data_6KTY # _entry.id 6KTY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KTY pdb_00006kty 10.2210/pdb6kty/pdb WWPDB D_1300013652 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-09 2 'Structure model' 1 1 2019-10-23 3 'Structure model' 1 2 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6KTY _pdbx_database_status.recvd_initial_deposition_date 2019-08-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cho, S.Y.' 1 ? 'Yoon, S.I.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 519 _citation.language ? _citation.page_first 652 _citation.page_last 658 _citation.title 'Crystal structure of the flagellar cap protein FliD from Bdellovibrio bacteriovorus.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2019.09.024 _citation.pdbx_database_id_PubMed 31542231 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cho, S.Y.' 1 ? primary 'Song, W.S.' 2 ? primary 'Yoon, S.I.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Flagellar hook-associated protein 2' 21218.662 1 ? ? ? ? 2 water nat water 18.015 54 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HAP2,Flagellar cap protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASVDKKFLSGDPNIVDGQVDPGSAIPGDYAIEVVQLAQKPAAMSNGFPDKDQTQIGVGYIKFETPEGTKEVYINGS NSTLDGVMKQINAANVGLKAQVVEDRKDQENPFKLLVSGLSTGNDSQVTFPKIYLLDGDQDMYFEESRKAQNAKVKVDGF EIELPDNKSTDLVPGVTLDFKSAAPGREIRLSVKEN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASVDKKFLSGDPNIVDGQVDPGSAIPGDYAIEVVQLAQKPAAMSNGFPDKDQTQIGVGYIKFETPEGTKEVYINGS NSTLDGVMKQINAANVGLKAQVVEDRKDQENPFKLLVSGLSTGNDSQVTFPKIYLLDGDQDMYFEESRKAQNAKVKVDGF EIELPDNKSTDLVPGVTLDFKSAAPGREIRLSVKEN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 VAL n 1 8 ASP n 1 9 LYS n 1 10 LYS n 1 11 PHE n 1 12 LEU n 1 13 SER n 1 14 GLY n 1 15 ASP n 1 16 PRO n 1 17 ASN n 1 18 ILE n 1 19 VAL n 1 20 ASP n 1 21 GLY n 1 22 GLN n 1 23 VAL n 1 24 ASP n 1 25 PRO n 1 26 GLY n 1 27 SER n 1 28 ALA n 1 29 ILE n 1 30 PRO n 1 31 GLY n 1 32 ASP n 1 33 TYR n 1 34 ALA n 1 35 ILE n 1 36 GLU n 1 37 VAL n 1 38 VAL n 1 39 GLN n 1 40 LEU n 1 41 ALA n 1 42 GLN n 1 43 LYS n 1 44 PRO n 1 45 ALA n 1 46 ALA n 1 47 MET n 1 48 SER n 1 49 ASN n 1 50 GLY n 1 51 PHE n 1 52 PRO n 1 53 ASP n 1 54 LYS n 1 55 ASP n 1 56 GLN n 1 57 THR n 1 58 GLN n 1 59 ILE n 1 60 GLY n 1 61 VAL n 1 62 GLY n 1 63 TYR n 1 64 ILE n 1 65 LYS n 1 66 PHE n 1 67 GLU n 1 68 THR n 1 69 PRO n 1 70 GLU n 1 71 GLY n 1 72 THR n 1 73 LYS n 1 74 GLU n 1 75 VAL n 1 76 TYR n 1 77 ILE n 1 78 ASN n 1 79 GLY n 1 80 SER n 1 81 ASN n 1 82 SER n 1 83 THR n 1 84 LEU n 1 85 ASP n 1 86 GLY n 1 87 VAL n 1 88 MET n 1 89 LYS n 1 90 GLN n 1 91 ILE n 1 92 ASN n 1 93 ALA n 1 94 ALA n 1 95 ASN n 1 96 VAL n 1 97 GLY n 1 98 LEU n 1 99 LYS n 1 100 ALA n 1 101 GLN n 1 102 VAL n 1 103 VAL n 1 104 GLU n 1 105 ASP n 1 106 ARG n 1 107 LYS n 1 108 ASP n 1 109 GLN n 1 110 GLU n 1 111 ASN n 1 112 PRO n 1 113 PHE n 1 114 LYS n 1 115 LEU n 1 116 LEU n 1 117 VAL n 1 118 SER n 1 119 GLY n 1 120 LEU n 1 121 SER n 1 122 THR n 1 123 GLY n 1 124 ASN n 1 125 ASP n 1 126 SER n 1 127 GLN n 1 128 VAL n 1 129 THR n 1 130 PHE n 1 131 PRO n 1 132 LYS n 1 133 ILE n 1 134 TYR n 1 135 LEU n 1 136 LEU n 1 137 ASP n 1 138 GLY n 1 139 ASP n 1 140 GLN n 1 141 ASP n 1 142 MET n 1 143 TYR n 1 144 PHE n 1 145 GLU n 1 146 GLU n 1 147 SER n 1 148 ARG n 1 149 LYS n 1 150 ALA n 1 151 GLN n 1 152 ASN n 1 153 ALA n 1 154 LYS n 1 155 VAL n 1 156 LYS n 1 157 VAL n 1 158 ASP n 1 159 GLY n 1 160 PHE n 1 161 GLU n 1 162 ILE n 1 163 GLU n 1 164 LEU n 1 165 PRO n 1 166 ASP n 1 167 ASN n 1 168 LYS n 1 169 SER n 1 170 THR n 1 171 ASP n 1 172 LEU n 1 173 VAL n 1 174 PRO n 1 175 GLY n 1 176 VAL n 1 177 THR n 1 178 LEU n 1 179 ASP n 1 180 PHE n 1 181 LYS n 1 182 SER n 1 183 ALA n 1 184 ALA n 1 185 PRO n 1 186 GLY n 1 187 ARG n 1 188 GLU n 1 189 ILE n 1 190 ARG n 1 191 LEU n 1 192 SER n 1 193 VAL n 1 194 LYS n 1 195 GLU n 1 196 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 196 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'fliD, Bd0610' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15356 / DSM 50701 / NCIB 9529 / HD100' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 264462 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 64 ? ? ? A . n A 1 2 SER 2 65 ? ? ? A . n A 1 3 HIS 3 66 ? ? ? A . n A 1 4 MET 4 67 ? ? ? A . n A 1 5 ALA 5 68 ? ? ? A . n A 1 6 SER 6 69 ? ? ? A . n A 1 7 VAL 7 70 ? ? ? A . n A 1 8 ASP 8 71 ? ? ? A . n A 1 9 LYS 9 72 ? ? ? A . n A 1 10 LYS 10 73 ? ? ? A . n A 1 11 PHE 11 74 74 PHE PHE A . n A 1 12 LEU 12 75 75 LEU LEU A . n A 1 13 SER 13 76 76 SER SER A . n A 1 14 GLY 14 77 77 GLY GLY A . n A 1 15 ASP 15 78 78 ASP ASP A . n A 1 16 PRO 16 79 79 PRO PRO A . n A 1 17 ASN 17 80 80 ASN ASN A . n A 1 18 ILE 18 81 81 ILE ILE A . n A 1 19 VAL 19 82 82 VAL VAL A . n A 1 20 ASP 20 83 83 ASP ASP A . n A 1 21 GLY 21 84 84 GLY GLY A . n A 1 22 GLN 22 85 85 GLN GLN A . n A 1 23 VAL 23 86 ? ? ? A . n A 1 24 ASP 24 87 ? ? ? A . n A 1 25 PRO 25 88 ? ? ? A . n A 1 26 GLY 26 89 ? ? ? A . n A 1 27 SER 27 90 ? ? ? A . n A 1 28 ALA 28 91 ? ? ? A . n A 1 29 ILE 29 92 ? ? ? A . n A 1 30 PRO 30 93 93 PRO PRO A . n A 1 31 GLY 31 94 94 GLY GLY A . n A 1 32 ASP 32 95 95 ASP ASP A . n A 1 33 TYR 33 96 96 TYR TYR A . n A 1 34 ALA 34 97 97 ALA ALA A . n A 1 35 ILE 35 98 98 ILE ILE A . n A 1 36 GLU 36 99 99 GLU GLU A . n A 1 37 VAL 37 100 100 VAL VAL A . n A 1 38 VAL 38 101 101 VAL VAL A . n A 1 39 GLN 39 102 102 GLN GLN A . n A 1 40 LEU 40 103 103 LEU LEU A . n A 1 41 ALA 41 104 104 ALA ALA A . n A 1 42 GLN 42 105 105 GLN GLN A . n A 1 43 LYS 43 106 106 LYS LYS A . n A 1 44 PRO 44 107 107 PRO PRO A . n A 1 45 ALA 45 108 108 ALA ALA A . n A 1 46 ALA 46 109 109 ALA ALA A . n A 1 47 MET 47 110 110 MET MET A . n A 1 48 SER 48 111 111 SER SER A . n A 1 49 ASN 49 112 112 ASN ASN A . n A 1 50 GLY 50 113 113 GLY GLY A . n A 1 51 PHE 51 114 114 PHE PHE A . n A 1 52 PRO 52 115 115 PRO PRO A . n A 1 53 ASP 53 116 116 ASP ASP A . n A 1 54 LYS 54 117 117 LYS LYS A . n A 1 55 ASP 55 118 118 ASP ASP A . n A 1 56 GLN 56 119 119 GLN GLN A . n A 1 57 THR 57 120 120 THR THR A . n A 1 58 GLN 58 121 121 GLN GLN A . n A 1 59 ILE 59 122 122 ILE ILE A . n A 1 60 GLY 60 123 123 GLY GLY A . n A 1 61 VAL 61 124 124 VAL VAL A . n A 1 62 GLY 62 125 125 GLY GLY A . n A 1 63 TYR 63 126 126 TYR TYR A . n A 1 64 ILE 64 127 127 ILE ILE A . n A 1 65 LYS 65 128 128 LYS LYS A . n A 1 66 PHE 66 129 129 PHE PHE A . n A 1 67 GLU 67 130 130 GLU GLU A . n A 1 68 THR 68 131 131 THR THR A . n A 1 69 PRO 69 132 132 PRO PRO A . n A 1 70 GLU 70 133 133 GLU GLU A . n A 1 71 GLY 71 134 134 GLY GLY A . n A 1 72 THR 72 135 135 THR THR A . n A 1 73 LYS 73 136 136 LYS LYS A . n A 1 74 GLU 74 137 137 GLU GLU A . n A 1 75 VAL 75 138 138 VAL VAL A . n A 1 76 TYR 76 139 139 TYR TYR A . n A 1 77 ILE 77 140 140 ILE ILE A . n A 1 78 ASN 78 141 141 ASN ASN A . n A 1 79 GLY 79 142 142 GLY GLY A . n A 1 80 SER 80 143 143 SER SER A . n A 1 81 ASN 81 144 144 ASN ASN A . n A 1 82 SER 82 145 145 SER SER A . n A 1 83 THR 83 146 146 THR THR A . n A 1 84 LEU 84 147 147 LEU LEU A . n A 1 85 ASP 85 148 148 ASP ASP A . n A 1 86 GLY 86 149 149 GLY GLY A . n A 1 87 VAL 87 150 150 VAL VAL A . n A 1 88 MET 88 151 151 MET MET A . n A 1 89 LYS 89 152 152 LYS LYS A . n A 1 90 GLN 90 153 153 GLN GLN A . n A 1 91 ILE 91 154 154 ILE ILE A . n A 1 92 ASN 92 155 155 ASN ASN A . n A 1 93 ALA 93 156 156 ALA ALA A . n A 1 94 ALA 94 157 157 ALA ALA A . n A 1 95 ASN 95 158 158 ASN ASN A . n A 1 96 VAL 96 159 159 VAL VAL A . n A 1 97 GLY 97 160 160 GLY GLY A . n A 1 98 LEU 98 161 161 LEU LEU A . n A 1 99 LYS 99 162 162 LYS LYS A . n A 1 100 ALA 100 163 163 ALA ALA A . n A 1 101 GLN 101 164 164 GLN GLN A . n A 1 102 VAL 102 165 165 VAL VAL A . n A 1 103 VAL 103 166 166 VAL VAL A . n A 1 104 GLU 104 167 167 GLU GLU A . n A 1 105 ASP 105 168 168 ASP ASP A . n A 1 106 ARG 106 169 169 ARG ARG A . n A 1 107 LYS 107 170 170 LYS LYS A . n A 1 108 ASP 108 171 171 ASP ASP A . n A 1 109 GLN 109 172 172 GLN GLN A . n A 1 110 GLU 110 173 173 GLU GLU A . n A 1 111 ASN 111 174 174 ASN ASN A . n A 1 112 PRO 112 175 175 PRO PRO A . n A 1 113 PHE 113 176 176 PHE PHE A . n A 1 114 LYS 114 177 177 LYS LYS A . n A 1 115 LEU 115 178 178 LEU LEU A . n A 1 116 LEU 116 179 179 LEU LEU A . n A 1 117 VAL 117 180 180 VAL VAL A . n A 1 118 SER 118 181 181 SER SER A . n A 1 119 GLY 119 182 182 GLY GLY A . n A 1 120 LEU 120 183 183 LEU LEU A . n A 1 121 SER 121 184 184 SER SER A . n A 1 122 THR 122 185 185 THR THR A . n A 1 123 GLY 123 186 186 GLY GLY A . n A 1 124 ASN 124 187 187 ASN ASN A . n A 1 125 ASP 125 188 188 ASP ASP A . n A 1 126 SER 126 189 189 SER SER A . n A 1 127 GLN 127 190 190 GLN GLN A . n A 1 128 VAL 128 191 191 VAL VAL A . n A 1 129 THR 129 192 192 THR THR A . n A 1 130 PHE 130 193 193 PHE PHE A . n A 1 131 PRO 131 194 194 PRO PRO A . n A 1 132 LYS 132 195 195 LYS LYS A . n A 1 133 ILE 133 196 196 ILE ILE A . n A 1 134 TYR 134 197 197 TYR TYR A . n A 1 135 LEU 135 198 198 LEU LEU A . n A 1 136 LEU 136 199 199 LEU LEU A . n A 1 137 ASP 137 200 200 ASP ASP A . n A 1 138 GLY 138 201 201 GLY GLY A . n A 1 139 ASP 139 202 202 ASP ASP A . n A 1 140 GLN 140 203 203 GLN GLN A . n A 1 141 ASP 141 204 204 ASP ASP A . n A 1 142 MET 142 205 205 MET MET A . n A 1 143 TYR 143 206 206 TYR TYR A . n A 1 144 PHE 144 207 207 PHE PHE A . n A 1 145 GLU 145 208 208 GLU GLU A . n A 1 146 GLU 146 209 209 GLU GLU A . n A 1 147 SER 147 210 210 SER SER A . n A 1 148 ARG 148 211 211 ARG ARG A . n A 1 149 LYS 149 212 212 LYS LYS A . n A 1 150 ALA 150 213 213 ALA ALA A . n A 1 151 GLN 151 214 214 GLN GLN A . n A 1 152 ASN 152 215 215 ASN ASN A . n A 1 153 ALA 153 216 216 ALA ALA A . n A 1 154 LYS 154 217 217 LYS LYS A . n A 1 155 VAL 155 218 218 VAL VAL A . n A 1 156 LYS 156 219 219 LYS LYS A . n A 1 157 VAL 157 220 220 VAL VAL A . n A 1 158 ASP 158 221 221 ASP ASP A . n A 1 159 GLY 159 222 222 GLY GLY A . n A 1 160 PHE 160 223 223 PHE PHE A . n A 1 161 GLU 161 224 224 GLU GLU A . n A 1 162 ILE 162 225 225 ILE ILE A . n A 1 163 GLU 163 226 226 GLU GLU A . n A 1 164 LEU 164 227 227 LEU LEU A . n A 1 165 PRO 165 228 228 PRO PRO A . n A 1 166 ASP 166 229 229 ASP ASP A . n A 1 167 ASN 167 230 230 ASN ASN A . n A 1 168 LYS 168 231 231 LYS LYS A . n A 1 169 SER 169 232 232 SER SER A . n A 1 170 THR 170 233 233 THR THR A . n A 1 171 ASP 171 234 234 ASP ASP A . n A 1 172 LEU 172 235 235 LEU LEU A . n A 1 173 VAL 173 236 236 VAL VAL A . n A 1 174 PRO 174 237 237 PRO PRO A . n A 1 175 GLY 175 238 238 GLY GLY A . n A 1 176 VAL 176 239 239 VAL VAL A . n A 1 177 THR 177 240 240 THR THR A . n A 1 178 LEU 178 241 241 LEU LEU A . n A 1 179 ASP 179 242 242 ASP ASP A . n A 1 180 PHE 180 243 243 PHE PHE A . n A 1 181 LYS 181 244 244 LYS LYS A . n A 1 182 SER 182 245 245 SER SER A . n A 1 183 ALA 183 246 246 ALA ALA A . n A 1 184 ALA 184 247 247 ALA ALA A . n A 1 185 PRO 185 248 248 PRO PRO A . n A 1 186 GLY 186 249 249 GLY GLY A . n A 1 187 ARG 187 250 250 ARG ARG A . n A 1 188 GLU 188 251 251 GLU GLU A . n A 1 189 ILE 189 252 252 ILE ILE A . n A 1 190 ARG 190 253 253 ARG ARG A . n A 1 191 LEU 191 254 254 LEU LEU A . n A 1 192 SER 192 255 255 SER SER A . n A 1 193 VAL 193 256 256 VAL VAL A . n A 1 194 LYS 194 257 ? ? ? A . n A 1 195 GLU 195 258 ? ? ? A . n A 1 196 ASN 196 259 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 34 HOH HOH A . B 2 HOH 2 302 5 HOH HOH A . B 2 HOH 3 303 62 HOH HOH A . B 2 HOH 4 304 58 HOH HOH A . B 2 HOH 5 305 9 HOH HOH A . B 2 HOH 6 306 56 HOH HOH A . B 2 HOH 7 307 6 HOH HOH A . B 2 HOH 8 308 84 HOH HOH A . B 2 HOH 9 309 25 HOH HOH A . B 2 HOH 10 310 101 HOH HOH A . B 2 HOH 11 311 59 HOH HOH A . B 2 HOH 12 312 79 HOH HOH A . B 2 HOH 13 313 94 HOH HOH A . B 2 HOH 14 314 11 HOH HOH A . B 2 HOH 15 315 95 HOH HOH A . B 2 HOH 16 316 75 HOH HOH A . B 2 HOH 17 317 46 HOH HOH A . B 2 HOH 18 318 8 HOH HOH A . B 2 HOH 19 319 16 HOH HOH A . B 2 HOH 20 320 53 HOH HOH A . B 2 HOH 21 321 93 HOH HOH A . B 2 HOH 22 322 100 HOH HOH A . B 2 HOH 23 323 27 HOH HOH A . B 2 HOH 24 324 80 HOH HOH A . B 2 HOH 25 325 29 HOH HOH A . B 2 HOH 26 326 15 HOH HOH A . B 2 HOH 27 327 63 HOH HOH A . B 2 HOH 28 328 18 HOH HOH A . B 2 HOH 29 329 2 HOH HOH A . B 2 HOH 30 330 65 HOH HOH A . B 2 HOH 31 331 21 HOH HOH A . B 2 HOH 32 332 69 HOH HOH A . B 2 HOH 33 333 67 HOH HOH A . B 2 HOH 34 334 97 HOH HOH A . B 2 HOH 35 335 52 HOH HOH A . B 2 HOH 36 336 12 HOH HOH A . B 2 HOH 37 337 39 HOH HOH A . B 2 HOH 38 338 86 HOH HOH A . B 2 HOH 39 339 45 HOH HOH A . B 2 HOH 40 340 36 HOH HOH A . B 2 HOH 41 341 72 HOH HOH A . B 2 HOH 42 342 13 HOH HOH A . B 2 HOH 43 343 98 HOH HOH A . B 2 HOH 44 344 66 HOH HOH A . B 2 HOH 45 345 71 HOH HOH A . B 2 HOH 46 346 90 HOH HOH A . B 2 HOH 47 347 88 HOH HOH A . B 2 HOH 48 348 73 HOH HOH A . B 2 HOH 49 349 60 HOH HOH A . B 2 HOH 50 350 76 HOH HOH A . B 2 HOH 51 351 81 HOH HOH A . B 2 HOH 52 352 64 HOH HOH A . B 2 HOH 53 353 96 HOH HOH A . B 2 HOH 54 354 85 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 170 ? CE ? A LYS 107 CE 2 1 Y 1 A LYS 170 ? NZ ? A LYS 107 NZ 3 1 Y 1 A GLU 173 ? CD ? A GLU 110 CD 4 1 Y 1 A GLU 173 ? OE1 ? A GLU 110 OE1 5 1 Y 1 A GLU 173 ? OE2 ? A GLU 110 OE2 6 1 Y 1 A TYR 197 ? CG ? A TYR 134 CG 7 1 Y 1 A TYR 197 ? CD1 ? A TYR 134 CD1 8 1 Y 1 A TYR 197 ? CD2 ? A TYR 134 CD2 9 1 Y 1 A TYR 197 ? CE1 ? A TYR 134 CE1 10 1 Y 1 A TYR 197 ? CE2 ? A TYR 134 CE2 11 1 Y 1 A TYR 197 ? CZ ? A TYR 134 CZ 12 1 Y 1 A TYR 197 ? OH ? A TYR 134 OH 13 1 Y 1 A LYS 231 ? CE ? A LYS 168 CE 14 1 Y 1 A LYS 231 ? NZ ? A LYS 168 NZ 15 1 Y 1 A VAL 256 ? CG1 ? A VAL 193 CG1 16 1 Y 1 A VAL 256 ? CG2 ? A VAL 193 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.5.0109 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6KTY _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.811 _cell.length_a_esd ? _cell.length_b 97.811 _cell.length_b_esd ? _cell.length_c 83.057 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6KTY _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KTY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'ammonium sulfate, MES, PEG 400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6KTY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.99 _reflns.d_resolution_low 30.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13863 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.1 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 46.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.99 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 7.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 694 _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.271 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 37.0 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6KTY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.99 _refine.ls_d_res_low 30.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13174 _refine.ls_number_reflns_R_free 682 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.0 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21801 _refine.ls_R_factor_R_free 0.25733 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21593 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1331 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 54 _refine_hist.number_atoms_total 1385 _refine_hist.d_res_high 1.99 _refine_hist.d_res_low 30.00 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.990 _refine_ls_shell.d_res_low 2.041 _refine_ls_shell.number_reflns_R_work 949 _refine_ls_shell.R_factor_R_work 0.247 _refine_ls_shell.percent_reflns_obs 99.61 _refine_ls_shell.R_factor_R_free 0.291 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 60 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _database_PDB_matrix.entry_id 6KTY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 6KTY _struct.title 'Crystal structure of the flagellar cap protein FliD from Bdellovibrio bacteriovorus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KTY _struct_keywords.text 'Bacterial flagellar cap protein, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6MQ71_BDEBA _struct_ref.pdbx_db_accession Q6MQ71 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VDKKFLSGDPNIVDGQVDPGSAIPGDYAIEVVQLAQKPAAMSNGFPDKDQTQIGVGYIKFETPEGTKEVYINGSNSTLDG VMKQINAANVGLKAQVVEDRKDQENPFKLLVSGLSTGNDSQVTFPKIYLLDGDQDMYFEESRKAQNAKVKVDGFEIELPD NKSTDLVPGVTLDFKSAAPGREIRLSVKEN ; _struct_ref.pdbx_align_begin 70 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KTY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 196 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6MQ71 _struct_ref_seq.db_align_beg 70 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 259 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 70 _struct_ref_seq.pdbx_auth_seq_align_end 259 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6KTY GLY A 1 ? UNP Q6MQ71 ? ? 'expression tag' 64 1 1 6KTY SER A 2 ? UNP Q6MQ71 ? ? 'expression tag' 65 2 1 6KTY HIS A 3 ? UNP Q6MQ71 ? ? 'expression tag' 66 3 1 6KTY MET A 4 ? UNP Q6MQ71 ? ? 'expression tag' 67 4 1 6KTY ALA A 5 ? UNP Q6MQ71 ? ? 'expression tag' 68 5 1 6KTY SER A 6 ? UNP Q6MQ71 ? ? 'expression tag' 69 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9110 ? 1 MORE -20 ? 1 'SSA (A^2)' 29160 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support cross-linking _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 78 ? SER A 82 ? ASN A 141 SER A 145 5 ? 5 HELX_P HELX_P2 AA2 THR A 83 ? ASN A 95 ? THR A 146 ASN A 158 1 ? 13 HELX_P HELX_P3 AA3 GLY A 123 ? GLN A 127 ? GLY A 186 GLN A 190 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 12 ? SER A 13 ? LEU A 75 SER A 76 AA1 2 ILE A 189 ? VAL A 193 ? ILE A 252 VAL A 256 AA1 3 GLY A 31 ? GLN A 39 ? GLY A 94 GLN A 102 AA1 4 ALA A 153 ? VAL A 157 ? ALA A 216 VAL A 220 AA1 5 PHE A 160 ? LEU A 164 ? PHE A 223 LEU A 227 AA2 1 VAL A 19 ? GLN A 22 ? VAL A 82 GLN A 85 AA2 2 THR A 177 ? PHE A 180 ? THR A 240 PHE A 243 AA2 3 LYS A 168 ? SER A 169 ? LYS A 231 SER A 232 AA3 1 LEU A 98 ? GLU A 104 ? LEU A 161 GLU A 167 AA3 2 PHE A 113 ? GLY A 119 ? PHE A 176 GLY A 182 AA3 3 ALA A 45 ? SER A 48 ? ALA A 108 SER A 111 AA3 4 PHE A 144 ? ARG A 148 ? PHE A 207 ARG A 211 AA4 1 GLY A 71 ? ILE A 77 ? GLY A 134 ILE A 140 AA4 2 VAL A 61 ? THR A 68 ? VAL A 124 THR A 131 AA4 3 THR A 129 ? LEU A 136 ? THR A 192 LEU A 199 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 12 ? N LEU A 75 O SER A 192 ? O SER A 255 AA1 2 3 O ILE A 189 ? O ILE A 252 N ILE A 35 ? N ILE A 98 AA1 3 4 N GLU A 36 ? N GLU A 99 O LYS A 156 ? O LYS A 219 AA1 4 5 N VAL A 155 ? N VAL A 218 O ILE A 162 ? O ILE A 225 AA2 1 2 N ASP A 20 ? N ASP A 83 O ASP A 179 ? O ASP A 242 AA2 2 3 O LEU A 178 ? O LEU A 241 N SER A 169 ? N SER A 232 AA3 1 2 N VAL A 103 ? N VAL A 166 O LYS A 114 ? O LYS A 177 AA3 2 3 O LEU A 115 ? O LEU A 178 N SER A 48 ? N SER A 111 AA3 3 4 N ALA A 45 ? N ALA A 108 O ARG A 148 ? O ARG A 211 AA4 1 2 O LYS A 73 ? O LYS A 136 N PHE A 66 ? N PHE A 129 AA4 2 3 N TYR A 63 ? N TYR A 126 O TYR A 134 ? O TYR A 197 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 119 ? ? -134.85 -47.22 2 1 ASN A 144 ? ? -152.10 75.98 3 1 ASN A 230 ? ? -93.39 43.79 4 1 ARG A 250 ? ? -119.18 77.69 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 13.7890 10.4620 13.9470 0.1209 0.0819 0.1713 -0.0326 -0.0161 -0.0351 3.4227 1.3905 0.7585 -1.2124 -0.2535 -0.1630 0.1362 -0.0291 0.2945 0.0261 -0.0604 -0.0551 -0.1397 0.0446 -0.0758 'X-RAY DIFFRACTION' 2 ? refined 33.7500 -2.7100 12.5410 0.1094 0.1715 0.0961 -0.0027 -0.0229 -0.0166 4.2350 7.4854 0.7432 -2.7821 -0.1775 -0.0837 -0.0243 0.1457 0.0595 0.1861 -0.0733 -0.5045 0.0507 0.1169 0.0975 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 74 ? ? A 105 ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 186 ? ? A 256 ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 106 ? ? A 185 ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 64 ? A GLY 1 2 1 Y 1 A SER 65 ? A SER 2 3 1 Y 1 A HIS 66 ? A HIS 3 4 1 Y 1 A MET 67 ? A MET 4 5 1 Y 1 A ALA 68 ? A ALA 5 6 1 Y 1 A SER 69 ? A SER 6 7 1 Y 1 A VAL 70 ? A VAL 7 8 1 Y 1 A ASP 71 ? A ASP 8 9 1 Y 1 A LYS 72 ? A LYS 9 10 1 Y 1 A LYS 73 ? A LYS 10 11 1 Y 1 A VAL 86 ? A VAL 23 12 1 Y 1 A ASP 87 ? A ASP 24 13 1 Y 1 A PRO 88 ? A PRO 25 14 1 Y 1 A GLY 89 ? A GLY 26 15 1 Y 1 A SER 90 ? A SER 27 16 1 Y 1 A ALA 91 ? A ALA 28 17 1 Y 1 A ILE 92 ? A ILE 29 18 1 Y 1 A LYS 257 ? A LYS 194 19 1 Y 1 A GLU 258 ? A GLU 195 20 1 Y 1 A ASN 259 ? A ASN 196 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'National Research Foundation (Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number 2019R1A2C1002100 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 6KTY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010224 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010224 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012040 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_