ? TYR I 7 GLU I 12 AA5 2 GLN J 14 ? GLY J 19 ? GLN J 14 GLY J 19 AA5 3 LEU J 29 ? HIS J 33 ? LEU J 29 HIS J 33 AA5 4 LEU J 42 ? ASN J 45 ? LEU J 42 ASN J 45 AA6 1 GLN I 16 ? PHE I 17 ? GLN I 16 PHE I 17 AA6 2 MSE I 30 ? VAL I 32 ? MSE I 30 VAL I 32 AA6 3 LEU I 42 ? LEU I 44 ? LEU I 42 LEU I 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 50 ? O LYS A 50 N ASN A 45 ? N ASN A 45 AA1 2 3 O LEU A 44 ? O LEU A 44 N MSE A 30 ? N MSE A 30 AA1 3 4 O LEU A 31 ? O LEU A 31 N GLN A 16 ? N GLN A 16 AA1 4 5 N ASP A 9 ? N ASP A 9 O PHE B 17 ? O PHE B 17 AA1 5 6 N GLN B 16 ? N GLN B 16 O LEU B 31 ? O LEU B 31 AA1 6 7 N MSE B 30 ? N MSE B 30 O LEU B 44 ? O LEU B 44 AA1 7 8 N THR B 41 ? N THR B 41 O ILE B 54 ? O ILE B 54 AA2 1 2 O ILE C 54 ? O ILE C 54 N THR C 41 ? N THR C 41 AA2 2 3 O LEU C 42 ? O LEU C 42 N VAL C 32 ? N VAL C 32 AA2 3 4 O TYR C 27 ? O TYR C 27 N PHE C 20 ? N PHE C 20 AA2 4 5 N GLU C 11 ? N GLU C 11 O VAL D 15 ? O VAL D 15 AA2 5 6 N PHE D 20 ? N PHE D 20 O TYR D 27 ? O TYR D 27 AA2 6 7 N MSE D 30 ? N MSE D 30 O LEU D 44 ? O LEU D 44 AA2 7 8 N THR D 41 ? N THR D 41 O ILE D 54 ? O ILE D 54 AA3 1 2 O ILE E 54 ? O ILE E 54 N THR E 41 ? N THR E 41 AA3 2 3 O LEU E 44 ? O LEU E 44 N MSE E 30 ? N MSE E 30 AA3 3 4 O TYR E 27 ? O TYR E 27 N PHE E 20 ? N PHE E 20 AA3 4 5 N LEU E 6 ? N LEU E 6 O GLY F 19 ? O GLY F 19 AA3 5 6 N PHE F 20 ? N PHE F 20 O TYR F 27 ? O TYR F 27 AA3 6 7 N MSE F 30 ? N MSE F 30 O LEU F 44 ? O LEU F 44 AA3 7 8 N THR F 41 ? N THR F 41 O ILE F 54 ? O ILE F 54 AA4 1 2 O LYS G 50 ? O LYS G 50 N ASN G 45 ? N ASN G 45 AA4 2 3 O LEU G 44 ? O LEU G 44 N MSE G 30 ? N MSE G 30 AA4 3 4 O TYR G 27 ? O TYR G 27 N PHE G 20 ? N PHE G 20 AA4 4 5 N GLU G 11 ? N GLU G 11 O VAL H 15 ? O VAL H 15 AA4 5 6 N PHE H 20 ? N PHE H 20 O TYR H 27 ? O TYR H 27 AA4 6 7 N MSE H 30 ? N MSE H 30 O LEU H 44 ? O LEU H 44 AA4 7 8 N THR H 41 ? N THR H 41 O ILE H 54 ? O ILE H 54 AA5 1 2 N GLU I 11 ? N GLU I 11 O VAL J 15 ? O VAL J 15 AA5 2 3 N GLN J 14 ? N GLN J 14 O HIS J 33 ? O HIS J 33 AA5 3 4 N MSE J 30 ? N MSE J 30 O LEU J 44 ? O LEU J 44 AA6 1 2 N GLN I 16 ? N GLN I 16 O LEU I 31 ? O LEU I 31 AA6 2 3 N MSE I 30 ? N MSE I 30 O LEU I 44 ? O LEU I 44 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id E _struct_site.pdbx_auth_comp_id CL _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'binding site for residue CL E 101' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id ALA _struct_site_gen.label_asym_id E _struct_site_gen.label_seq_id 73 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id ALA _struct_site_gen.auth_asym_id E _struct_site_gen.auth_seq_id 73 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _atom_sites.entry_id 6IY0 _atom_sites.fract_transf_matrix[1][1] 0.007801 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000048 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013029 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022951 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 MSE 4 4 ? ? ? A . n A 1 5 TYR 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 GLU 23 23 ? ? ? A . n A 1 24 HIS 24 24 ? ? ? A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 MSE 30 30 30 MSE MSE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 MSE 46 46 46 MSE MSE A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 ? ? ? A . n A 1 57 ASP 57 57 ? ? ? A . n A 1 58 ASP 58 58 ? ? ? A . n A 1 59 LEU 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ILE 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 LEU 89 89 ? ? ? A . n A 1 90 GLU 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n B 1 1 MSE 1 1 ? ? ? B . n B 1 2 ILE 2 2 2 ILE ILE B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 MSE 4 4 4 MSE MSE B . n B 1 5 TYR 5 5 5 TYR TYR B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 TYR 7 7 7 TYR TYR B . n B 1 8 ASP 8 8 8 ASP ASP B . n B 1 9 ASP 9 9 9 ASP ASP B . n B 1 10 ASN 10 10 10 ASN ASN B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 GLN 14 14 14 GLN GLN B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 GLN 16 16 16 GLN GLN B . n B 1 17 PHE 17 17 17 PHE PHE B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 GLY 19 19 19 GLY GLY B . n B 1 20 PHE 20 20 20 PHE PHE B . n B 1 21 VAL 21 21 ? ? ? B . n B 1 22 GLY 22 22 ? ? ? B . n B 1 23 GLU 23 23 ? ? ? B . n B 1 24 HIS 24 24 ? ? ? B . n B 1 25 SER 25 25 25 SER SER B . n B 1 26 ARG 26 26 26 ARG ARG B . n B 1 27 TYR 27 27 27 TYR TYR B . n B 1 28 ASP 28 28 28 ASP ASP B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 MSE 30 30 30 MSE MSE B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 HIS 33 33 33 HIS HIS B . n B 1 34 THR 34 34 34 THR THR B . n B 1 35 ASN 35 35 35 ASN ASN B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 HIS 37 37 37 HIS HIS B . n B 1 38 TYR 38 38 38 TYR TYR B . n B 1 39 GLY 39 39 39 GLY GLY B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 THR 41 41 41 THR THR B . n B 1 42 LEU 42 42 42 LEU LEU B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 ASN 45 45 45 ASN ASN B . n B 1 46 MSE 46 46 46 MSE MSE B . n B 1 47 GLN 47 47 47 GLN GLN B . n B 1 48 THR 48 48 48 THR THR B . n B 1 49 ASN 49 49 49 ASN ASN B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 PHE 51 51 51 PHE PHE B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 ILE 53 53 53 ILE ILE B . n B 1 54 ILE 54 54 54 ILE ILE B . n B 1 55 GLY 55 55 55 GLY GLY B . n B 1 56 THR 56 56 56 THR THR B . n B 1 57 ASP 57 57 57 ASP ASP B . n B 1 58 ASP 58 58 58 ASP ASP B . n B 1 59 LEU 59 59 ? ? ? B . n B 1 60 LYS 60 60 ? ? ? B . n B 1 61 GLU 61 61 ? ? ? B . n B 1 62 GLU 62 62 ? ? ? B . n B 1 63 GLY 63 63 ? ? ? B . n B 1 64 TYR 64 64 64 TYR TYR B . n B 1 65 ILE 65 65 65 ILE ILE B . n B 1 66 ALA 66 66 66 ALA ALA B . n B 1 67 HIS 67 67 67 HIS HIS B . n B 1 68 ILE 68 68 68 ILE ILE B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLY 70 70 ? ? ? B . n B 1 71 VAL 71 71 ? ? ? B . n B 1 72 ASN 72 72 ? ? ? B . n B 1 73 ALA 73 73 ? ? ? B . n B 1 74 GLU 74 74 ? ? ? B . n B 1 75 GLU 75 75 75 GLU GLU B . n B 1 76 GLY 76 76 76 GLY GLY B . n B 1 77 ASP 77 77 77 ASP ASP B . n B 1 78 GLU 78 78 78 GLU GLU B . n B 1 79 ILE 79 79 79 ILE ILE B . n B 1 80 THR 80 80 80 THR THR B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 TYR 82 82 82 TYR TYR B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 ASN 84 84 84 ASN ASN B . n B 1 85 GLU 85 85 85 GLU GLU B . n B 1 86 VAL 86 86 86 VAL VAL B . n B 1 87 ILE 87 87 87 ILE ILE B . n B 1 88 HIS 88 88 ? ? ? B . n B 1 89 LEU 89 89 ? ? ? B . n B 1 90 GLU 90 90 ? ? ? B . n B 1 91 HIS 91 91 ? ? ? B . n B 1 92 HIS 92 92 ? ? ? B . n B 1 93 HIS 93 93 ? ? ? B . n B 1 94 HIS 94 94 ? ? ? B . n B 1 95 HIS 95 95 ? ? ? B . n B 1 96 HIS 96 96 ? ? ? B . n C 1 1 MSE 1 1 ? ? ? C . n C 1 2 ILE 2 2 ? ? ? C . n C 1 3 ASP 3 3 3 ASP ASP C . n C 1 4 MSE 4 4 4 MSE MSE C . n C 1 5 TYR 5 5 5 TYR TYR C . n C 1 6 LEU 6 6 6 LEU LEU C . n C 1 7 TYR 7 7 7 TYR TYR C . n C 1 8 ASP 8 8 8 ASP ASP C . n C 1 9 ASP 9 9 9 ASP ASP C . n C 1 10 ASN 10 10 10 ASN ASN C . n C 1 11 GLU 11 11 11 GLU GLU C . n C 1 12 GLU 12 12 12 GLU GLU C . n C 1 13 SER 13 13 13 SER SER C . n C 1 14 GLN 14 14 14 GLN GLN C . n C 1 15 VAL 15 15 15 VAL VAL C . n C 1 16 GLN 16 16 16 GLN GLN C . n C 1 17 PHE 17 17 17 PHE PHE C . n C 1 18 VAL 18 18 18 VAL VAL C . n C 1 19 GLY 19 19 19 GLY GLY C . n C 1 20 PHE 20 20 20 PHE PHE C . n C 1 21 VAL 21 21 21 VAL VAL C . n C 1 22 GLY 22 22 22 GLY GLY C . n C 1 23 GLU 23 23 23 GLU GLU C . n C 1 24 HIS 24 24 24 HIS HIS C . n C 1 25 SER 25 25 25 SER SER C . n C 1 26 ARG 26 26 26 ARG ARG C . n C 1 27 TYR 27 27 27 TYR TYR C . n C 1 28 ASP 28 28 28 ASP ASP C . n C 1 29 LEU 29 29 29 LEU LEU C . n C 1 30 MSE 30 30 30 MSE MSE C . n C 1 31 LEU 31 31 31 LEU LEU C . n C 1 32 VAL 32 32 32 VAL VAL C . n C 1 33 HIS 33 33 33 HIS HIS C . n C 1 34 THR 34 34 34 THR THR C . n C 1 35 ASN 35 35 35 ASN ASN C . n C 1 36 ARG 36 36 36 ARG ARG C . n C 1 37 HIS 37 37 37 HIS HIS C . n C 1 38 TYR 38 38 38 TYR TYR C . n C 1 39 GLY 39 39 39 GLY GLY C . n C 1 40 LYS 40 40 40 LYS LYS C . n C 1 41 THR 41 41 41 THR THR C . n C 1 42 LEU 42 42 42 LEU LEU C . n C 1 43 VAL 43 43 43 VAL VAL C . n C 1 44 LEU 44 44 44 LEU LEU C . n C 1 45 ASN 45 45 45 ASN ASN C . n C 1 46 MSE 46 46 46 MSE MSE C . n C 1 47 GLN 47 47 47 GLN GLN C . n C 1 48 THR 48 48 48 THR THR C . n C 1 49 ASN 49 49 49 ASN ASN C . n C 1 50 LYS 50 50 50 LYS LYS C . n C 1 51 PHE 51 51 51 PHE PHE C . n C 1 52 GLY 52 52 52 GLY GLY C . n C 1 53 ILE 53 53 53 ILE ILE C . n C 1 54 ILE 54 54 54 ILE ILE C . n C 1 55 GLY 55 55 55 GLY GLY C . n C 1 56 THR 56 56 56 THR THR C . n C 1 57 ASP 57 57 57 ASP ASP C . n C 1 58 ASP 58 58 58 ASP ASP C . n C 1 59 LEU 59 59 59 LEU LEU C . n C 1 60 LYS 60 60 60 LYS LYS C . n C 1 61 GLU 61 61 61 GLU GLU C . n C 1 62 GLU 62 62 62 GLU GLU C . n C 1 63 GLY 63 63 63 GLY GLY C . n C 1 64 TYR 64 64 64 TYR TYR C . n C 1 65 ILE 65 65 65 ILE ILE C . n C 1 66 ALA 66 66 66 ALA ALA C . n C 1 67 HIS 67 67 67 HIS HIS C . n C 1 68 ILE 68 68 68 ILE ILE C . n C 1 69 LEU 69 69 69 LEU LEU C . n C 1 70 GLY 70 70 70 GLY GLY C . n C 1 71 VAL 71 71 71 VAL VAL C . n C 1 72 ASN 72 72 72 ASN ASN C . n C 1 73 ALA 73 73 73 ALA ALA C . n C 1 74 GLU 74 74 74 GLU GLU C . n C 1 75 GLU 75 75 75 GLU GLU C . n C 1 76 GLY 76 76 76 GLY GLY C . n C 1 77 ASP 77 77 77 ASP ASP C . n C 1 78 GLU 78 78 78 GLU GLU C . n C 1 79 ILE 79 79 79 ILE ILE C . n C 1 80 THR 80 80 80 THR THR C . n C 1 81 GLU 81 81 81 GLU GLU C . n C 1 82 TYR 82 82 82 TYR TYR C . n C 1 83 LEU 83 83 83 LEU LEU C . n C 1 84 ASN 84 84 84 ASN ASN C . n C 1 85 GLU 85 85 85 GLU GLU C . n C 1 86 VAL 86 86 86 VAL VAL C . n C 1 87 ILE 87 87 87 ILE ILE C . n C 1 88 HIS 88 88 ? ? ? C . n C 1 89 LEU 89 89 ? ? ? C . n C 1 90 GLU 90 90 ? ? ? C . n C 1 91 HIS 91 91 ? ? ? C . n C 1 92 HIS 92 92 ? ? ? C . n C 1 93 HIS 93 93 ? ? ? C . n C 1 94 HIS 94 94 ? ? ? C . n C 1 95 HIS 95 95 ? ? ? C . n C 1 96 HIS 96 96 ? ? ? C . n D 1 1 MSE 1 1 1 MSE MSE D . n D 1 2 ILE 2 2 2 ILE ILE D . n D 1 3 ASP 3 3 3 ASP ASP D . n D 1 4 MSE 4 4 4 MSE MSE D . n D 1 5 TYR 5 5 5 TYR TYR D . n D 1 6 LEU 6 6 6 LEU LEU D . n D 1 7 TYR 7 7 7 TYR TYR D . n D 1 8 ASP 8 8 8 ASP ASP D . n D 1 9 ASP 9 9 9 ASP ASP D . n D 1 10 ASN 10 10 10 ASN ASN D . n D 1 11 GLU 11 11 11 GLU GLU D . n D 1 12 GLU 12 12 12 GLU GLU D . n D 1 13 SER 13 13 13 SER SER D . n D 1 14 GLN 14 14 14 GLN GLN D . n D 1 15 VAL 15 15 15 VAL VAL D . n D 1 16 GLN 16 16 16 GLN GLN D . n D 1 17 PHE 17 17 17 PHE PHE D . n D 1 18 VAL 18 18 18 VAL VAL D . n D 1 19 GLY 19 19 19 GLY GLY D . n D 1 20 PHE 20 20 20 PHE PHE D . n D 1 21 VAL 21 21 21 VAL VAL D . n D 1 22 GLY 22 22 22 GLY GLY D . n D 1 23 GLU 23 23 ? ? ? D . n D 1 24 HIS 24 24 ? ? ? D . n D 1 25 SER 25 25 25 SER SER D . n D 1 26 ARG 26 26 26 ARG ARG D . n D 1 27 TYR 27 27 27 TYR TYR D . n D 1 28 ASP 28 28 28 ASP ASP D . n D 1 29 LEU 29 29 29 LEU LEU D . n D 1 30 MSE 30 30 30 MSE MSE D . n D 1 31 LEU 31 31 31 LEU LEU D . n D 1 32 VAL 32 32 32 VAL VAL D . n D 1 33 HIS 33 33 33 HIS HIS D . n D 1 34 THR 34 34 34 THR THR D . n D 1 35 ASN 35 35 35 ASN ASN D . n D 1 36 ARG 36 36 36 ARG ARG D . n D 1 37 HIS 37 37 37 HIS HIS D . n D 1 38 TYR 38 38 38 TYR TYR D . n D 1 39 GLY 39 39 39 GLY GLY D . n D 1 40 LYS 40 40 40 LYS LYS D . n D 1 41 THR 41 41 41 THR THR D . n D 1 42 LEU 42 42 42 LEU LEU D . n D 1 43 VAL 43 43 43 VAL VAL D . n D 1 44 LEU 44 44 44 LEU LEU D . n D 1 45 ASN 45 45 45 ASN ASN D . n D 1 46 MSE 46 46 46 MSE MSE D . n D 1 47 GLN 47 47 47 GLN GLN D . n D 1 48 THR 48 48 48 THR THR D . n D 1 49 ASN 49 49 49 ASN ASN D . n D 1 50 LYS 50 50 50 LYS LYS D . n D 1 51 PHE 51 51 51 PHE PHE D . n D 1 52 GLY 52 52 52 GLY GLY D . n D 1 53 ILE 53 53 53 ILE ILE D . n D 1 54 ILE 54 54 54 ILE ILE D . n D 1 55 GLY 55 55 55 GLY GLY D . n D 1 56 THR 56 56 56 THR THR D . n D 1 57 ASP 57 57 57 ASP ASP D . n D 1 58 ASP 58 58 58 ASP ASP D . n D 1 59 LEU 59 59 59 LEU LEU D . n D 1 60 LYS 60 60 60 LYS LYS D . n D 1 61 GLU 61 61 61 GLU GLU D . n D 1 62 GLU 62 62 62 GLU GLU D . n D 1 63 GLY 63 63 63 GLY GLY D . n D 1 64 TYR 64 64 64 TYR TYR D . n D 1 65 ILE 65 65 65 ILE ILE D . n D 1 66 ALA 66 66 66 ALA ALA D . n D 1 67 HIS 67 67 67 HIS HIS D . n D 1 68 ILE 68 68 68 ILE ILE D . n D 1 69 LEU 69 69 69 LEU LEU D . n D 1 70 GLY 70 70 70 GLY GLY D . n D 1 71 VAL 71 71 71 VAL VAL D . n D 1 72 ASN 72 72 72 ASN ASN D . n D 1 73 ALA 73 73 73 ALA ALA D . n D 1 74 GLU 74 74 74 GLU GLU D . n D 1 75 GLU 75 75 75 GLU GLU D . n D 1 76 GLY 76 76 76 GLY GLY D . n D 1 77 ASP 77 77 77 ASP ASP D . n D 1 78 GLU 78 78 78 GLU GLU D . n D 1 79 ILE 79 79 79 ILE ILE D . n D 1 80 THR 80 80 80 THR THR D . n D 1 81 GLU 81 81 81 GLU GLU D . n D 1 82 TYR 82 82 82 TYR TYR D . n D 1 83 LEU 83 83 83 LEU LEU D . n D 1 84 ASN 84 84 84 ASN ASN D . n D 1 85 GLU 85 85 85 GLU GLU D . n D 1 86 VAL 86 86 86 VAL VAL D . n D 1 87 ILE 87 87 ? ? ? D . n D 1 88 HIS 88 88 ? ? ? D . n D 1 89 LEU 89 89 ? ? ? D . n D 1 90 GLU 90 90 ? ? ? D . n D 1 91 HIS 91 91 ? ? ? D . n D 1 92 HIS 92 92 ? ? ? D . n D 1 93 HIS 93 93 ? ? ? D . n D 1 94 HIS 94 94 ? ? ? D . n D 1 95 HIS 95 95 ? ? ? D . n D 1 96 HIS 96 96 ? ? ? D . n E 1 1 MSE 1 1 1 MSE MSE E . n E 1 2 ILE 2 2 2 ILE ILE E . n E 1 3 ASP 3 3 3 ASP ASP E . n E 1 4 MSE 4 4 4 MSE MSE E . n E 1 5 TYR 5 5 5 TYR TYR E . n E 1 6 LEU 6 6 6 LEU LEU E . n E 1 7 TYR 7 7 7 TYR TYR E . n E 1 8 ASP 8 8 8 ASP ASP E . n E 1 9 ASP 9 9 9 ASP ASP E . n E 1 10 ASN 10 10 10 ASN ASN E . n E 1 11 GLU 11 11 11 GLU GLU E . n E 1 12 GLU 12 12 12 GLU GLU E . n E 1 13 SER 13 13 13 SER SER E . n E 1 14 GLN 14 14 14 GLN GLN E . n E 1 15 VAL 15 15 15 VAL VAL E . n E 1 16 GLN 16 16 16 GLN GLN E . n E 1 17 PHE 17 17 17 PHE PHE E . n E 1 18 VAL 18 18 18 VAL VAL E . n E 1 19 GLY 19 19 19 GLY GLY E . n E 1 20 PHE 20 20 20 PHE PHE E . n E 1 21 VAL 21 21 21 VAL VAL E . n E 1 22 GLY 22 22 22 GLY GLY E . n E 1 23 GLU 23 23 23 GLU GLU E . n E 1 24 HIS 24 24 24 HIS HIS E . n E 1 25 SER 25 25 25 SER SER E . n E 1 26 ARG 26 26 26 ARG ARG E . n E 1 27 TYR 27 27 27 TYR TYR E . n E 1 28 ASP 28 28 28 ASP ASP E . n E 1 29 LEU 29 29 29 LEU LEU E . n E 1 30 MSE 30 30 30 MSE MSE E . n E 1 31 LEU 31 31 31 LEU LEU E . n E 1 32 VAL 32 32 32 VAL VAL E . n E 1 33 HIS 33 33 33 HIS HIS E . n E 1 34 THR 34 34 34 THR THR E . n E 1 35 ASN 35 35 35 ASN ASN E . n E 1 36 ARG 36 36 36 ARG ARG E . n E 1 37 HIS 37 37 37 HIS HIS E . n E 1 38 TYR 38 38 38 TYR TYR E . n E 1 39 GLY 39 39 39 GLY GLY E . n E 1 40 LYS 40 40 40 LYS LYS E . n E 1 41 THR 41 41 41 THR THR E . n E 1 42 LEU 42 42 42 LEU LEU E . n E 1 43 VAL 43 43 43 VAL VAL E . n E 1 44 LEU 44 44 44 LEU LEU E . n E 1 45 ASN 45 45 45 ASN ASN E . n E 1 46 MSE 46 46 46 MSE MSE E . n E 1 47 GLN 47 47 47 GLN GLN E . n E 1 48 THR 48 48 48 THR THR E . n E 1 49 ASN 49 49 49 ASN ASN E . n E 1 50 LYS 50 50 50 LYS LYS E . n E 1 51 PHE 51 51 51 PHE PHE E . n E 1 52 GLY 52 52 52 GLY GLY E . n E 1 53 ILE 53 53 53 ILE ILE E . n E 1 54 ILE 54 54 54 ILE ILE E . n E 1 55 GLY 55 55 55 GLY GLY E . n E 1 56 THR 56 56 56 THR THR E . n E 1 57 ASP 57 57 57 ASP ASP E . n E 1 58 ASP 58 58 58 ASP ASP E . n E 1 59 LEU 59 59 59 LEU LEU E . n E 1 60 LYS 60 60 60 LYS LYS E . n E 1 61 GLU 61 61 61 GLU GLU E . n E 1 62 GLU 62 62 62 GLU GLU E . n E 1 63 GLY 63 63 63 GLY GLY E . n E 1 64 TYR 64 64 64 TYR TYR E . n E 1 65 ILE 65 65 65 ILE ILE E . n E 1 66 ALA 66 66 66 ALA ALA E . n E 1 67 HIS 67 67 67 HIS HIS E . n E 1 68 ILE 68 68 68 ILE ILE E . n E 1 69 LEU 69 69 69 LEU LEU E . n E 1 70 GLY 70 70 70 GLY GLY E . n E 1 71 VAL 71 71 71 VAL VAL E . n E 1 72 ASN 72 72 72 ASN ASN E . n E 1 73 ALA 73 73 73 ALA ALA E . n E 1 74 GLU 74 74 74 GLU GLU E . n E 1 75 GLU 75 75 75 GLU GLU E . n E 1 76 GLY 76 76 76 GLY GLY E . n E 1 77 ASP 77 77 77 ASP ASP E . n E 1 78 GLU 78 78 78 GLU GLU E . n E 1 79 ILE 79 79 79 ILE ILE E . n E 1 80 THR 80 80 80 THR THR E . n E 1 81 GLU 81 81 81 GLU GLU E . n E 1 82 TYR 82 82 82 TYR TYR E . n E 1 83 LEU 83 83 83 LEU LEU E . n E 1 84 ASN 84 84 84 ASN ASN E . n E 1 85 GLU 85 85 85 GLU GLU E . n E 1 86 VAL 86 86 86 VAL VAL E . n E 1 87 ILE 87 87 87 ILE ILE E . n E 1 88 HIS 88 88 88 HIS HIS E . n E 1 89 LEU 89 89 ? ? ? E . n E 1 90 GLU 90 90 ? ? ? E . n E 1 91 HIS 91 91 ? ? ? E . n E 1 92 HIS 92 92 ? ? ? E . n E 1 93 HIS 93 93 ? ? ? E . n E 1 94 HIS 94 94 ? ? ? E . n E 1 95 HIS 95 95 ? ? ? E . n E 1 96 HIS 96 96 ? ? ? E . n F 1 1 MSE 1 1 1 MSE MSE F . n F 1 2 ILE 2 2 2 ILE ILE F . n F 1 3 ASP 3 3 3 ASP ASP F . n F 1 4 MSE 4 4 4 MSE MSE F . n F 1 5 TYR 5 5 5 TYR TYR F . n F 1 6 LEU 6 6 6 LEU LEU F . n F 1 7 TYR 7 7 7 TYR TYR F . n F 1 8 ASP 8 8 8 ASP ASP F . n F 1 9 ASP 9 9 9 ASP ASP F . n F 1 10 ASN 10 10 10 ASN ASN F . n F 1 11 GLU 11 11 11 GLU GLU F . n F 1 12 GLU 12 12 12 GLU GLU F . n F 1 13 SER 13 13 13 SER SER F . n F 1 14 GLN 14 14 14 GLN GLN F . n F 1 15 VAL 15 15 15 VAL VAL F . n F 1 16 GLN 16 16 16 GLN GLN F . n F 1 17 PHE 17 17 17 PHE PHE F . n F 1 18 VAL 18 18 18 VAL VAL F . n F 1 19 GLY 19 19 19 GLY GLY F . n F 1 20 PHE 20 20 20 PHE PHE F . n F 1 21 VAL 21 21 21 VAL VAL F . n F 1 22 GLY 22 22 22 GLY GLY F . n F 1 23 GLU 23 23 23 GLU GLU F . n F 1 24 HIS 24 24 24 HIS HIS F . n F 1 25 SER 25 25 25 SER SER F . n F 1 26 ARG 26 26 26 ARG ARG F . n F 1 27 TYR 27 27 27 TYR TYR F . n F 1 28 ASP 28 28 28 ASP ASP F . n F 1 29 LEU 29 29 29 LEU LEU F . n F 1 30 MSE 30 30 30 MSE MSE F . n F 1 31 LEU 31 31 31 LEU LEU F . n F 1 32 VAL 32 32 32 VAL VAL F . n F 1 33 HIS 33 33 33 HIS HIS F . n F 1 34 THR 34 34 34 THR THR F . n F 1 35 ASN 35 35 35 ASN ASN F . n F 1 36 ARG 36 36 36 ARG ARG F . n F 1 37 HIS 37 37 37 HIS HIS F . n F 1 38 TYR 38 38 38 TYR TYR F . n F 1 39 GLY 39 39 39 GLY GLY F . n F 1 40 LYS 40 40 40 LYS LYS F . n F 1 41 THR 41 41 41 THR THR F . n F 1 42 LEU 42 42 42 LEU LEU F . n F 1 43 VAL 43 43 43 VAL VAL F . n F 1 44 LEU 44 44 44 LEU LEU F . n F 1 45 ASN 45 45 45 ASN ASN F . n F 1 46 MSE 46 46 46 MSE MSE F . n F 1 47 GLN 47 47 47 GLN GLN F . n F 1 48 THR 48 48 48 THR THR F . n F 1 49 ASN 49 49 49 ASN ASN F . n F 1 50 LYS 50 50 50 LYS LYS F . n F 1 51 PHE 51 51 51 PHE PHE F . n F 1 52 GLY 52 52 52 GLY GLY F . n F 1 53 ILE 53 53 53 ILE ILE F . n F 1 54 ILE 54 54 54 ILE ILE F . n F 1 55 GLY 55 55 55 GLY GLY F . n F 1 56 THR 56 56 56 THR THR F . n F 1 57 ASP 57 57 57 ASP ASP F . n F 1 58 ASP 58 58 58 ASP ASP F . n F 1 59 LEU 59 59 59 LEU LEU F . n F 1 60 LYS 60 60 60 LYS LYS F . n F 1 61 GLU 61 61 61 GLU GLU F . n F 1 62 GLU 62 62 62 GLU GLU F . n F 1 63 GLY 63 63 63 GLY GLY F . n F 1 64 TYR 64 64 64 TYR TYR F . n F 1 65 ILE 65 65 65 ILE ILE F . n F 1 66 ALA 66 66 66 ALA ALA F . n F 1 67 HIS 67 67 67 HIS HIS F . n F 1 68 ILE 68 68 68 ILE ILE F . n F 1 69 LEU 69 69 69 LEU LEU F . n F 1 70 GLY 70 70 70 GLY GLY F . n F 1 71 VAL 71 71 71 VAL VAL F . n F 1 72 ASN 72 72 72 ASN ASN F . n F 1 73 ALA 73 73 73 ALA ALA F . n F 1 74 GLU 74 74 74 GLU GLU F . n F 1 75 GLU 75 75 75 GLU GLU F . n F 1 76 GLY 76 76 76 GLY GLY F . n F 1 77 ASP 77 77 77 ASP ASP F . n F 1 78 GLU 78 78 78 GLU GLU F . n F 1 79 ILE 79 79 79 ILE ILE F . n F 1 80 THR 80 80 80 THR THR F . n F 1 81 GLU 81 81 81 GLU GLU F . n F 1 82 TYR 82 82 82 TYR TYR F . n F 1 83 LEU 83 83 83 LEU LEU F . n F 1 84 ASN 84 84 84 ASN ASN F . n F 1 85 GLU 85 85 85 GLU GLU F . n F 1 86 VAL 86 86 86 VAL VAL F . n F 1 87 ILE 87 87 87 ILE ILE F . n F 1 88 HIS 88 88 88 HIS HIS F . n F 1 89 LEU 89 89 ? ? ? F . n F 1 90 GLU 90 90 ? ? ? F . n F 1 91 HIS 91 91 ? ? ? F . n F 1 92 HIS 92 92 ? ? ? F . n F 1 93 HIS 93 93 ? ? ? F . n F 1 94 HIS 94 94 ? ? ? F . n F 1 95 HIS 95 95 ? ? ? F . n F 1 96 HIS 96 96 ? ? ? F . n G 1 1 MSE 1 1 ? ? ? G . n G 1 2 ILE 2 2 2 ILE ILE G . n G 1 3 ASP 3 3 3 ASP ASP G . n G 1 4 MSE 4 4 4 MSE MSE G . n G 1 5 TYR 5 5 5 TYR TYR G . n G 1 6 LEU 6 6 6 LEU LEU G . n G 1 7 TYR 7 7 7 TYR TYR G . n G 1 8 ASP 8 8 8 ASP ASP G . n G 1 9 ASP 9 9 9 ASP ASP G . n G 1 10 ASN 10 10 10 ASN ASN G . n G 1 11 GLU 11 11 11 GLU GLU G . n G 1 12 GLU 12 12 12 GLU GLU G . n G 1 13 SER 13 13 13 SER SER G . n G 1 14 GLN 14 14 14 GLN GLN G . n G 1 15 VAL 15 15 15 VAL VAL G . n G 1 16 GLN 16 16 16 GLN GLN G . n G 1 17 PHE 17 17 17 PHE PHE G . n G 1 18 VAL 18 18 18 VAL VAL G . n G 1 19 GLY 19 19 19 GLY GLY G . n G 1 20 PHE 20 20 20 PHE PHE G . n G 1 21 VAL 21 21 21 VAL VAL G . n G 1 22 GLY 22 22 22 GLY GLY G . n G 1 23 GLU 23 23 23 GLU GLU G . n G 1 24 HIS 24 24 24 HIS HIS G . n G 1 25 SER 25 25 25 SER SER G . n G 1 26 ARG 26 26 26 ARG ARG G . n G 1 27 TYR 27 27 27 TYR TYR G . n G 1 28 ASP 28 28 28 ASP ASP G . n G 1 29 LEU 29 29 29 LEU LEU G . n G 1 30 MSE 30 30 30 MSE MSE G . n G 1 31 LEU 31 31 31 LEU LEU G . n G 1 32 VAL 32 32 32 VAL VAL G . n G 1 33 HIS 33 33 33 HIS HIS G . n G 1 34 THR 34 34 34 THR THR G . n G 1 35 ASN 35 35 35 ASN ASN G . n G 1 36 ARG 36 36 36 ARG ARG G . n G 1 37 HIS 37 37 37 HIS HIS G . n G 1 38 TYR 38 38 38 TYR TYR G . n G 1 39 GLY 39 39 39 GLY GLY G . n G 1 40 LYS 40 40 40 LYS LYS G . n G 1 41 THR 41 41 41 THR THR G . n G 1 42 LEU 42 42 42 LEU LEU G . n G 1 43 VAL 43 43 43 VAL VAL G . n G 1 44 LEU 44 44 44 LEU LEU G . n G 1 45 ASN 45 45 45 ASN ASN G . n G 1 46 MSE 46 46 46 MSE MSE G . n G 1 47 GLN 47 47 47 GLN GLN G . n G 1 48 THR 48 48 48 THR THR G . n G 1 49 ASN 49 49 49 ASN ASN G . n G 1 50 LYS 50 50 50 LYS LYS G . n G 1 51 PHE 51 51 51 PHE PHE G . n G 1 52 GLY 52 52 52 GLY GLY G . n G 1 53 ILE 53 53 53 ILE ILE G . n G 1 54 ILE 54 54 54 ILE ILE G . n G 1 55 GLY 55 55 55 GLY GLY G . n G 1 56 THR 56 56 56 THR THR G . n G 1 57 ASP 57 57 57 ASP ASP G . n G 1 58 ASP 58 58 58 ASP ASP G . n G 1 59 LEU 59 59 59 LEU LEU G . n G 1 60 LYS 60 60 60 LYS LYS G . n G 1 61 GLU 61 61 61 GLU GLU G . n G 1 62 GLU 62 62 62 GLU GLU G . n G 1 63 GLY 63 63 63 GLY GLY G . n G 1 64 TYR 64 64 64 TYR TYR G . n G 1 65 ILE 65 65 65 ILE ILE G . n G 1 66 ALA 66 66 66 ALA ALA G . n G 1 67 HIS 67 67 67 HIS HIS G . n G 1 68 ILE 68 68 68 ILE ILE G . n G 1 69 LEU 69 69 69 LEU LEU G . n G 1 70 GLY 70 70 70 GLY GLY G . n G 1 71 VAL 71 71 71 VAL VAL G . n G 1 72 ASN 72 72 72 ASN ASN G . n G 1 73 ALA 73 73 73 ALA ALA G . n G 1 74 GLU 74 74 74 GLU GLU G . n G 1 75 GLU 75 75 75 GLU GLU G . n G 1 76 GLY 76 76 76 GLY GLY G . n G 1 77 ASP 77 77 77 ASP ASP G . n G 1 78 GLU 78 78 78 GLU GLU G . n G 1 79 ILE 79 79 79 ILE ILE G . n G 1 80 THR 80 80 80 THR THR G . n G 1 81 GLU 81 81 81 GLU GLU G . n G 1 82 TYR 82 82 82 TYR TYR G . n G 1 83 LEU 83 83 83 LEU LEU G . n G 1 84 ASN 84 84 84 ASN ASN G . n G 1 85 GLU 85 85 85 GLU GLU G . n G 1 86 VAL 86 86 86 VAL VAL G . n G 1 87 ILE 87 87 87 ILE ILE G . n G 1 88 HIS 88 88 ? ? ? G . n G 1 89 LEU 89 89 ? ? ? G . n G 1 90 GLU 90 90 ? ? ? G . n G 1 91 HIS 91 91 ? ? ? G . n G 1 92 HIS 92 92 ? ? ? G . n G 1 93 HIS 93 93 ? ? ? G . n G 1 94 HIS 94 94 ? ? ? G . n G 1 95 HIS 95 95 ? ? ? G . n G 1 96 HIS 96 96 ? ? ? G . n H 1 1 MSE 1 1 1 MSE MSE H . n H 1 2 ILE 2 2 2 ILE ILE H . n H 1 3 ASP 3 3 3 ASP ASP H . n H 1 4 MSE 4 4 4 MSE MSE H . n H 1 5 TYR 5 5 5 TYR TYR H . n H 1 6 LEU 6 6 6 LEU LEU H . n H 1 7 TYR 7 7 7 TYR TYR H . n H 1 8 ASP 8 8 8 ASP ASP H . n H 1 9 ASP 9 9 9 ASP ASP H . n H 1 10 ASN 10 10 10 ASN ASN H . n H 1 11 GLU 11 11 11 GLU GLU H . n H 1 12 GLU 12 12 12 GLU GLU H . n H 1 13 SER 13 13 13 SER SER H . n H 1 14 GLN 14 14 14 GLN GLN H . n H 1 15 VAL 15 15 15 VAL VAL H . n H 1 16 GLN 16 16 16 GLN GLN H . n H 1 17 PHE 17 17 17 PHE PHE H . n H 1 18 VAL 18 18 18 VAL VAL H . n H 1 19 GLY 19 19 19 GLY GLY H . n H 1 20 PHE 20 20 20 PHE PHE H . n H 1 21 VAL 21 21 21 VAL VAL H . n H 1 22 GLY 22 22 22 GLY GLY H . n H 1 23 GLU 23 23 23 GLU GLU H . n H 1 24 HIS 24 24 24 HIS HIS H . n H 1 25 SER 25 25 25 SER SER H . n H 1 26 ARG 26 26 26 ARG ARG H . n H 1 27 TYR 27 27 27 TYR TYR H . n H 1 28 ASP 28 28 28 ASP ASP H . n H 1 29 LEU 29 29 29 LEU LEU H . n H 1 30 MSE 30 30 30 MSE MSE H . n H 1 31 LEU 31 31 31 LEU LEU H . n H 1 32 VAL 32 32 32 VAL VAL H . n H 1 33 HIS 33 33 33 HIS HIS H . n H 1 34 THR 34 34 34 THR THR H . n H 1 35 ASN 35 35 35 ASN ASN H . n H 1 36 ARG 36 36 36 ARG ARG H . n H 1 37 HIS 37 37 37 HIS HIS H . n H 1 38 TYR 38 38 38 TYR TYR H . n H 1 39 GLY 39 39 39 GLY GLY H . n H 1 40 LYS 40 40 40 LYS LYS H . n H 1 41 THR 41 41 41 THR THR H . n H 1 42 LEU 42 42 42 LEU LEU H . n H 1 43 VAL 43 43 43 VAL VAL H . n H 1 44 LEU 44 44 44 LEU LEU H . n H 1 45 ASN 45 45 45 ASN ASN H . n H 1 46 MSE 46 46 46 MSE MSE H . n H 1 47 GLN 47 47 47 GLN GLN H . n H 1 48 THR 48 48 48 THR THR H . n H 1 49 ASN 49 49 49 ASN ASN H . n H 1 50 LYS 50 50 50 LYS LYS H . n H 1 51 PHE 51 51 51 PHE PHE H . n H 1 52 GLY 52 52 52 GLY GLY H . n H 1 53 ILE 53 53 53 ILE ILE H . n H 1 54 ILE 54 54 54 ILE ILE H . n H 1 55 GLY 55 55 55 GLY GLY H . n H 1 56 THR 56 56 56 THR THR H . n H 1 57 ASP 57 57 57 ASP ASP H . n H 1 58 ASP 58 58 58 ASP ASP H . n H 1 59 LEU 59 59 59 LEU LEU H . n H 1 60 LYS 60 60 60 LYS LYS H . n H 1 61 GLU 61 61 61 GLU GLU H . n H 1 62 GLU 62 62 62 GLU GLU H . n H 1 63 GLY 63 63 63 GLY GLY H . n H 1 64 TYR 64 64 64 TYR TYR H . n H 1 65 ILE 65 65 65 ILE ILE H . n H 1 66 ALA 66 66 66 ALA ALA H . n H 1 67 HIS 67 67 67 HIS HIS H . n H 1 68 ILE 68 68 68 ILE ILE H . n H 1 69 LEU 69 69 69 LEU LEU H . n H 1 70 GLY 70 70 70 GLY GLY H . n H 1 71 VAL 71 71 71 VAL VAL H . n H 1 72 ASN 72 72 72 ASN ASN H . n H 1 73 ALA 73 73 73 ALA ALA H . n H 1 74 GLU 74 74 74 GLU GLU H . n H 1 75 GLU 75 75 75 GLU GLU H . n H 1 76 GLY 76 76 76 GLY GLY H . n H 1 77 ASP 77 77 77 ASP ASP H . n H 1 78 GLU 78 78 78 GLU GLU H . n H 1 79 ILE 79 79 79 ILE ILE H . n H 1 80 THR 80 80 80 THR THR H . n H 1 81 GLU 81 81 81 GLU GLU H . n H 1 82 TYR 82 82 82 TYR TYR H . n H 1 83 LEU 83 83 83 LEU LEU H . n H 1 84 ASN 84 84 84 ASN ASN H . n H 1 85 GLU 85 85 85 GLU GLU H . n H 1 86 VAL 86 86 86 VAL VAL H . n H 1 87 ILE 87 87 87 ILE ILE H . n H 1 88 HIS 88 88 ? ? ? H . n H 1 89 LEU 89 89 ? ? ? H . n H 1 90 GLU 90 90 ? ? ? H . n H 1 91 HIS 91 91 ? ? ? H . n H 1 92 HIS 92 92 ? ? ? H . n H 1 93 HIS 93 93 ? ? ? H . n H 1 94 HIS 94 94 ? ? ? H . n H 1 95 HIS 95 95 ? ? ? H . n H 1 96 HIS 96 96 ? ? ? H . n I 1 1 MSE 1 1 ? ? ? I . n I 1 2 ILE 2 2 ? ? ? I . n I 1 3 ASP 3 3 ? ? ? I . n I 1 4 MSE 4 4 ? ? ? I . n I 1 5 TYR 5 5 ? ? ? I . n I 1 6 LEU 6 6 6 LEU LEU I . n I 1 7 TYR 7 7 7 TYR TYR I . n I 1 8 ASP 8 8 8 ASP ASP I . n I 1 9 ASP 9 9 9 ASP ASP I . n I 1 10 ASN 10 10 10 ASN ASN I . n I 1 11 GLU 11 11 11 GLU GLU I . n I 1 12 GLU 12 12 12 GLU GLU I . n I 1 13 SER 13 13 13 SER SER I . n I 1 14 GLN 14 14 ? ? ? I . n I 1 15 VAL 15 15 15 VAL VAL I . n I 1 16 GLN 16 16 16 GLN GLN I . n I 1 17 PHE 17 17 17 PHE PHE I . n I 1 18 VAL 18 18 18 VAL VAL I . n I 1 19 GLY 19 19 19 GLY GLY I . n I 1 20 PHE 20 20 ? ? ? I . n I 1 21 VAL 21 21 ? ? ? I . n I 1 22 GLY 22 22 ? ? ? I . n I 1 23 GLU 23 23 ? ? ? I . n I 1 24 HIS 24 24 ? ? ? I . n I 1 25 SER 25 25 ? ? ? I . n I 1 26 ARG 26 26 ? ? ? I . n I 1 27 TYR 27 27 27 TYR TYR I . n I 1 28 ASP 28 28 28 ASP ASP I . n I 1 29 LEU 29 29 29 LEU LEU I . n I 1 30 MSE 30 30 30 MSE MSE I . n I 1 31 LEU 31 31 31 LEU LEU I . n I 1 32 VAL 32 32 32 VAL VAL I . n I 1 33 HIS 33 33 33 HIS HIS I . n I 1 34 THR 34 34 34 THR THR I . n I 1 35 ASN 35 35 35 ASN ASN I . n I 1 36 ARG 36 36 36 ARG ARG I . n I 1 37 HIS 37 37 37 HIS HIS I . n I 1 38 TYR 38 38 38 TYR TYR I . n I 1 39 GLY 39 39 39 GLY GLY I . n I 1 40 LYS 40 40 40 LYS LYS I . n I 1 41 THR 41 41 41 THR THR I . n I 1 42 LEU 42 42 42 LEU LEU I . n I 1 43 VAL 43 43 43 VAL VAL I . n I 1 44 LEU 44 44 44 LEU LEU I . n I 1 45 ASN 45 45 ? ? ? I . n I 1 46 MSE 46 46 ? ? ? I . n I 1 47 GLN 47 47 ? ? ? I . n I 1 48 THR 48 48 ? ? ? I . n I 1 49 ASN 49 49 ? ? ? I . n I 1 50 LYS 50 50 ? ? ? I . n I 1 51 PHE 51 51 51 PHE PHE I . n I 1 52 GLY 52 52 52 GLY GLY I . n I 1 53 ILE 53 53 53 ILE ILE I . n I 1 54 ILE 54 54 54 ILE ILE I . n I 1 55 GLY 55 55 ? ? ? I . n I 1 56 THR 56 56 ? ? ? I . n I 1 57 ASP 57 57 ? ? ? I . n I 1 58 ASP 58 58 ? ? ? I . n I 1 59 LEU 59 59 ? ? ? I . n I 1 60 LYS 60 60 ? ? ? I . n I 1 61 GLU 61 61 ? ? ? I . n I 1 62 GLU 62 62 ? ? ? I . n I 1 63 GLY 63 63 ? ? ? I . n I 1 64 TYR 64 64 ? ? ? I . n I 1 65 ILE 65 65 ? ? ? I . n I 1 66 ALA 66 66 ? ? ? I . n I 1 67 HIS 67 67 ? ? ? I . n I 1 68 ILE 68 68 ? ? ? I . n I 1 69 LEU 69 69 ? ? ? I . n I 1 70 GLY 70 70 ? ? ? I . n I 1 71 VAL 71 71 ? ? ? I . n I 1 72 ASN 72 72 ? ? ? I . n I 1 73 ALA 73 73 ? ? ? I . n I 1 74 GLU 74 74 ? ? ? I . n I 1 75 GLU 75 75 ? ? ? I . n I 1 76 GLY 76 76 ? ? ? I . n I 1 77 ASP 77 77 ? ? ? I . n I 1 78 GLU 78 78 ? ? ? I . n I 1 79 ILE 79 79 ? ? ? I . n I 1 80 THR 80 80 ? ? ? I . n I 1 81 GLU 81 81 ? ? ? I . n I 1 82 TYR 82 82 ? ? ? I . n I 1 83 LEU 83 83 ? ? ? I . n I 1 84 ASN 84 84 ? ? ? I . n I 1 85 GLU 85 85 ? ? ? I . n I 1 86 VAL 86 86 ? ? ? I . n I 1 87 ILE 87 87 ? ? ? I . n I 1 88 HIS 88 88 ? ? ? I . n I 1 89 LEU 89 89 ? ? ? I . n I 1 90 GLU 90 90 ? ? ? I . n I 1 91 HIS 91 91 ? ? ? I . n I 1 92 HIS 92 92 ? ? ? I . n I 1 93 HIS 93 93 ? ? ? I . n I 1 94 HIS 94 94 ? ? ? I . n I 1 95 HIS 95 95 ? ? ? I . n I 1 96 HIS 96 96 ? ? ? I . n J 1 1 MSE 1 1 ? ? ? J . n J 1 2 ILE 2 2 ? ? ? J . n J 1 3 ASP 3 3 ? ? ? J . n J 1 4 MSE 4 4 ? ? ? J . n J 1 5 TYR 5 5 ? ? ? J . n J 1 6 LEU 6 6 ? ? ? J . n J 1 7 TYR 7 7 ? ? ? J . n J 1 8 ASP 8 8 ? ? ? J . n J 1 9 ASP 9 9 ? ? ? J . n J 1 10 ASN 10 10 ? ? ? J . n J 1 11 GLU 11 11 11 GLU GLU J . n J 1 12 GLU 12 12 12 GLU GLU J . n J 1 13 SER 13 13 13 SER SER J . n J 1 14 GLN 14 14 14 GLN GLN J . n J 1 15 VAL 15 15 15 VAL VAL J . n J 1 16 GLN 16 16 16 GLN GLN J . n J 1 17 PHE 17 17 17 PHE PHE J . n J 1 18 VAL 18 18 18 VAL VAL J . n J 1 19 GLY 19 19 19 GLY GLY J . n J 1 20 PHE 20 20 20 PHE PHE J . n J 1 21 VAL 21 21 ? ? ? J . n J 1 22 GLY 22 22 ? ? ? J . n J 1 23 GLU 23 23 ? ? ? J . n J 1 24 HIS 24 24 ? ? ? J . n J 1 25 SER 25 25 ? ? ? J . n J 1 26 ARG 26 26 ? ? ? J . n J 1 27 TYR 27 27 27 TYR TYR J . n J 1 28 ASP 28 28 28 ASP ASP J . n J 1 29 LEU 29 29 29 LEU LEU J . n J 1 30 MSE 30 30 30 MSE MSE J . n J 1 31 LEU 31 31 31 LEU LEU J . n J 1 32 VAL 32 32 32 VAL VAL J . n J 1 33 HIS 33 33 33 HIS HIS J . n J 1 34 THR 34 34 34 THR THR J . n J 1 35 ASN 35 35 35 ASN ASN J . n J 1 36 ARG 36 36 36 ARG ARG J . n J 1 37 HIS 37 37 37 HIS HIS J . n J 1 38 TYR 38 38 38 TYR TYR J . n J 1 39 GLY 39 39 39 GLY GLY J . n J 1 40 LYS 40 40 40 LYS LYS J . n J 1 41 THR 41 41 41 THR THR J . n J 1 42 LEU 42 42 42 LEU LEU J . n J 1 43 VAL 43 43 43 VAL VAL J . n J 1 44 LEU 44 44 44 LEU LEU J . n J 1 45 ASN 45 45 45 ASN ASN J . n J 1 46 MSE 46 46 46 MSE MSE J . n J 1 47 GLN 47 47 47 GLN GLN J . n J 1 48 THR 48 48 48 THR THR J . n J 1 49 ASN 49 49 ? ? ? J . n J 1 50 LYS 50 50 ? ? ? J . n J 1 51 PHE 51 51 ? ? ? J . n J 1 52 GLY 52 52 ? ? ? J . n J 1 53 ILE 53 53 ? ? ? J . n J 1 54 ILE 54 54 ? ? ? J . n J 1 55 GLY 55 55 ? ? ? J . n J 1 56 THR 56 56 ? ? ? J . n J 1 57 ASP 57 57 ? ? ? J . n J 1 58 ASP 58 58 ? ? ? J . n J 1 59 LEU 59 59 ? ? ? J . n J 1 60 LYS 60 60 ? ? ? J . n J 1 61 GLU 61 61 ? ? ? J . n J 1 62 GLU 62 62 ? ? ? J . n J 1 63 GLY 63 63 ? ? ? J . n J 1 64 TYR 64 64 ? ? ? J . n J 1 65 ILE 65 65 ? ? ? J . n J 1 66 ALA 66 66 ? ? ? J . n J 1 67 HIS 67 67 ? ? ? J . n J 1 68 ILE 68 68 ? ? ? J . n J 1 69 LEU 69 69 ? ? ? J . n J 1 70 GLY 70 70 ? ? ? J . n J 1 71 VAL 71 71 ? ? ? J . n J 1 72 ASN 72 72 ? ? ? J . n J 1 73 ALA 73 73 ? ? ? J . n J 1 74 GLU 74 74 ? ? ? J . n J 1 75 GLU 75 75 ? ? ? J . n J 1 76 GLY 76 76 ? ? ? J . n J 1 77 ASP 77 77 ? ? ? J . n J 1 78 GLU 78 78 ? ? ? J . n J 1 79 ILE 79 79 ? ? ? J . n J 1 80 THR 80 80 ? ? ? J . n J 1 81 GLU 81 81 ? ? ? J . n J 1 82 TYR 82 82 ? ? ? J . n J 1 83 LEU 83 83 ? ? ? J . n J 1 84 ASN 84 84 ? ? ? J . n J 1 85 GLU 85 85 ? ? ? J . n J 1 86 VAL 86 86 ? ? ? J . n J 1 87 ILE 87 87 ? ? ? J . n J 1 88 HIS 88 88 ? ? ? J . n J 1 89 LEU 89 89 ? ? ? J . n J 1 90 GLU 90 90 ? ? ? J . n J 1 91 HIS 91 91 ? ? ? J . n J 1 92 HIS 92 92 ? ? ? J . n J 1 93 HIS 93 93 ? ? ? J . n J 1 94 HIS 94 94 ? ? ? J . n J 1 95 HIS 95 95 ? ? ? J . n J 1 96 HIS 96 96 ? ? ? J . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code K 2 CL 1 101 89 CL CL E . L 3 HOH 1 101 89 HOH HOH C . L 3 HOH 2 102 90 HOH HOH C . L 3 HOH 3 103 88 HOH HOH C . M 3 HOH 1 101 87 HOH HOH D . N 3 HOH 1 201 93 HOH HOH E . N 3 HOH 2 202 90 HOH HOH E . N 3 HOH 3 203 94 HOH HOH E . N 3 HOH 4 204 91 HOH HOH E . N 3 HOH 5 205 92 HOH HOH E . O 3 HOH 1 101 89 HOH HOH F . P 3 HOH 1 101 88 HOH HOH H . P 3 HOH 2 102 89 HOH HOH H . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 30 A MSE 30 ? MET 'modified residue' 2 A MSE 46 A MSE 46 ? MET 'modified residue' 3 B MSE 4 B MSE 4 ? MET 'modified residue' 4 B MSE 30 B MSE 30 ? MET 'modified residue' 5 B MSE 46 B MSE 46 ? MET 'modified residue' 6 C MSE 4 C MSE 4 ? MET 'modified residue' 7 C MSE 30 C MSE 30 ? MET 'modified residue' 8 C MSE 46 C MSE 46 ? MET 'modified residue' 9 D MSE 1 D MSE 1 ? MET 'modified residue' 10 D MSE 4 D MSE 4 ? MET 'modified residue' 11 D MSE 30 D MSE 30 ? MET 'modified residue' 12 D MSE 46 D MSE 46 ? MET 'modified residue' 13 E MSE 1 E MSE 1 ? MET 'modified residue' 14 E MSE 4 E MSE 4 ? MET 'modified residue' 15 E MSE 30 E MSE 30 ? MET 'modified residue' 16 E MSE 46 E MSE 46 ? MET 'modified residue' 17 F MSE 1 F MSE 1 ? MET 'modified residue' 18 F MSE 4 F MSE 4 ? MET 'modified residue' 19 F MSE 30 F MSE 30 ? MET 'modified residue' 20 F MSE 46 F MSE 46 ? MET 'modified residue' 21 G MSE 4 G MSE 4 ? MET 'modified residue' 22 G MSE 30 G MSE 30 ? MET 'modified residue' 23 G MSE 46 G MSE 46 ? MET 'modified residue' 24 H MSE 1 H MSE 1 ? MET 'modified residue' 25 H MSE 4 H MSE 4 ? MET 'modified residue' 26 H MSE 30 H MSE 30 ? MET 'modified residue' 27 H MSE 46 H MSE 46 ? MET 'modified residue' 28 I MSE 30 I MSE 30 ? MET 'modified residue' 29 J MSE 30 J MSE 30 ? MET 'modified residue' 30 J MSE 46 J MSE 46 ? MET 'modified residue' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 author_and_software_defined_assembly PISA dimeric 2 4 author_and_software_defined_assembly PISA dimeric 2 5 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1 C,D,L,M 3 1 E,F,K,N,O 4 1 G,H,P 5 1 I,J # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2970 ? 1 MORE -18 ? 1 'SSA (A^2)' 8130 ? 2 'ABSA (A^2)' 3710 ? 2 MORE -27 ? 2 'SSA (A^2)' 9000 ? 3 'ABSA (A^2)' 3890 ? 3 MORE -22 ? 3 'SSA (A^2)' 9180 ? 4 'ABSA (A^2)' 3780 ? 4 MORE -23 ? 4 'SSA (A^2)' 8950 ? 5 'ABSA (A^2)' 1660 ? 5 MORE -11 ? 5 'SSA (A^2)' 5050 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-18 2 'Structure model' 1 1 2020-07-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 12.5012 36.2194 37.3163 0.3821 0.7513 0.8055 0.1508 0.2536 -0.0252 5.9372 4.8077 3.2989 -1.0916 0.7409 -1.5036 0.0384 -0.6981 1.5830 0.6006 0.7655 0.7702 -1.1014 -0.9764 -0.6275 'X-RAY DIFFRACTION' 2 ? refined 25.2633 17.0955 43.9154 0.3490 0.8005 0.4978 0.0376 0.1517 0.2988 6.4772 2.5354 2.9300 2.7122 -3.2937 -1.9455 -0.5343 0.4157 -0.4142 -0.1670 0.1231 -0.1119 0.4592 0.0639 0.4643 'X-RAY DIFFRACTION' 3 ? refined 17.9837 25.0538 40.1004 0.2387 0.6354 0.4639 0.0429 0.2530 -0.1269 3.1307 2.9789 1.7844 -2.4543 -0.3009 0.0920 0.2259 -0.1570 -0.0730 -0.0248 -0.2505 0.0886 -0.4413 -0.0910 -0.1851 'X-RAY DIFFRACTION' 4 ? refined 8.9511 27.2528 36.0742 0.2804 0.8752 0.8740 0.0766 0.2227 -0.0600 1.9665 1.0914 0.1887 -0.7194 0.6037 -0.1631 -0.0954 -0.0259 0.2887 0.1499 0.1224 0.5849 -0.2028 -0.9155 -0.1447 'X-RAY DIFFRACTION' 5 ? refined 17.1127 18.2629 32.5196 0.0630 0.6628 0.8676 0.0236 0.1869 -0.3239 0.2754 1.7479 0.2107 -0.3221 0.1412 -0.3861 -0.1050 -0.5589 -0.6272 -0.0311 -0.0291 0.0881 0.1210 0.3189 0.2775 'X-RAY DIFFRACTION' 6 ? refined 16.3242 12.9435 42.3107 0.5417 0.5408 1.1179 0.0086 0.3973 -0.0117 5.8017 4.3545 4.8117 -0.5542 -0.8646 0.6886 0.1206 -0.6852 -0.1444 0.2707 0.1714 -0.1572 0.1800 0.2665 -0.1519 'X-RAY DIFFRACTION' 7 ? refined 25.1753 15.5033 50.8402 0.6783 1.5401 0.6859 0.2285 0.0824 0.1836 2.1642 9.7063 6.9409 3.8420 -3.1510 -8.1995 0.0872 -2.5641 -0.9816 1.7925 -1.4208 -0.9186 -0.1263 1.4657 1.3130 'X-RAY DIFFRACTION' 8 ? refined 18.9154 33.5393 43.0625 0.5613 0.6457 0.6863 -0.1864 0.2354 -0.3451 9.0917 8.0840 4.4365 -5.1406 5.2837 -5.6064 -0.6851 -1.1447 0.9158 1.1046 0.0927 0.0978 -0.5371 -0.6488 0.4624 'X-RAY DIFFRACTION' 9 ? refined 11.5167 34.8200 21.6343 0.4781 0.7771 0.7255 -0.2349 -0.0908 -0.0013 2.9719 3.1383 3.3408 -2.4262 3.0728 -2.4475 0.0184 0.4614 0.9272 -0.7265 -0.1353 0.8999 0.6729 -1.4574 0.1329 'X-RAY DIFFRACTION' 10 ? refined 17.8897 35.7807 33.4044 0.3388 0.4195 1.0738 -0.0224 0.1311 -0.0340 2.8015 7.8981 4.4089 -1.5393 3.2206 0.3516 0.2399 -0.4801 1.1789 0.5790 -0.2915 0.8481 -0.1224 -0.8317 0.1875 'X-RAY DIFFRACTION' 11 ? refined 27.8285 35.5384 38.5022 0.3153 0.5153 0.7256 -0.0991 -0.0628 -0.3891 2.4261 4.5592 1.4688 2.8046 1.8180 1.7257 -0.1795 -0.0624 0.2182 0.1755 0.0991 -0.4959 -0.3322 0.2292 -0.1209 'X-RAY DIFFRACTION' 12 ? refined 19.4105 32.1707 28.8949 0.3156 0.3434 0.3655 -0.1129 0.0459 -0.1562 3.9333 3.4079 6.1279 3.1667 1.6128 1.8763 -0.0480 0.4590 0.1757 -0.3832 0.1686 -0.0352 -0.2474 0.0377 -0.0087 'X-RAY DIFFRACTION' 13 ? refined 18.3034 27.5926 26.6863 0.3146 0.5460 0.5146 -0.0999 0.1242 -0.2400 8.8649 9.5657 6.2336 1.8526 3.2531 1.2407 -0.1764 0.7808 -0.0690 -0.7892 0.2782 0.6584 0.1100 -0.4068 -0.0493 'X-RAY DIFFRACTION' 14 ? refined 31.2221 34.9158 24.7491 0.5410 1.0681 0.9126 -0.0128 0.2224 -0.1717 0.8133 2.5364 2.0995 0.6764 0.5122 2.2987 0.5125 0.0937 0.7695 -0.3005 -0.5951 -0.8387 -0.1578 0.4277 0.0528 'X-RAY DIFFRACTION' 15 ? refined 23.4257 28.0023 20.0802 0.6708 0.8791 0.3820 -0.0182 0.0312 -0.2245 5.6610 6.1603 0.9655 2.0740 1.8056 1.3057 0.6229 0.9239 0.0863 -0.9400 0.3058 -0.4557 0.2535 1.3631 -0.9313 'X-RAY DIFFRACTION' 16 ? refined 21.3422 39.6300 20.0108 0.9512 1.0033 0.4942 -0.1702 0.1059 0.0800 8.6149 9.4983 0.8261 1.5042 0.4822 -0.7315 0.3855 0.5375 0.5265 -1.4485 -0.4087 -0.5011 -1.3813 0.9470 -0.1141 'X-RAY DIFFRACTION' 17 ? refined 34.0831 36.1415 48.9254 0.1424 0.5701 0.4771 0.0198 0.0429 -0.2139 4.5458 3.2091 1.4681 -2.7957 0.0575 -0.5944 -0.1989 -0.7175 0.5468 0.3754 0.1953 0.6921 -0.3258 -0.5486 0.0037 'X-RAY DIFFRACTION' 18 ? refined 45.2553 24.9707 39.2579 0.1491 0.0209 -0.0328 -0.0637 -0.0584 -0.0277 1.8419 3.3067 3.3902 1.1196 0.9093 -0.2105 -0.0332 -0.2507 0.1876 0.3241 0.0460 0.3525 -0.2260 -0.2996 0.1118 'X-RAY DIFFRACTION' 19 ? refined 43.4251 27.4282 30.9997 0.0242 0.1730 0.1238 -0.1001 -0.0167 0.0051 4.4347 2.7478 3.7058 0.3659 -0.6915 -0.3329 -0.1784 0.4939 -0.2098 0.0290 -0.1389 0.2223 -0.0799 -0.3454 -0.0179 'X-RAY DIFFRACTION' 20 ? refined 47.8884 19.1177 32.3742 0.1543 0.0764 0.0394 -0.0887 -0.0163 -0.0654 5.8751 5.1470 4.5152 0.9986 -4.9838 -0.1846 -0.4145 0.0276 -0.3023 0.1734 -0.0036 -0.0586 0.3830 -0.1356 0.0868 'X-RAY DIFFRACTION' 21 ? refined 56.9311 14.1670 36.1741 0.3447 0.0354 0.2374 0.0940 0.0642 -0.0637 6.1285 1.9245 4.7545 1.3020 3.4489 -1.4202 0.2153 0.4882 -0.7128 -0.6564 0.0784 -0.8373 0.5111 0.3795 0.0187 'X-RAY DIFFRACTION' 22 ? refined 52.1214 20.8192 47.5994 0.1811 0.0180 0.0353 -0.0361 -0.0391 -0.1243 0.3910 1.7056 1.1267 -0.5297 -0.2562 0.6417 -0.0238 -0.1389 0.0622 0.2826 -0.1638 0.2658 0.0857 -0.2319 0.3809 'X-RAY DIFFRACTION' 23 ? refined 35.2604 39.7183 45.5629 0.2999 0.3487 0.4369 0.0644 -0.0488 -0.2351 3.3080 4.5572 0.3781 -2.0049 -0.9306 1.1850 -0.3829 -0.4113 0.3952 0.3957 0.0324 0.2973 -0.5485 -0.3634 0.0466 'X-RAY DIFFRACTION' 24 ? refined 46.9316 35.0372 50.4212 0.2973 0.1758 0.1487 0.0115 0.0084 -0.0936 5.4147 7.3490 5.1457 -2.3529 1.3774 -0.0175 -0.3827 -0.3024 -0.1182 1.0398 -0.0234 0.2019 -0.0813 0.0594 0.1025 'X-RAY DIFFRACTION' 25 ? refined 42.5781 38.6238 40.1251 0.3230 0.0568 0.1152 0.0429 -0.0746 -0.1214 3.1296 6.0902 5.3902 1.1759 1.3734 2.5104 -0.1561 -0.1521 0.4773 -0.4797 -0.1215 0.5949 -0.3790 -0.3403 0.6526 'X-RAY DIFFRACTION' 26 ? refined 51.4405 49.8364 45.4191 0.6984 0.3928 0.4856 -0.1605 -0.0411 -0.0240 5.4399 7.6676 5.5012 1.9359 -4.7303 -4.7954 0.0103 -0.4371 1.0445 0.2214 -0.1824 -0.0373 -0.8836 1.7334 0.1117 'X-RAY DIFFRACTION' 27 ? refined 42.4904 49.0681 41.1237 0.5572 0.2376 0.5917 0.0541 -0.2021 -0.2319 2.9222 4.0302 4.2408 -0.3281 -3.0170 -0.7513 0.2695 -0.3062 0.9868 -0.1458 -0.0543 0.7154 -0.9390 -0.2260 0.1225 'X-RAY DIFFRACTION' 28 ? refined 54.1583 30.6031 63.1071 0.1599 0.2817 0.2476 -0.1897 0.0034 0.0812 7.3024 4.1481 6.6003 -1.3760 -5.2837 1.0200 -0.1904 -0.2695 -0.5724 0.1352 0.0206 0.2212 0.2816 -0.1687 -0.0271 'X-RAY DIFFRACTION' 29 ? refined 72.3668 33.7390 46.1368 0.2095 0.1134 0.1497 0.0167 -0.0623 0.0274 2.0190 1.9447 2.7072 1.2248 -0.6730 0.9322 0.1680 -0.0601 -0.0845 -0.3659 -0.1179 0.0381 0.1030 0.0440 -0.0215 'X-RAY DIFFRACTION' 30 ? refined 69.8782 40.7710 42.2580 0.1931 0.0779 -0.1000 0.0302 0.0125 -0.0494 4.3382 3.0141 3.0765 0.7124 -0.7053 0.6703 0.0851 0.4660 -0.1325 -0.5191 0.0489 -0.0178 0.2431 0.0423 -0.0058 'X-RAY DIFFRACTION' 31 ? refined 85.2482 36.9279 37.5480 0.7237 0.4466 0.4104 0.0857 0.2105 0.1892 2.0008 5.1061 9.4160 -1.0918 6.8948 -5.5884 -0.1940 1.7150 1.5353 -1.2022 -0.4961 -1.0381 -1.4387 1.1200 0.7020 'X-RAY DIFFRACTION' 32 ? refined 80.7367 28.5939 47.3660 0.3123 0.2390 0.0692 0.0811 0.0394 0.0827 3.5885 1.4453 4.2143 1.7792 -2.4387 -2.2377 -0.2226 -0.0907 -0.2087 -0.2482 0.3443 0.1140 0.7056 -0.3857 -0.2908 'X-RAY DIFFRACTION' 33 ? refined 69.0522 23.6193 55.2014 0.5645 0.3323 0.6554 0.1788 0.0940 0.2912 1.4368 0.2882 0.7831 0.3542 -1.0283 -0.1563 -0.1628 -0.1118 -0.4038 -0.1908 -0.1119 -0.2165 0.2898 0.2715 0.2956 'X-RAY DIFFRACTION' 34 ? refined 54.2266 37.9908 62.7981 0.2168 0.2752 0.0558 -0.1375 0.0506 0.1028 6.4498 4.3682 4.9819 0.1902 -1.1648 -1.6370 0.2513 -0.5698 0.3565 0.5911 0.0962 0.4572 -0.3724 -0.4097 -0.6478 'X-RAY DIFFRACTION' 35 ? refined 66.4100 30.0334 58.6564 0.6810 0.2721 0.4099 -0.1733 0.0582 0.0512 3.4046 7.1860 1.3890 -3.1828 0.3008 -2.2011 -0.0446 0.1821 -0.0790 -0.5441 -0.0073 -0.0818 0.3685 -0.0454 -0.0411 'X-RAY DIFFRACTION' 36 ? refined 69.4482 36.8922 61.5903 0.2451 0.3657 0.0807 -0.1358 -0.0420 0.1795 1.1097 1.5965 2.4068 -0.8487 0.7498 -1.2031 0.0387 -0.6165 -0.2636 0.3570 -0.1021 -0.1718 -0.0067 0.0672 -0.2598 'X-RAY DIFFRACTION' 37 ? refined 66.5089 46.8449 65.0378 0.4771 0.3841 0.1440 -0.1453 0.0856 -0.0814 5.3458 1.9856 2.0981 -1.0037 1.7483 -1.0223 0.0311 -0.4094 0.1556 0.3490 -0.0808 -0.0352 -0.4263 0.1376 -0.3327 'X-RAY DIFFRACTION' 38 ? refined 60.7895 38.6162 69.4383 0.4025 0.6024 0.1833 -0.2339 0.0285 -0.0395 7.0486 4.0471 5.6499 -3.9411 -0.2509 1.6991 0.0112 -1.3386 -0.0380 1.0144 0.2718 0.0562 0.1265 -0.0025 -0.1626 'X-RAY DIFFRACTION' 39 ? refined 77.7246 16.0613 68.5720 0.6982 0.4218 1.3553 -0.1367 -0.0607 0.0891 1.6869 5.4606 8.8346 -2.9377 3.5921 -5.6148 0.5560 -0.6027 -1.6562 0.6918 -0.0931 1.0349 0.9941 -0.8818 -0.4610 'X-RAY DIFFRACTION' 40 ? refined 89.7359 27.3695 56.2921 0.4520 0.3598 0.4949 0.1327 -0.0359 0.0621 8.1817 7.8544 2.8458 6.7008 -1.5336 -1.2074 -0.5904 0.7523 -0.2878 -1.0149 0.2445 -0.2418 0.3495 0.3828 0.3533 'X-RAY DIFFRACTION' 41 ? refined 102.3831 46.7846 66.5303 0.3398 0.4366 0.9755 -0.0669 -0.1820 0.2377 4.4428 1.8531 6.2370 0.8759 -1.2376 -0.4180 0.1225 -0.1138 0.8121 0.3703 -0.1639 -0.3465 -0.6951 0.4549 0.2463 'X-RAY DIFFRACTION' 42 ? refined 87.8051 35.6504 56.9677 0.2868 0.6301 0.2871 -0.0217 0.0371 0.1917 4.7243 8.4691 3.3097 4.3691 1.6574 1.3783 0.4777 0.1525 -0.5448 -0.6376 -0.3114 -0.8753 0.1122 -0.0238 0.0208 'X-RAY DIFFRACTION' 43 ? refined 92.2555 39.3222 63.9224 0.2066 0.2603 0.3820 0.0120 0.0040 0.1574 1.9440 5.8999 3.0190 -3.2588 1.7995 -3.7854 0.1030 -0.1320 0.3320 -0.3357 0.1134 -0.1099 0.0766 -0.7571 -0.1588 'X-RAY DIFFRACTION' 44 ? refined 92.5162 38.9827 68.9686 0.1091 0.3095 0.3469 -0.0011 -0.1151 0.2221 5.8344 1.4093 4.5490 -0.9635 2.9042 -0.5008 -0.1867 -0.0307 0.2275 0.4078 -0.0992 -0.6820 -0.1167 0.5402 0.2142 'X-RAY DIFFRACTION' 45 ? refined 83.8516 50.8201 62.3972 0.9107 0.5797 0.6198 0.1975 -0.0637 0.1658 4.5444 5.1277 5.4364 -4.4536 4.8758 -5.1738 0.2340 -0.0660 0.4705 -0.3225 0.1345 0.5560 -0.4471 -1.1160 -0.3406 'X-RAY DIFFRACTION' 46 ? refined 88.7722 46.7694 71.0646 0.7189 0.2275 0.6118 0.0348 -0.2396 0.0517 4.3524 2.7504 3.4659 -0.6422 -0.5938 1.1117 0.1817 -0.2109 0.3760 1.2832 0.0075 -0.0042 -0.5495 -0.0066 -0.1838 'X-RAY DIFFRACTION' 47 ? refined 94.6448 50.9637 63.1050 0.6109 0.3723 1.1458 -0.0290 -0.0941 0.2487 1.3280 5.9033 4.8483 -0.3447 -0.4850 4.7907 0.2318 0.3441 0.6683 -0.4562 0.2141 -0.3907 -1.5886 -0.0969 -0.3920 'X-RAY DIFFRACTION' 48 ? refined 92.8107 33.1142 63.9487 0.1662 0.2819 0.3616 0.1233 -0.0146 0.1600 7.4430 8.8098 3.2924 4.2302 -1.2901 -1.4213 0.0230 0.3639 0.1917 -0.0207 -0.1800 -0.4264 -0.2185 0.3255 0.1486 'X-RAY DIFFRACTION' 49 ? refined 99.1765 27.0837 64.0723 0.1737 0.3853 0.6912 0.0635 0.0838 0.0374 4.1970 3.7409 7.5314 2.0324 -0.7045 0.2493 -0.1004 0.1009 -0.0277 -0.2156 0.1456 -0.9862 0.1664 1.3679 0.0377 'X-RAY DIFFRACTION' 50 ? refined 90.3350 25.2251 75.0089 0.3192 0.1917 0.3223 0.1775 0.0403 0.1683 1.8811 5.3339 5.1794 0.5238 0.6014 -1.9100 -0.2036 -0.2546 -0.5265 0.6192 0.1797 -0.0876 0.4417 0.2793 -0.0294 'X-RAY DIFFRACTION' 51 ? refined 111.7694 29.1432 57.4439 0.4513 0.9200 0.7642 0.0301 0.0833 -0.1586 2.4494 4.4127 3.8309 2.9300 -0.3329 0.1323 -1.1306 1.7133 -1.2467 -1.1766 1.0450 -1.1281 -0.2241 0.3044 0.1304 'X-RAY DIFFRACTION' 52 ? refined 121.8578 37.3079 74.9880 0.4437 1.2762 1.0588 0.2897 0.0613 -0.0911 4.1766 4.0389 2.6504 -1.6506 -0.2075 -0.3332 0.4473 0.4629 0.3184 -0.5091 -0.1135 0.4170 -0.1780 -0.3119 -0.2557 'X-RAY DIFFRACTION' 53 ? refined 119.3377 35.7149 75.7211 0.5440 1.2203 0.7924 0.2122 0.0712 -0.0461 7.3442 3.4187 4.9702 1.6813 5.8277 0.6533 -0.3534 0.8238 -0.4300 -0.6419 -0.4899 -1.0858 0.5425 2.5167 0.9025 'X-RAY DIFFRACTION' 54 ? refined 110.6888 34.3068 72.6982 0.5741 0.9079 1.1202 0.3194 -0.1743 -0.1274 3.6355 5.9598 7.6686 -4.1081 1.6542 -4.1308 -0.3644 0.1041 -0.1391 0.5066 0.1844 0.3494 -0.1180 0.0734 0.2272 'X-RAY DIFFRACTION' 55 ? refined 123.1382 38.6014 65.9673 0.7009 1.0216 1.1953 0.3601 0.1334 -0.1550 8.7811 6.1595 3.1810 1.9851 2.8638 0.0013 0.2168 1.0657 -1.7965 -0.6676 -0.4714 -0.0903 -0.6642 -0.8285 0.1961 'X-RAY DIFFRACTION' 56 ? refined 113.9064 26.0019 60.8029 0.3524 0.9804 1.0937 0.2858 0.0060 -0.2178 1.5960 4.1795 1.1527 -0.0298 0.3733 1.8216 0.1105 0.3095 -0.1859 -0.1016 0.1032 -0.2132 0.0394 0.0658 0.0214 'X-RAY DIFFRACTION' 57 ? refined 114.0521 24.2432 65.1975 0.5861 0.8219 0.9279 0.3124 -0.2369 -0.1268 9.6700 5.0762 2.7084 6.9194 0.7284 1.0668 0.2025 -0.0844 -0.2778 -0.3368 -0.5999 1.3286 -0.0253 -0.2849 0.3728 'X-RAY DIFFRACTION' 58 ? refined 127.0206 33.5458 67.9325 0.3072 1.1211 0.7993 0.0509 0.0295 0.1309 0.0489 4.4675 0.2999 -0.1284 0.1019 -0.8698 0.0737 -0.2297 0.5216 -0.5052 -0.2586 -0.1032 0.0039 -0.4820 0.0616 'X-RAY DIFFRACTION' 59 ? refined 130.3178 28.5460 67.6639 0.6654 1.0355 1.2876 -0.2280 0.4155 -0.1188 7.6612 0.1307 1.1392 -0.0891 2.3951 -0.0231 0.1228 -0.2048 0.6469 0.0616 -0.2314 -0.0608 -0.2919 0.5721 0.0397 'X-RAY DIFFRACTION' 60 ? refined 114.5510 24.1485 70.0434 0.4019 0.9302 0.9096 0.0136 -0.1577 0.0729 5.9473 0.6554 0.1834 1.6011 0.5103 0.3144 -0.0470 0.4413 -0.2492 -0.1068 0.3991 0.4546 0.2034 -0.3623 -0.2720 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 7 through 17 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 18 through 26 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 27 through 34 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 35 through 45 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 46 through 72 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 73 through 86 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 2 through 6 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 7 through 16 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 17 through 29 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 30 through 34 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 35 through 40 ) ; 'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 41 through 45 ) ; 'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 46 through 54 ) ; 'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 55 through 64 ) ; 'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 65 through 75 ) ; 'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 76 through 87 ) ; 'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 3 through 17 ) ; 'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 18 through 45 ) ; 'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 46 through 72 ) ; 'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 73 through 87 ) ; 'X-RAY DIFFRACTION' 21 21 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 1 through 5 ) ; 'X-RAY DIFFRACTION' 22 22 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 6 through 10 ) ; 'X-RAY DIFFRACTION' 23 23 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 11 through 29 ) ; 'X-RAY DIFFRACTION' 24 24 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 30 through 40 ) ; 'X-RAY DIFFRACTION' 25 25 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 41 through 54 ) ; 'X-RAY DIFFRACTION' 26 26 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 55 through 63 ) ; 'X-RAY DIFFRACTION' 27 27 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 64 through 86 ) ; 'X-RAY DIFFRACTION' 28 28 ? ? ? ? ? ? ? ? ? ;chain 'E' and (resid 1 through 13 ) ; 'X-RAY DIFFRACTION' 29 29 ? ? ? ? ? ? ? ? ? ;chain 'E' and (resid 14 through 40 ) ; 'X-RAY DIFFRACTION' 30 30 ? ? ? ? ? ? ? ? ? ;chain 'E' and (resid 41 through 88 ) ; 'X-RAY DIFFRACTION' 31 31 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 1 through 5 ) ; 'X-RAY DIFFRACTION' 32 32 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 6 through 10 ) ; 'X-RAY DIFFRACTION' 33 33 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 11 through 15 ) ; 'X-RAY DIFFRACTION' 34 34 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 16 through 29 ) ; 'X-RAY DIFFRACTION' 35 35 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 30 through 34 ) ; 'X-RAY DIFFRACTION' 36 36 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 35 through 60 ) ; 'X-RAY DIFFRACTION' 37 37 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 61 through 72 ) ; 'X-RAY DIFFRACTION' 38 38 ? ? ? ? ? ? ? ? ? ;chain 'F' and (resid 73 through 88 ) ; 'X-RAY DIFFRACTION' 39 39 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 2 through 6 ) ; 'X-RAY DIFFRACTION' 40 40 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 7 through 16 ) ; 'X-RAY DIFFRACTION' 41 41 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 17 through 29 ) ; 'X-RAY DIFFRACTION' 42 42 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 30 through 40 ) ; 'X-RAY DIFFRACTION' 43 43 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 41 through 45 ) ; 'X-RAY DIFFRACTION' 44 44 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 46 through 54 ) ; 'X-RAY DIFFRACTION' 45 45 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 55 through 63 ) ; 'X-RAY DIFFRACTION' 46 46 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 64 through 72 ) ; 'X-RAY DIFFRACTION' 47 47 ? ? ? ? ? ? ? ? ? ;chain 'G' and (resid 73 through 87 ) ; 'X-RAY DIFFRACTION' 48 48 ? ? ? ? ? ? ? ? ? ;chain 'H' and (resid 1 through 29 ) ; 'X-RAY DIFFRACTION' 49 49 ? ? ? ? ? ? ? ? ? ;chain 'H' and (resid 30 through 40 ) ; 'X-RAY DIFFRACTION' 50 50 ? ? ? ? ? ? ? ? ? ;chain 'H' and (resid 41 through 87 ) ; 'X-RAY DIFFRACTION' 51 51 ? ? ? ? ? ? ? ? ? ;chain 'I' and (resid 6 through 10 ) ; 'X-RAY DIFFRACTION' 52 52 ? ? ? ? ? ? ? ? ? ;chain 'I' and (resid 11 through 28 ) ; 'X-RAY DIFFRACTION' 53 53 ? ? ? ? ? ? ? ? ? ;chain 'I' and (resid 29 through 33 ) ; 'X-RAY DIFFRACTION' 54 54 ? ? ? ? ? ? ? ? ? ;chain 'I' and (resid 34 through 54 ) ; 'X-RAY DIFFRACTION' 55 55 ? ? ? ? ? ? ? ? ? ;chain 'J' and (resid 11 through 15 ) ; 'X-RAY DIFFRACTION' 56 56 ? ? ? ? ? ? ? ? ? ;chain 'J' and (resid 16 through 20 ) ; 'X-RAY DIFFRACTION' 57 57 ? ? ? ? ? ? ? ? ? ;chain 'J' and (resid 27 through 31 ) ; 'X-RAY DIFFRACTION' 58 58 ? ? ? ? ? ? ? ? ? ;chain 'J' and (resid 32 through 36 ) ; 'X-RAY DIFFRACTION' 59 59 ? ? ? ? ? ? ? ? ? ;chain 'J' and (resid 37 through 41 ) ; 'X-RAY DIFFRACTION' 60 60 ? ? ? ? ? ? ? ? ? ;chain 'J' and (resid 42 through 48 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 J _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 28 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NE2 _pdbx_validate_close_contact.auth_asym_id_2 J _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 47 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP B 8 ? ? -161.64 98.33 2 1 ASP E 8 ? ? -150.39 89.90 3 1 ASP I 28 ? ? -151.92 71.06 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A MSE 4 ? A MSE 4 5 1 Y 1 A TYR 5 ? A TYR 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A GLY 22 ? A GLY 22 8 1 Y 1 A GLU 23 ? A GLU 23 9 1 Y 1 A HIS 24 ? A HIS 24 10 1 Y 1 A THR 56 ? A THR 56 11 1 Y 1 A ASP 57 ? A ASP 57 12 1 Y 1 A ASP 58 ? A ASP 58 13 1 Y 1 A LEU 59 ? A LEU 59 14 1 Y 1 A LYS 60 ? A LYS 60 15 1 Y 1 A GLU 61 ? A GLU 61 16 1 Y 1 A GLU 62 ? A GLU 62 17 1 Y 1 A ILE 87 ? A ILE 87 18 1 Y 1 A HIS 88 ? A HIS 88 19 1 Y 1 A LEU 89 ? A LEU 89 20 1 Y 1 A GLU 90 ? A GLU 90 21 1 Y 1 A HIS 91 ? A HIS 91 22 1 Y 1 A HIS 92 ? A HIS 92 23 1 Y 1 A HIS 93 ? A HIS 93 24 1 Y 1 A HIS 94 ? A HIS 94 25 1 Y 1 A HIS 95 ? A HIS 95 26 1 Y 1 A HIS 96 ? A HIS 96 27 1 Y 1 B MSE 1 ? B MSE 1 28 1 Y 1 B VAL 21 ? B VAL 21 29 1 Y 1 B GLY 22 ? B GLY 22 30 1 Y 1 B GLU 23 ? B GLU 23 31 1 Y 1 B HIS 24 ? B HIS 24 32 1 Y 1 B LEU 59 ? B LEU 59 33 1 Y 1 B LYS 60 ? B LYS 60 34 1 Y 1 B GLU 61 ? B GLU 61 35 1 Y 1 B GLU 62 ? B GLU 62 36 1 Y 1 B GLY 63 ? B GLY 63 37 1 Y 1 B GLY 70 ? B GLY 70 38 1 Y 1 B VAL 71 ? B VAL 71 39 1 Y 1 B ASN 72 ? B ASN 72 40 1 Y 1 B ALA 73 ? B ALA 73 41 1 Y 1 B GLU 74 ? B GLU 74 42 1 Y 1 B HIS 88 ? B HIS 88 43 1 Y 1 B LEU 89 ? B LEU 89 44 1 Y 1 B GLU 90 ? B GLU 90 45 1 Y 1 B HIS 91 ? B HIS 91 46 1 Y 1 B HIS 92 ? B HIS 92 47 1 Y 1 B HIS 93 ? B HIS 93 48 1 Y 1 B HIS 94 ? B HIS 94 49 1 Y 1 B HIS 95 ? B HIS 95 50 1 Y 1 B HIS 96 ? B HIS 96 51 1 Y 1 C MSE 1 ? C MSE 1 52 1 Y 1 C ILE 2 ? C ILE 2 53 1 Y 1 C HIS 88 ? C HIS 88 54 1 Y 1 C LEU 89 ? C LEU 89 55 1 Y 1 C GLU 90 ? C GLU 90 56 1 Y 1 C HIS 91 ? C HIS 91 57 1 Y 1 C HIS 92 ? C HIS 92 58 1 Y 1 C HIS 93 ? C HIS 93 59 1 Y 1 C HIS 94 ? C HIS 94 60 1 Y 1 C HIS 95 ? C HIS 95 61 1 Y 1 C HIS 96 ? C HIS 96 62 1 Y 1 D GLU 23 ? D GLU 23 63 1 Y 1 D HIS 24 ? D HIS 24 64 1 Y 1 D ILE 87 ? D ILE 87 65 1 Y 1 D HIS 88 ? D HIS 88 66 1 Y 1 D LEU 89 ? D LEU 89 67 1 Y 1 D GLU 90 ? D GLU 90 68 1 Y 1 D HIS 91 ? D HIS 91 69 1 Y 1 D HIS 92 ? D HIS 92 70 1 Y 1 D HIS 93 ? D HIS 93 71 1 Y 1 D HIS 94 ? D HIS 94 72 1 Y 1 D HIS 95 ? D HIS 95 73 1 Y 1 D HIS 96 ? D HIS 96 74 1 Y 1 E LEU 89 ? E LEU 89 75 1 Y 1 E GLU 90 ? E GLU 90 76 1 Y 1 E HIS 91 ? E HIS 91 77 1 Y 1 E HIS 92 ? E HIS 92 78 1 Y 1 E HIS 93 ? E HIS 93 79 1 Y 1 E HIS 94 ? E HIS 94 80 1 Y 1 E HIS 95 ? E HIS 95 81 1 Y 1 E HIS 96 ? E HIS 96 82 1 Y 1 F LEU 89 ? F LEU 89 83 1 Y 1 F GLU 90 ? F GLU 90 84 1 Y 1 F HIS 91 ? F HIS 91 85 1 Y 1 F HIS 92 ? F HIS 92 86 1 Y 1 F HIS 93 ? F HIS 93 87 1 Y 1 F HIS 94 ? F HIS 94 88 1 Y 1 F HIS 95 ? F HIS 95 89 1 Y 1 F HIS 96 ? F HIS 96 90 1 Y 1 G MSE 1 ? G MSE 1 91 1 Y 1 G HIS 88 ? G HIS 88 92 1 Y 1 G LEU 89 ? G LEU 89 93 1 Y 1 G GLU 90 ? G GLU 90 94 1 Y 1 G HIS 91 ? G HIS 91 95 1 Y 1 G HIS 92 ? G HIS 92 96 1 Y 1 G HIS 93 ? G HIS 93 97 1 Y 1 G HIS 94 ? G HIS 94 98 1 Y 1 G HIS 95 ? G HIS 95 99 1 Y 1 G HIS 96 ? G HIS 96 100 1 Y 1 H HIS 88 ? H HIS 88 101 1 Y 1 H LEU 89 ? H LEU 89 102 1 Y 1 H GLU 90 ? H GLU 90 103 1 Y 1 H HIS 91 ? H HIS 91 104 1 Y 1 H HIS 92 ? H HIS 92 105 1 Y 1 H HIS 93 ? H HIS 93 106 1 Y 1 H HIS 94 ? H HIS 94 107 1 Y 1 H HIS 95 ? H HIS 95 108 1 Y 1 H HIS 96 ? H HIS 96 109 1 Y 1 I MSE 1 ? I MSE 1 110 1 Y 1 I ILE 2 ? I ILE 2 111 1 Y 1 I ASP 3 ? I ASP 3 112 1 Y 1 I MSE 4 ? I MSE 4 113 1 Y 1 I TYR 5 ? I TYR 5 114 1 Y 1 I GLN 14 ? I GLN 14 115 1 Y 1 I PHE 20 ? I PHE 20 116 1 Y 1 I VAL 21 ? I VAL 21 117 1 Y 1 I GLY 22 ? I GLY 22 118 1 Y 1 I GLU 23 ? I GLU 23 119 1 Y 1 I HIS 24 ? I HIS 24 120 1 Y 1 I SER 25 ? I SER 25 121 1 Y 1 I ARG 26 ? I ARG 26 122 1 Y 1 I ASN 45 ? I ASN 45 123 1 Y 1 I MSE 46 ? I MSE 46 124 1 Y 1 I GLN 47 ? I GLN 47 125 1 Y 1 I THR 48 ? I THR 48 126 1 Y 1 I ASN 49 ? I ASN 49 127 1 Y 1 I LYS 50 ? I LYS 50 128 1 Y 1 I GLY 55 ? I GLY 55 129 1 Y 1 I THR 56 ? I THR 56 130 1 Y 1 I ASP 57 ? I ASP 57 131 1 Y 1 I ASP 58 ? I ASP 58 132 1 Y 1 I LEU 59 ? I LEU 59 133 1 Y 1 I LYS 60 ? I LYS 60 134 1 Y 1 I GLU 61 ? I GLU 61 135 1 Y 1 I GLU 62 ? I GLU 62 136 1 Y 1 I GLY 63 ? I GLY 63 137 1 Y 1 I TYR 64 ? I TYR 64 138 1 Y 1 I ILE 65 ? I ILE 65 139 1 Y 1 I ALA 66 ? I ALA 66 140 1 Y 1 I HIS 67 ? I HIS 67 141 1 Y 1 I ILE 68 ? I ILE 68 142 1 Y 1 I LEU 69 ? I LEU 69 143 1 Y 1 I GLY 70 ? I GLY 70 144 1 Y 1 I VAL 71 ? I VAL 71 145 1 Y 1 I ASN 72 ? I ASN 72 146 1 Y 1 I ALA 73 ? I ALA 73 147 1 Y 1 I GLU 74 ? I GLU 74 148 1 Y 1 I GLU 75 ? I GLU 75 149 1 Y 1 I GLY 76 ? I GLY 76 150 1 Y 1 I ASP 77 ? I ASP 77 151 1 Y 1 I GLU 78 ? I GLU 78 152 1 Y 1 I ILE 79 ? I ILE 79 153 1 Y 1 I THR 80 ? I THR 80 154 1 Y 1 I GLU 81 ? I GLU 81 155 1 Y 1 I TYR 82 ? I TYR 82 156 1 Y 1 I LEU 83 ? I LEU 83 157 1 Y 1 I ASN 84 ? I ASN 84 158 1 Y 1 I GLU 85 ? I GLU 85 159 1 Y 1 I VAL 86 ? I VAL 86 160 1 Y 1 I ILE 87 ? I ILE 87 161 1 Y 1 I HIS 88 ? I HIS 88 162 1 Y 1 I LEU 89 ? I LEU 89 163 1 Y 1 I GLU 90 ? I GLU 90 164 1 Y 1 I HIS 91 ? I HIS 91 165 1 Y 1 I HIS 92 ? I HIS 92 166 1 Y 1 I HIS 93 ? I HIS 93 167 1 Y 1 I HIS 94 ? I HIS 94 168 1 Y 1 I HIS 95 ? I HIS 95 169 1 Y 1 I HIS 96 ? I HIS 96 170 1 Y 1 J MSE 1 ? J MSE 1 171 1 Y 1 J ILE 2 ? J ILE 2 172 1 Y 1 J ASP 3 ? J ASP 3 173 1 Y 1 J MSE 4 ? J MSE 4 174 1 Y 1 J TYR 5 ? J TYR 5 175 1 Y 1 J LEU 6 ? J LEU 6 176 1 Y 1 J TYR 7 ? J TYR 7 177 1 Y 1 J ASP 8 ? J ASP 8 178 1 Y 1 J ASP 9 ? J ASP 9 179 1 Y 1 J ASN 10 ? J ASN 10 180 1 Y 1 J VAL 21 ? J VAL 21 181 1 Y 1 J GLY 22 ? J GLY 22 182 1 Y 1 J GLU 23 ? J GLU 23 183 1 Y 1 J HIS 24 ? J HIS 24 184 1 Y 1 J SER 25 ? J SER 25 185 1 Y 1 J ARG 26 ? J ARG 26 186 1 Y 1 J ASN 49 ? J ASN 49 187 1 Y 1 J LYS 50 ? J LYS 50 188 1 Y 1 J PHE 51 ? J PHE 51 189 1 Y 1 J GLY 52 ? J GLY 52 190 1 Y 1 J ILE 53 ? J ILE 53 191 1 Y 1 J ILE 54 ? J ILE 54 192 1 Y 1 J GLY 55 ? J GLY 55 193 1 Y 1 J THR 56 ? J THR 56 194 1 Y 1 J ASP 57 ? J ASP 57 195 1 Y 1 J ASP 58 ? J ASP 58 196 1 Y 1 J LEU 59 ? J LEU 59 197 1 Y 1 J LYS 60 ? J LYS 60 198 1 Y 1 J GLU 61 ? J GLU 61 199 1 Y 1 J GLU 62 ? J GLU 62 200 1 Y 1 J GLY 63 ? J GLY 63 201 1 Y 1 J TYR 64 ? J TYR 64 202 1 Y 1 J ILE 65 ? J ILE 65 203 1 Y 1 J ALA 66 ? J ALA 66 204 1 Y 1 J HIS 67 ? J HIS 67 205 1 Y 1 J ILE 68 ? J ILE 68 206 1 Y 1 J LEU 69 ? J LEU 69 207 1 Y 1 J GLY 70 ? J GLY 70 208 1 Y 1 J VAL 71 ? J VAL 71 209 1 Y 1 J ASN 72 ? J ASN 72 210 1 Y 1 J ALA 73 ? J ALA 73 211 1 Y 1 J GLU 74 ? J GLU 74 212 1 Y 1 J GLU 75 ? J GLU 75 213 1 Y 1 J GLY 76 ? J GLY 76 214 1 Y 1 J ASP 77 ? J ASP 77 215 1 Y 1 J GLU 78 ? J GLU 78 216 1 Y 1 J ILE 79 ? J ILE 79 217 1 Y 1 J THR 80 ? J THR 80 218 1 Y 1 J GLU 81 ? J GLU 81 219 1 Y 1 J TYR 82 ? J TYR 82 220 1 Y 1 J LEU 83 ? J LEU 83 221 1 Y 1 J ASN 84 ? J ASN 84 222 1 Y 1 J GLU 85 ? J GLU 85 223 1 Y 1 J VAL 86 ? J VAL 86 224 1 Y 1 J ILE 87 ? J ILE 87 225 1 Y 1 J HIS 88 ? J HIS 88 226 1 Y 1 J LEU 89 ? J LEU 89 227 1 Y 1 J GLU 90 ? J GLU 90 228 1 Y 1 J HIS 91 ? J HIS 91 229 1 Y 1 J HIS 92 ? J HIS 92 230 1 Y 1 J HIS 93 ? J HIS 93 231 1 Y 1 J HIS 94 ? J HIS 94 232 1 Y 1 J HIS 95 ? J HIS 95 233 1 Y 1 J HIS 96 ? J HIS 96 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' 'SEC-MALS, dimer' 2 1 'light scattering' 'SEC-MALS, dimer' #