data_6IZ6 # _entry.id 6IZ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IZ6 pdb_00006iz6 10.2210/pdb6iz6/pdb WWPDB D_1300010194 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IZ6 _pdbx_database_status.recvd_initial_deposition_date 2018-12-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, X.L.' 1 ? 'Wang, X.H.' 2 ? 'Su, M.' 3 ? 'Hendrickson, W.A.' 4 ? 'Chen, Y.H.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 116 _citation.language ? _citation.page_first 4238 _citation.page_last 4243 _citation.title 'Structural basis for activity of TRIC counter-ion channels in calcium release.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1817271116 _citation.pdbx_database_id_PubMed 30770441 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, X.H.' 1 ? primary 'Su, M.' 2 ? primary 'Gao, F.' 3 ? primary 'Xie, W.' 4 ? primary 'Zeng, Y.' 5 ? primary 'Li, D.L.' 6 ? primary 'Liu, X.L.' 7 ? primary 'Zhao, H.' 8 ? primary 'Qin, L.' 9 ? primary 'Li, F.' 10 ? primary 'Liu, Q.' 11 ? primary 'Clarke, O.B.' 12 ? primary 'Lam, S.M.' 13 ? primary 'Shui, G.H.' 14 ? primary 'Hendrickson, W.A.' 15 ? primary 'Chen, Y.H.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6IZ6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 250.110 _cell.length_a_esd ? _cell.length_b 250.110 _cell.length_b_esd ? _cell.length_c 250.110 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IZ6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Trimeric intracellular cation channel type B-B' 35463.840 1 ? ? ? ? 2 non-polymer nat 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TRICB-B,Transmembrane protein 38B-B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MESLSEVSVQFSQLSMFPFFDMAHYLASVMSAREQAGALDIASHSPMASWFSAMLHCFGGGILSSILLAEPPVGILANTT NIMLASAIWYMVYYFPYDLFYNCFFFLPIRLIAAGMKEVTRTWKILSGITHAHSHYKDAWLVMITIGWARGAGGGLISNF EQLVRGVWKPESNEFLKMSYPVKVTLIGAVLFTLQHGHYLPISRHNLMFIYTMFLVSIKVTMMLTHSAGSPFLPLETPLH RILFGLRQNQAEVRESPSSSGAKGKPSKKTLDKDSGEQSNKKDKAAAENLYFQGLEDYKDDDDKHHHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MESLSEVSVQFSQLSMFPFFDMAHYLASVMSAREQAGALDIASHSPMASWFSAMLHCFGGGILSSILLAEPPVGILANTT NIMLASAIWYMVYYFPYDLFYNCFFFLPIRLIAAGMKEVTRTWKILSGITHAHSHYKDAWLVMITIGWARGAGGGLISNF EQLVRGVWKPESNEFLKMSYPVKVTLIGAVLFTLQHGHYLPISRHNLMFIYTMFLVSIKVTMMLTHSAGSPFLPLETPLH RILFGLRQNQAEVRESPSSSGAKGKPSKKTLDKDSGEQSNKKDKAAAENLYFQGLEDYKDDDDKHHHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 SER n 1 4 LEU n 1 5 SER n 1 6 GLU n 1 7 VAL n 1 8 SER n 1 9 VAL n 1 10 GLN n 1 11 PHE n 1 12 SER n 1 13 GLN n 1 14 LEU n 1 15 SER n 1 16 MET n 1 17 PHE n 1 18 PRO n 1 19 PHE n 1 20 PHE n 1 21 ASP n 1 22 MET n 1 23 ALA n 1 24 HIS n 1 25 TYR n 1 26 LEU n 1 27 ALA n 1 28 SER n 1 29 VAL n 1 30 MET n 1 31 SER n 1 32 ALA n 1 33 ARG n 1 34 GLU n 1 35 GLN n 1 36 ALA n 1 37 GLY n 1 38 ALA n 1 39 LEU n 1 40 ASP n 1 41 ILE n 1 42 ALA n 1 43 SER n 1 44 HIS n 1 45 SER n 1 46 PRO n 1 47 MET n 1 48 ALA n 1 49 SER n 1 50 TRP n 1 51 PHE n 1 52 SER n 1 53 ALA n 1 54 MET n 1 55 LEU n 1 56 HIS n 1 57 CYS n 1 58 PHE n 1 59 GLY n 1 60 GLY n 1 61 GLY n 1 62 ILE n 1 63 LEU n 1 64 SER n 1 65 SER n 1 66 ILE n 1 67 LEU n 1 68 LEU n 1 69 ALA n 1 70 GLU n 1 71 PRO n 1 72 PRO n 1 73 VAL n 1 74 GLY n 1 75 ILE n 1 76 LEU n 1 77 ALA n 1 78 ASN n 1 79 THR n 1 80 THR n 1 81 ASN n 1 82 ILE n 1 83 MET n 1 84 LEU n 1 85 ALA n 1 86 SER n 1 87 ALA n 1 88 ILE n 1 89 TRP n 1 90 TYR n 1 91 MET n 1 92 VAL n 1 93 TYR n 1 94 TYR n 1 95 PHE n 1 96 PRO n 1 97 TYR n 1 98 ASP n 1 99 LEU n 1 100 PHE n 1 101 TYR n 1 102 ASN n 1 103 CYS n 1 104 PHE n 1 105 PHE n 1 106 PHE n 1 107 LEU n 1 108 PRO n 1 109 ILE n 1 110 ARG n 1 111 LEU n 1 112 ILE n 1 113 ALA n 1 114 ALA n 1 115 GLY n 1 116 MET n 1 117 LYS n 1 118 GLU n 1 119 VAL n 1 120 THR n 1 121 ARG n 1 122 THR n 1 123 TRP n 1 124 LYS n 1 125 ILE n 1 126 LEU n 1 127 SER n 1 128 GLY n 1 129 ILE n 1 130 THR n 1 131 HIS n 1 132 ALA n 1 133 HIS n 1 134 SER n 1 135 HIS n 1 136 TYR n 1 137 LYS n 1 138 ASP n 1 139 ALA n 1 140 TRP n 1 141 LEU n 1 142 VAL n 1 143 MET n 1 144 ILE n 1 145 THR n 1 146 ILE n 1 147 GLY n 1 148 TRP n 1 149 ALA n 1 150 ARG n 1 151 GLY n 1 152 ALA n 1 153 GLY n 1 154 GLY n 1 155 GLY n 1 156 LEU n 1 157 ILE n 1 158 SER n 1 159 ASN n 1 160 PHE n 1 161 GLU n 1 162 GLN n 1 163 LEU n 1 164 VAL n 1 165 ARG n 1 166 GLY n 1 167 VAL n 1 168 TRP n 1 169 LYS n 1 170 PRO n 1 171 GLU n 1 172 SER n 1 173 ASN n 1 174 GLU n 1 175 PHE n 1 176 LEU n 1 177 LYS n 1 178 MET n 1 179 SER n 1 180 TYR n 1 181 PRO n 1 182 VAL n 1 183 LYS n 1 184 VAL n 1 185 THR n 1 186 LEU n 1 187 ILE n 1 188 GLY n 1 189 ALA n 1 190 VAL n 1 191 LEU n 1 192 PHE n 1 193 THR n 1 194 LEU n 1 195 GLN n 1 196 HIS n 1 197 GLY n 1 198 HIS n 1 199 TYR n 1 200 LEU n 1 201 PRO n 1 202 ILE n 1 203 SER n 1 204 ARG n 1 205 HIS n 1 206 ASN n 1 207 LEU n 1 208 MET n 1 209 PHE n 1 210 ILE n 1 211 TYR n 1 212 THR n 1 213 MET n 1 214 PHE n 1 215 LEU n 1 216 VAL n 1 217 SER n 1 218 ILE n 1 219 LYS n 1 220 VAL n 1 221 THR n 1 222 MET n 1 223 MET n 1 224 LEU n 1 225 THR n 1 226 HIS n 1 227 SER n 1 228 ALA n 1 229 GLY n 1 230 SER n 1 231 PRO n 1 232 PHE n 1 233 LEU n 1 234 PRO n 1 235 LEU n 1 236 GLU n 1 237 THR n 1 238 PRO n 1 239 LEU n 1 240 HIS n 1 241 ARG n 1 242 ILE n 1 243 LEU n 1 244 PHE n 1 245 GLY n 1 246 LEU n 1 247 ARG n 1 248 GLN n 1 249 ASN n 1 250 GLN n 1 251 ALA n 1 252 GLU n 1 253 VAL n 1 254 ARG n 1 255 GLU n 1 256 SER n 1 257 PRO n 1 258 SER n 1 259 SER n 1 260 SER n 1 261 GLY n 1 262 ALA n 1 263 LYS n 1 264 GLY n 1 265 LYS n 1 266 PRO n 1 267 SER n 1 268 LYS n 1 269 LYS n 1 270 THR n 1 271 LEU n 1 272 ASP n 1 273 LYS n 1 274 ASP n 1 275 SER n 1 276 GLY n 1 277 GLU n 1 278 GLN n 1 279 SER n 1 280 ASN n 1 281 LYS n 1 282 LYS n 1 283 ASP n 1 284 LYS n 1 285 ALA n 1 286 ALA n 1 287 ALA n 1 288 GLU n 1 289 ASN n 1 290 LEU n 1 291 TYR n 1 292 PHE n 1 293 GLN n 1 294 GLY n 1 295 LEU n 1 296 GLU n 1 297 ASP n 1 298 TYR n 1 299 LYS n 1 300 ASP n 1 301 ASP n 1 302 ASP n 1 303 ASP n 1 304 LYS n 1 305 HIS n 1 306 HIS n 1 307 HIS n 1 308 HIS n 1 309 HIS n 1 310 HIS n 1 311 HIS n 1 312 HIS n 1 313 HIS n 1 314 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 314 _entity_src_gen.gene_src_common_name 'African clawed frog' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene tmem38b-b _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xenopus laevis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8355 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name Schizosaccharomyces _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4895 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code T38BB_XENLA _struct_ref.pdbx_db_accession Q6GN30 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MESLSEVSVQFSQLSMFPFFDMAHYLASVMSAREQAGALDIASHSPMASWFSAMLHCFGGGILSSILLAEPPVGILANTT NIMLASAIWYMVYYFPYDLFYNCFFFLPIRLIAAGMKEVTRTWKILSGITHAHSHYKDAWLVMITIGWARGAGGGLISNF EQLVRGVWKPESNEFLKMSYPVKVTLIGAVLFTLQHGHYLPISRHNLMFIYTMFLVSIKVTMMLTHSAGSPFLPLETPLH RILFGLRQNQAEVRESPSSSGAKGKPSKKTLDKDSGEQSNKKDK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IZ6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 284 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6GN30 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 284 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 284 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6IZ6 ALA A 285 ? UNP Q6GN30 ? ? 'expression tag' 285 1 1 6IZ6 ALA A 286 ? UNP Q6GN30 ? ? 'expression tag' 286 2 1 6IZ6 ALA A 287 ? UNP Q6GN30 ? ? 'expression tag' 287 3 1 6IZ6 GLU A 288 ? UNP Q6GN30 ? ? 'expression tag' 288 4 1 6IZ6 ASN A 289 ? UNP Q6GN30 ? ? 'expression tag' 289 5 1 6IZ6 LEU A 290 ? UNP Q6GN30 ? ? 'expression tag' 290 6 1 6IZ6 TYR A 291 ? UNP Q6GN30 ? ? 'expression tag' 291 7 1 6IZ6 PHE A 292 ? UNP Q6GN30 ? ? 'expression tag' 292 8 1 6IZ6 GLN A 293 ? UNP Q6GN30 ? ? 'expression tag' 293 9 1 6IZ6 GLY A 294 ? UNP Q6GN30 ? ? 'expression tag' 294 10 1 6IZ6 LEU A 295 ? UNP Q6GN30 ? ? 'expression tag' 295 11 1 6IZ6 GLU A 296 ? UNP Q6GN30 ? ? 'expression tag' 296 12 1 6IZ6 ASP A 297 ? UNP Q6GN30 ? ? 'expression tag' 297 13 1 6IZ6 TYR A 298 ? UNP Q6GN30 ? ? 'expression tag' 298 14 1 6IZ6 LYS A 299 ? UNP Q6GN30 ? ? 'expression tag' 299 15 1 6IZ6 ASP A 300 ? UNP Q6GN30 ? ? 'expression tag' 300 16 1 6IZ6 ASP A 301 ? UNP Q6GN30 ? ? 'expression tag' 301 17 1 6IZ6 ASP A 302 ? UNP Q6GN30 ? ? 'expression tag' 302 18 1 6IZ6 ASP A 303 ? UNP Q6GN30 ? ? 'expression tag' 303 19 1 6IZ6 LYS A 304 ? UNP Q6GN30 ? ? 'expression tag' 304 20 1 6IZ6 HIS A 305 ? UNP Q6GN30 ? ? 'expression tag' 305 21 1 6IZ6 HIS A 306 ? UNP Q6GN30 ? ? 'expression tag' 306 22 1 6IZ6 HIS A 307 ? UNP Q6GN30 ? ? 'expression tag' 307 23 1 6IZ6 HIS A 308 ? UNP Q6GN30 ? ? 'expression tag' 308 24 1 6IZ6 HIS A 309 ? UNP Q6GN30 ? ? 'expression tag' 309 25 1 6IZ6 HIS A 310 ? UNP Q6GN30 ? ? 'expression tag' 310 26 1 6IZ6 HIS A 311 ? UNP Q6GN30 ? ? 'expression tag' 311 27 1 6IZ6 HIS A 312 ? UNP Q6GN30 ? ? 'expression tag' 312 28 1 6IZ6 HIS A 313 ? UNP Q6GN30 ? ? 'expression tag' 313 29 1 6IZ6 HIS A 314 ? UNP Q6GN30 ? ? 'expression tag' 314 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IZ6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 73.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 278 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 350 MME, CaCl2, MES PH6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.7712 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.7712 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IZ6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.290 _reflns.d_resolution_low 48.134 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9924 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 82.800 _reflns.pdbx_Rmerge_I_obs 0.213 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.214 _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.290 3.550 ? ? ? ? ? ? 1812 84.700 ? ? ? ? 6.966 ? ? ? ? ? ? ? ? 44.200 ? ? ? ? 7.047 1.043 ? 1 1 0.583 ? 8.710 48.130 ? ? ? ? ? ? 679 99.400 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 92.700 ? ? ? ? 0.088 0.009 ? 2 1 1.000 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 267.330 _refine.B_iso_mean 149.6937 _refine.B_iso_min 66.980 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IZ6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.2930 _refine.ls_d_res_low 48.1340 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9779 _refine.ls_number_reflns_R_free 456 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.7600 _refine.ls_percent_reflns_R_free 4.6600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3276 _refine.ls_R_factor_R_free 0.3542 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3263 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6IZ5 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 53.1500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.2930 _refine_hist.d_res_low 48.1340 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 1769 _refine_hist.pdbx_number_residues_total 224 _refine_hist.pdbx_B_iso_mean_ligand 182.68 _refine_hist.pdbx_B_iso_mean_solvent 95.28 _refine_hist.pdbx_number_atoms_protein 1766 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.2932 3.7696 2762 . 141 2621 80.0000 . . . 0.4632 0.0000 0.4561 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.7696 4.7486 3283 . 146 3137 94.0000 . . . 0.3565 0.0000 0.3179 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 4.7486 48.1388 3734 . 169 3565 100.0000 . . . 0.3411 0.0000 0.3159 . . . . . . 3 . . . # _struct.entry_id 6IZ6 _struct.title 'Crystal Structure Analysis of TRIC counter-ion channels in calcium release' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IZ6 _struct_keywords.text 'TRIC, cation channel, membrane protein' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? GLN A 13 ? SER A 5 GLN A 13 1 ? 9 HELX_P HELX_P2 AA2 PHE A 19 ? GLU A 34 ? PHE A 19 GLU A 34 1 ? 16 HELX_P HELX_P3 AA3 GLY A 37 ? SER A 45 ? GLY A 37 SER A 45 1 ? 9 HELX_P HELX_P4 AA4 SER A 45 ? PHE A 58 ? SER A 45 PHE A 58 1 ? 14 HELX_P HELX_P5 AA5 PHE A 58 ? LEU A 68 ? PHE A 58 LEU A 68 1 ? 11 HELX_P HELX_P6 AA6 VAL A 73 ? ASN A 78 ? VAL A 73 ASN A 78 1 ? 6 HELX_P HELX_P7 AA7 ASN A 78 ? PHE A 95 ? ASN A 78 PHE A 95 1 ? 18 HELX_P HELX_P8 AA8 ASP A 98 ? PHE A 105 ? ASP A 98 PHE A 105 1 ? 8 HELX_P HELX_P9 AA9 PHE A 106 ? TYR A 136 ? PHE A 106 TYR A 136 1 ? 31 HELX_P HELX_P10 AB1 ALA A 139 ? ALA A 152 ? ALA A 139 ALA A 152 1 ? 14 HELX_P HELX_P11 AB2 ALA A 152 ? ILE A 157 ? ALA A 152 ILE A 157 1 ? 6 HELX_P HELX_P12 AB3 ILE A 157 ? GLY A 166 ? ILE A 157 GLY A 166 1 ? 10 HELX_P HELX_P13 AB4 SER A 179 ? GLY A 197 ? SER A 179 GLY A 197 1 ? 19 HELX_P HELX_P14 AB5 SER A 203 ? SER A 227 ? SER A 203 SER A 227 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue CA A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ALA A 69 ? ALA A 69 . ? 57_554 ? 2 AC1 3 ALA A 69 ? ALA A 69 . ? 1_555 ? 3 AC1 3 ALA A 69 ? ALA A 69 . ? 77_545 ? # _atom_sites.entry_id 6IZ6 _atom_sites.fract_transf_matrix[1][1] 0.003998 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.003998 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003998 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 TRP 148 148 148 TRP TRP A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 TRP 168 168 168 TRP TRP A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 HIS 198 198 198 HIS HIS A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 MET 208 208 208 MET MET A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 MET 213 213 213 MET MET A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 MET 223 223 223 MET MET A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 HIS 226 226 226 HIS HIS A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 ALA 228 228 ? ? ? A . n A 1 229 GLY 229 229 ? ? ? A . n A 1 230 SER 230 230 ? ? ? A . n A 1 231 PRO 231 231 ? ? ? A . n A 1 232 PHE 232 232 ? ? ? A . n A 1 233 LEU 233 233 ? ? ? A . n A 1 234 PRO 234 234 ? ? ? A . n A 1 235 LEU 235 235 ? ? ? A . n A 1 236 GLU 236 236 ? ? ? A . n A 1 237 THR 237 237 ? ? ? A . n A 1 238 PRO 238 238 ? ? ? A . n A 1 239 LEU 239 239 ? ? ? A . n A 1 240 HIS 240 240 ? ? ? A . n A 1 241 ARG 241 241 ? ? ? A . n A 1 242 ILE 242 242 ? ? ? A . n A 1 243 LEU 243 243 ? ? ? A . n A 1 244 PHE 244 244 ? ? ? A . n A 1 245 GLY 245 245 ? ? ? A . n A 1 246 LEU 246 246 ? ? ? A . n A 1 247 ARG 247 247 ? ? ? A . n A 1 248 GLN 248 248 ? ? ? A . n A 1 249 ASN 249 249 ? ? ? A . n A 1 250 GLN 250 250 ? ? ? A . n A 1 251 ALA 251 251 ? ? ? A . n A 1 252 GLU 252 252 ? ? ? A . n A 1 253 VAL 253 253 ? ? ? A . n A 1 254 ARG 254 254 ? ? ? A . n A 1 255 GLU 255 255 ? ? ? A . n A 1 256 SER 256 256 ? ? ? A . n A 1 257 PRO 257 257 ? ? ? A . n A 1 258 SER 258 258 ? ? ? A . n A 1 259 SER 259 259 ? ? ? A . n A 1 260 SER 260 260 ? ? ? A . n A 1 261 GLY 261 261 ? ? ? A . n A 1 262 ALA 262 262 ? ? ? A . n A 1 263 LYS 263 263 ? ? ? A . n A 1 264 GLY 264 264 ? ? ? A . n A 1 265 LYS 265 265 ? ? ? A . n A 1 266 PRO 266 266 ? ? ? A . n A 1 267 SER 267 267 ? ? ? A . n A 1 268 LYS 268 268 ? ? ? A . n A 1 269 LYS 269 269 ? ? ? A . n A 1 270 THR 270 270 ? ? ? A . n A 1 271 LEU 271 271 ? ? ? A . n A 1 272 ASP 272 272 ? ? ? A . n A 1 273 LYS 273 273 ? ? ? A . n A 1 274 ASP 274 274 ? ? ? A . n A 1 275 SER 275 275 ? ? ? A . n A 1 276 GLY 276 276 ? ? ? A . n A 1 277 GLU 277 277 ? ? ? A . n A 1 278 GLN 278 278 ? ? ? A . n A 1 279 SER 279 279 ? ? ? A . n A 1 280 ASN 280 280 ? ? ? A . n A 1 281 LYS 281 281 ? ? ? A . n A 1 282 LYS 282 282 ? ? ? A . n A 1 283 ASP 283 283 ? ? ? A . n A 1 284 LYS 284 284 ? ? ? A . n A 1 285 ALA 285 285 ? ? ? A . n A 1 286 ALA 286 286 ? ? ? A . n A 1 287 ALA 287 287 ? ? ? A . n A 1 288 GLU 288 288 ? ? ? A . n A 1 289 ASN 289 289 ? ? ? A . n A 1 290 LEU 290 290 ? ? ? A . n A 1 291 TYR 291 291 ? ? ? A . n A 1 292 PHE 292 292 ? ? ? A . n A 1 293 GLN 293 293 ? ? ? A . n A 1 294 GLY 294 294 ? ? ? A . n A 1 295 LEU 295 295 ? ? ? A . n A 1 296 GLU 296 296 ? ? ? A . n A 1 297 ASP 297 297 ? ? ? A . n A 1 298 TYR 298 298 ? ? ? A . n A 1 299 LYS 299 299 ? ? ? A . n A 1 300 ASP 300 300 ? ? ? A . n A 1 301 ASP 301 301 ? ? ? A . n A 1 302 ASP 302 302 ? ? ? A . n A 1 303 ASP 303 303 ? ? ? A . n A 1 304 LYS 304 304 ? ? ? A . n A 1 305 HIS 305 305 ? ? ? A . n A 1 306 HIS 306 306 ? ? ? A . n A 1 307 HIS 307 307 ? ? ? A . n A 1 308 HIS 308 308 ? ? ? A . n A 1 309 HIS 309 309 ? ? ? A . n A 1 310 HIS 310 310 ? ? ? A . n A 1 311 HIS 311 311 ? ? ? A . n A 1 312 HIS 312 312 ? ? ? A . n A 1 313 HIS 313 313 ? ? ? A . n A 1 314 HIS 314 314 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 401 1 CA CA A . C 3 HOH 1 501 3 HOH HOH A . C 3 HOH 2 502 2 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4970 ? 1 MORE -62 ? 1 'SSA (A^2)' 31530 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 57_554 y+1/2,z,x-1/2 0.0000000000 1.0000000000 0.0000000000 125.0550000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -125.0550000000 3 'crystal symmetry operation' 77_545 z+1/2,x-1/2,y 0.0000000000 0.0000000000 1.0000000000 125.0550000000 1.0000000000 0.0000000000 0.0000000000 -125.0550000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 401 ? B CA . 2 1 A HOH 502 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-01 2 'Structure model' 1 1 2019-11-06 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14rc2_3191 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.2 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 13 ? ? -88.77 35.89 2 1 PRO A 18 ? ? -78.66 -72.46 3 1 GLU A 34 ? ? -64.65 2.68 4 1 ASN A 78 ? ? -64.25 72.15 5 1 TYR A 94 ? ? -90.00 42.69 6 1 LYS A 137 ? ? -52.40 -83.01 7 1 ASP A 138 ? ? -107.91 41.13 8 1 LYS A 169 ? ? -118.09 76.00 9 1 PRO A 170 ? ? -62.73 0.86 10 1 SER A 172 ? ? -106.72 73.28 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 501 ? 6.39 . 2 1 O ? A HOH 502 ? 6.93 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 80 ? CG2 ? A THR 80 CG2 2 1 Y 1 A TRP 140 ? CG ? A TRP 140 CG 3 1 Y 1 A TRP 140 ? CD1 ? A TRP 140 CD1 4 1 Y 1 A TRP 140 ? CD2 ? A TRP 140 CD2 5 1 Y 1 A TRP 140 ? NE1 ? A TRP 140 NE1 6 1 Y 1 A TRP 140 ? CE2 ? A TRP 140 CE2 7 1 Y 1 A TRP 140 ? CE3 ? A TRP 140 CE3 8 1 Y 1 A TRP 140 ? CZ2 ? A TRP 140 CZ2 9 1 Y 1 A TRP 140 ? CZ3 ? A TRP 140 CZ3 10 1 Y 1 A TRP 140 ? CH2 ? A TRP 140 CH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A ALA 228 ? A ALA 228 5 1 Y 1 A GLY 229 ? A GLY 229 6 1 Y 1 A SER 230 ? A SER 230 7 1 Y 1 A PRO 231 ? A PRO 231 8 1 Y 1 A PHE 232 ? A PHE 232 9 1 Y 1 A LEU 233 ? A LEU 233 10 1 Y 1 A PRO 234 ? A PRO 234 11 1 Y 1 A LEU 235 ? A LEU 235 12 1 Y 1 A GLU 236 ? A GLU 236 13 1 Y 1 A THR 237 ? A THR 237 14 1 Y 1 A PRO 238 ? A PRO 238 15 1 Y 1 A LEU 239 ? A LEU 239 16 1 Y 1 A HIS 240 ? A HIS 240 17 1 Y 1 A ARG 241 ? A ARG 241 18 1 Y 1 A ILE 242 ? A ILE 242 19 1 Y 1 A LEU 243 ? A LEU 243 20 1 Y 1 A PHE 244 ? A PHE 244 21 1 Y 1 A GLY 245 ? A GLY 245 22 1 Y 1 A LEU 246 ? A LEU 246 23 1 Y 1 A ARG 247 ? A ARG 247 24 1 Y 1 A GLN 248 ? A GLN 248 25 1 Y 1 A ASN 249 ? A ASN 249 26 1 Y 1 A GLN 250 ? A GLN 250 27 1 Y 1 A ALA 251 ? A ALA 251 28 1 Y 1 A GLU 252 ? A GLU 252 29 1 Y 1 A VAL 253 ? A VAL 253 30 1 Y 1 A ARG 254 ? A ARG 254 31 1 Y 1 A GLU 255 ? A GLU 255 32 1 Y 1 A SER 256 ? A SER 256 33 1 Y 1 A PRO 257 ? A PRO 257 34 1 Y 1 A SER 258 ? A SER 258 35 1 Y 1 A SER 259 ? A SER 259 36 1 Y 1 A SER 260 ? A SER 260 37 1 Y 1 A GLY 261 ? A GLY 261 38 1 Y 1 A ALA 262 ? A ALA 262 39 1 Y 1 A LYS 263 ? A LYS 263 40 1 Y 1 A GLY 264 ? A GLY 264 41 1 Y 1 A LYS 265 ? A LYS 265 42 1 Y 1 A PRO 266 ? A PRO 266 43 1 Y 1 A SER 267 ? A SER 267 44 1 Y 1 A LYS 268 ? A LYS 268 45 1 Y 1 A LYS 269 ? A LYS 269 46 1 Y 1 A THR 270 ? A THR 270 47 1 Y 1 A LEU 271 ? A LEU 271 48 1 Y 1 A ASP 272 ? A ASP 272 49 1 Y 1 A LYS 273 ? A LYS 273 50 1 Y 1 A ASP 274 ? A ASP 274 51 1 Y 1 A SER 275 ? A SER 275 52 1 Y 1 A GLY 276 ? A GLY 276 53 1 Y 1 A GLU 277 ? A GLU 277 54 1 Y 1 A GLN 278 ? A GLN 278 55 1 Y 1 A SER 279 ? A SER 279 56 1 Y 1 A ASN 280 ? A ASN 280 57 1 Y 1 A LYS 281 ? A LYS 281 58 1 Y 1 A LYS 282 ? A LYS 282 59 1 Y 1 A ASP 283 ? A ASP 283 60 1 Y 1 A LYS 284 ? A LYS 284 61 1 Y 1 A ALA 285 ? A ALA 285 62 1 Y 1 A ALA 286 ? A ALA 286 63 1 Y 1 A ALA 287 ? A ALA 287 64 1 Y 1 A GLU 288 ? A GLU 288 65 1 Y 1 A ASN 289 ? A ASN 289 66 1 Y 1 A LEU 290 ? A LEU 290 67 1 Y 1 A TYR 291 ? A TYR 291 68 1 Y 1 A PHE 292 ? A PHE 292 69 1 Y 1 A GLN 293 ? A GLN 293 70 1 Y 1 A GLY 294 ? A GLY 294 71 1 Y 1 A LEU 295 ? A LEU 295 72 1 Y 1 A GLU 296 ? A GLU 296 73 1 Y 1 A ASP 297 ? A ASP 297 74 1 Y 1 A TYR 298 ? A TYR 298 75 1 Y 1 A LYS 299 ? A LYS 299 76 1 Y 1 A ASP 300 ? A ASP 300 77 1 Y 1 A ASP 301 ? A ASP 301 78 1 Y 1 A ASP 302 ? A ASP 302 79 1 Y 1 A ASP 303 ? A ASP 303 80 1 Y 1 A LYS 304 ? A LYS 304 81 1 Y 1 A HIS 305 ? A HIS 305 82 1 Y 1 A HIS 306 ? A HIS 306 83 1 Y 1 A HIS 307 ? A HIS 307 84 1 Y 1 A HIS 308 ? A HIS 308 85 1 Y 1 A HIS 309 ? A HIS 309 86 1 Y 1 A HIS 310 ? A HIS 310 87 1 Y 1 A HIS 311 ? A HIS 311 88 1 Y 1 A HIS 312 ? A HIS 312 89 1 Y 1 A HIS 313 ? A HIS 313 90 1 Y 1 A HIS 314 ? A HIS 314 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Science and Technology (China)' China 2016YFA0500503 1 'Ministry of Science and Technology (China)' China 2015CB910102 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6IZ5 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support cross-linking _pdbx_struct_assembly_auth_evidence.details ? #