data_6M8F # _entry.id 6M8F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6M8F pdb_00006m8f 10.2210/pdb6m8f/pdb WWPDB D_1000236303 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6M8F _pdbx_database_status.recvd_initial_deposition_date 2018-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bacik, J.P.' 1 0000-0001-9315-5332 'Ando, N.' 2 0000-0001-7062-1644 'Fasan, R.' 3 0000-0003-4636-9578 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Catalysis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2155-5435 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 1514 _citation.page_last 1524 _citation.title 'Origin of high stereocontrol in olefin cyclopropanation catalyzed by an engineered carbene transferase.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acscatal.8b04073 _citation.pdbx_database_id_PubMed 31134138 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tinoco, A.' 1 ? primary 'Wei, Y.' 2 ? primary 'Bacik, J.P.' 3 ? primary 'Carminati, D.M.' 4 ? primary 'Moore, E.J.' 5 ? primary 'Ando, N.' 6 ? primary 'Zhang, Y.' 7 ? primary 'Fasan, R.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6M8F _cell.details ? _cell.formula_units_Z ? _cell.length_a 90.780 _cell.length_a_esd ? _cell.length_b 90.780 _cell.length_b_esd ? _cell.length_c 45.580 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6M8F _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Myoglobin 17298.094 1 ? ? ? ? 2 branched man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose' 342.297 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 5 water nat water 18.015 224 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name sucrose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKVGVTALTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKVGVTALTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LEU n 1 4 SER n 1 5 GLU n 1 6 GLY n 1 7 GLU n 1 8 TRP n 1 9 GLN n 1 10 LEU n 1 11 VAL n 1 12 LEU n 1 13 HIS n 1 14 VAL n 1 15 TRP n 1 16 ALA n 1 17 LYS n 1 18 VAL n 1 19 GLU n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 ALA n 1 24 GLY n 1 25 HIS n 1 26 GLY n 1 27 GLN n 1 28 ASP n 1 29 ILE n 1 30 LEU n 1 31 ILE n 1 32 ARG n 1 33 LEU n 1 34 PHE n 1 35 LYS n 1 36 SER n 1 37 HIS n 1 38 PRO n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 GLU n 1 43 LYS n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 PHE n 1 48 LYS n 1 49 HIS n 1 50 LEU n 1 51 LYS n 1 52 THR n 1 53 GLU n 1 54 ALA n 1 55 GLU n 1 56 MET n 1 57 LYS n 1 58 ALA n 1 59 SER n 1 60 GLU n 1 61 ASP n 1 62 LEU n 1 63 LYS n 1 64 LYS n 1 65 VAL n 1 66 GLY n 1 67 VAL n 1 68 THR n 1 69 ALA n 1 70 LEU n 1 71 THR n 1 72 ALA n 1 73 LEU n 1 74 GLY n 1 75 ALA n 1 76 ILE n 1 77 LEU n 1 78 LYS n 1 79 LYS n 1 80 LYS n 1 81 GLY n 1 82 HIS n 1 83 HIS n 1 84 GLU n 1 85 ALA n 1 86 GLU n 1 87 LEU n 1 88 LYS n 1 89 PRO n 1 90 LEU n 1 91 ALA n 1 92 GLN n 1 93 SER n 1 94 HIS n 1 95 ALA n 1 96 THR n 1 97 LYS n 1 98 HIS n 1 99 LYS n 1 100 ILE n 1 101 PRO n 1 102 ILE n 1 103 LYS n 1 104 TYR n 1 105 LEU n 1 106 GLU n 1 107 PHE n 1 108 ILE n 1 109 SER n 1 110 GLU n 1 111 ALA n 1 112 ILE n 1 113 ILE n 1 114 HIS n 1 115 VAL n 1 116 LEU n 1 117 HIS n 1 118 SER n 1 119 ARG n 1 120 HIS n 1 121 PRO n 1 122 GLY n 1 123 ASN n 1 124 PHE n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 ALA n 1 129 GLN n 1 130 GLY n 1 131 ALA n 1 132 MET n 1 133 ASN n 1 134 LYS n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 LEU n 1 139 PHE n 1 140 ARG n 1 141 LYS n 1 142 ASP n 1 143 ILE n 1 144 ALA n 1 145 ALA n 1 146 LYS n 1 147 TYR n 1 148 LYS n 1 149 GLU n 1 150 LEU n 1 151 GLY n 1 152 TYR n 1 153 GLN n 1 154 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 154 _entity_src_gen.gene_src_common_name 'Sperm whale' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCD _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6M8F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6M8F VAL A 65 ? UNP P02185 HIS 65 conflict 64 1 1 6M8F ALA A 69 ? UNP P02185 VAL 69 conflict 68 2 1 6M8F ASN A 123 ? UNP P02185 ASP 123 conflict 122 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FRU 'D-saccharide, beta linking' . beta-D-fructofuranose 'beta-D-fructose; D-fructose; fructose' 'C6 H12 O6' 180.156 GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose 'alpha-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6M8F _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;A crystal was grown by mixing 1 ul of reservoir buffer (2 M ammonium sulfate, 0.2 M Tris pH 8.6) with 1 ul of protein in buffer (20 mM Tris pH 8.0, 1 mM EDTA). The crystal was cryoprotected by soaking it in a drop containing reservoir buffer supplemented with 25% sucrose for 5 minutes prior to being flash-cooled in liquid nitrogen ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-06-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9768 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9768 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6M8F _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.10 _reflns.d_resolution_low 39.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 76057 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 87.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.3 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.10 _reflns_shell.d_res_low 1.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5028 _reflns_shell.percent_possible_all 40.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.448 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.407 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.617 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6M8F _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.100 _refine.ls_d_res_low 32.163 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 76038 _refine.ls_number_reflns_R_free 3765 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 87.53 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1273 _refine.ls_R_factor_R_free 0.1458 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1263 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1JW8 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 14.27 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.07 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1216 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 81 _refine_hist.number_atoms_solvent 224 _refine_hist.number_atoms_total 1521 _refine_hist.d_res_high 1.100 _refine_hist.d_res_low 32.163 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1408 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.134 ? 1919 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 29.707 ? 524 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.076 ? 203 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 230 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.1000 1.1139 . . 35 595 20.00 . . . 0.3356 . 0.3220 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1139 1.1286 . . 48 1107 36.00 . . . 0.3029 . 0.2753 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1286 1.1441 . . 67 1433 47.00 . . . 0.2604 . 0.2685 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1441 1.1604 . . 97 1735 58.00 . . . 0.2407 . 0.2331 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1604 1.1777 . . 125 2072 68.00 . . . 0.2374 . 0.2130 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1777 1.1961 . . 115 2286 75.00 . . . 0.2226 . 0.1954 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1961 1.2157 . . 111 2479 82.00 . . . 0.2123 . 0.1877 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2157 1.2367 . . 145 2667 87.00 . . . 0.2217 . 0.1717 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2367 1.2592 . . 171 2840 94.00 . . . 0.2009 . 0.1569 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2592 1.2834 . . 159 2978 98.00 . . . 0.1482 . 0.1352 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2834 1.3096 . . 134 2989 98.00 . . . 0.1589 . 0.1275 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3096 1.3381 . . 165 3059 100.00 . . . 0.1485 . 0.1179 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3381 1.3692 . . 156 3040 100.00 . . . 0.1224 . 0.1107 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3692 1.4035 . . 127 3069 100.00 . . . 0.1375 . 0.1112 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4035 1.4414 . . 141 3072 100.00 . . . 0.1181 . 0.1128 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4414 1.4838 . . 149 3047 100.00 . . . 0.1132 . 0.1066 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4838 1.5317 . . 161 3072 100.00 . . . 0.1426 . 0.0990 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5317 1.5865 . . 139 3082 100.00 . . . 0.1158 . 0.1006 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5865 1.6500 . . 190 3012 100.00 . . . 0.1169 . 0.1084 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6500 1.7251 . . 148 3065 100.00 . . . 0.1381 . 0.1068 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7251 1.8160 . . 150 3098 100.00 . . . 0.1461 . 0.1104 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8160 1.9298 . . 159 3042 100.00 . . . 0.1221 . 0.1105 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9298 2.0788 . . 172 3063 100.00 . . . 0.1207 . 0.1149 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0788 2.2879 . . 151 3077 100.00 . . . 0.1247 . 0.1059 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2879 2.6188 . . 183 3056 100.00 . . . 0.1311 . 0.1131 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6188 3.2989 . . 209 3063 100.00 . . . 0.1513 . 0.1291 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2989 32.1765 . . 158 3175 100.00 . . . 0.1612 . 0.1434 . . . . . . . . . . # _struct.entry_id 6M8F _struct.title 'Engineered sperm whale myoglobin-based carbene transferase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6M8F _struct_keywords.text 'Metalloprotein, myoglobin, carbene transferase, cyclopropanation, heme, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 3 ? F N N 3 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? GLU A 19 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 AA2 ASP A 21 ? HIS A 37 ? ASP A 20 HIS A 36 1 ? 17 HELX_P HELX_P3 AA3 PRO A 38 ? PHE A 44 ? PRO A 37 PHE A 43 5 ? 7 HELX_P HELX_P4 AA4 THR A 52 ? SER A 59 ? THR A 51 SER A 58 1 ? 8 HELX_P HELX_P5 AA5 SER A 59 ? LYS A 79 ? SER A 58 LYS A 78 1 ? 21 HELX_P HELX_P6 AA6 HIS A 83 ? LYS A 97 ? HIS A 82 LYS A 96 1 ? 15 HELX_P HELX_P7 AA7 PRO A 101 ? HIS A 120 ? PRO A 100 HIS A 119 1 ? 20 HELX_P HELX_P8 AA8 PRO A 121 ? PHE A 124 ? PRO A 120 PHE A 123 5 ? 4 HELX_P HELX_P9 AA9 GLY A 125 ? LEU A 150 ? GLY A 124 LEU A 149 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GLC . C1 ? ? ? 1_555 B FRU . O2 ? ? B GLC 1 B FRU 2 1_555 ? ? ? ? ? ? ? 1.422 sing ? metalc1 metalc ? ? A HIS 94 NE2 ? ? ? 1_555 D HEM . FE ? ? A HIS 93 A HEM 202 1_555 ? ? ? ? ? ? ? 2.112 ? ? metalc2 metalc ? ? D HEM . FE ? ? ? 1_555 G HOH . O ? ? A HEM 202 A HOH 395 1_555 ? ? ? ? ? ? ? 2.164 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _atom_sites.entry_id 6M8F _atom_sites.fract_transf_matrix[1][1] 0.011016 _atom_sites.fract_transf_matrix[1][2] 0.006360 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012720 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021939 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLY 6 5 5 GLY GLY A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 GLN 9 8 8 GLN GLN A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 HIS 13 12 12 HIS HIS A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 TRP 15 14 14 TRP TRP A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 ILE 29 28 28 ILE ILE A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 PHE 34 33 33 PHE PHE A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 PRO 38 37 37 PRO PRO A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 HIS 49 48 48 HIS HIS A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 MET 56 55 55 MET MET A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 SER 59 58 58 SER SER A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 GLY 66 65 65 GLY GLY A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 LYS 80 79 79 LYS LYS A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 HIS 82 81 81 HIS HIS A . n A 1 83 HIS 83 82 82 HIS HIS A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 GLN 92 91 91 GLN GLN A . n A 1 93 SER 93 92 92 SER SER A . n A 1 94 HIS 94 93 93 HIS HIS A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 THR 96 95 95 THR THR A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 HIS 98 97 97 HIS HIS A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 PRO 101 100 100 PRO PRO A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 TYR 104 103 103 TYR TYR A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 GLU 106 105 105 GLU GLU A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 SER 109 108 108 SER SER A . n A 1 110 GLU 110 109 109 GLU GLU A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 HIS 114 113 113 HIS HIS A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 HIS 117 116 116 HIS HIS A . n A 1 118 SER 118 117 117 SER SER A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 HIS 120 119 119 HIS HIS A . n A 1 121 PRO 121 120 120 PRO PRO A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 ASN 123 122 122 ASN ASN A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 GLY 125 124 124 GLY GLY A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 ALA 128 127 127 ALA ALA A . n A 1 129 GLN 129 128 128 GLN GLN A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 MET 132 131 131 MET MET A . n A 1 133 ASN 133 132 132 ASN ASN A . n A 1 134 LYS 134 133 133 LYS LYS A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 LEU 136 135 135 LEU LEU A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 PHE 139 138 138 PHE PHE A . n A 1 140 ARG 140 139 139 ARG ARG A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 TYR 152 151 151 TYR TYR A . n A 1 153 GLN 153 152 152 GLN GLN A . n A 1 154 GLY 154 153 153 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 201 159 SO4 SO4 A . D 4 HEM 1 202 155 HEM HEM A . E 3 SO4 1 203 1 SO4 SO4 A . F 3 SO4 1 204 2 SO4 SO4 A . G 5 HOH 1 301 165 HOH HOH A . G 5 HOH 2 302 98 HOH HOH A . G 5 HOH 3 303 179 HOH HOH A . G 5 HOH 4 304 142 HOH HOH A . G 5 HOH 5 305 118 HOH HOH A . G 5 HOH 6 306 102 HOH HOH A . G 5 HOH 7 307 174 HOH HOH A . G 5 HOH 8 308 175 HOH HOH A . G 5 HOH 9 309 256 HOH HOH A . G 5 HOH 10 310 187 HOH HOH A . G 5 HOH 11 311 152 HOH HOH A . G 5 HOH 12 312 81 HOH HOH A . G 5 HOH 13 313 111 HOH HOH A . G 5 HOH 14 314 129 HOH HOH A . G 5 HOH 15 315 74 HOH HOH A . G 5 HOH 16 316 36 HOH HOH A . G 5 HOH 17 317 154 HOH HOH A . G 5 HOH 18 318 92 HOH HOH A . G 5 HOH 19 319 257 HOH HOH A . G 5 HOH 20 320 114 HOH HOH A . G 5 HOH 21 321 236 HOH HOH A . G 5 HOH 22 322 181 HOH HOH A . G 5 HOH 23 323 69 HOH HOH A . G 5 HOH 24 324 76 HOH HOH A . G 5 HOH 25 325 93 HOH HOH A . G 5 HOH 26 326 26 HOH HOH A . G 5 HOH 27 327 124 HOH HOH A . G 5 HOH 28 328 75 HOH HOH A . G 5 HOH 29 329 198 HOH HOH A . G 5 HOH 30 330 97 HOH HOH A . G 5 HOH 31 331 4 HOH HOH A . G 5 HOH 32 332 131 HOH HOH A . G 5 HOH 33 333 91 HOH HOH A . G 5 HOH 34 334 251 HOH HOH A . G 5 HOH 35 335 186 HOH HOH A . G 5 HOH 36 336 40 HOH HOH A . G 5 HOH 37 337 21 HOH HOH A . G 5 HOH 38 338 45 HOH HOH A . G 5 HOH 39 339 29 HOH HOH A . G 5 HOH 40 340 15 HOH HOH A . G 5 HOH 41 341 116 HOH HOH A . G 5 HOH 42 342 77 HOH HOH A . G 5 HOH 43 343 79 HOH HOH A . G 5 HOH 44 344 57 HOH HOH A . G 5 HOH 45 345 155 HOH HOH A . G 5 HOH 46 346 18 HOH HOH A . G 5 HOH 47 347 32 HOH HOH A . G 5 HOH 48 348 163 HOH HOH A . G 5 HOH 49 349 240 HOH HOH A . G 5 HOH 50 350 218 HOH HOH A . G 5 HOH 51 351 41 HOH HOH A . G 5 HOH 52 352 246 HOH HOH A . G 5 HOH 53 353 43 HOH HOH A . G 5 HOH 54 354 46 HOH HOH A . G 5 HOH 55 355 90 HOH HOH A . G 5 HOH 56 356 51 HOH HOH A . G 5 HOH 57 357 137 HOH HOH A . G 5 HOH 58 358 8 HOH HOH A . G 5 HOH 59 359 19 HOH HOH A . G 5 HOH 60 360 1 HOH HOH A . G 5 HOH 61 361 11 HOH HOH A . G 5 HOH 62 362 20 HOH HOH A . G 5 HOH 63 363 67 HOH HOH A . G 5 HOH 64 364 33 HOH HOH A . G 5 HOH 65 365 192 HOH HOH A . G 5 HOH 66 366 6 HOH HOH A . G 5 HOH 67 367 133 HOH HOH A . G 5 HOH 68 368 31 HOH HOH A . G 5 HOH 69 369 48 HOH HOH A . G 5 HOH 70 370 103 HOH HOH A . G 5 HOH 71 371 65 HOH HOH A . G 5 HOH 72 372 7 HOH HOH A . G 5 HOH 73 373 5 HOH HOH A . G 5 HOH 74 374 2 HOH HOH A . G 5 HOH 75 375 37 HOH HOH A . G 5 HOH 76 376 22 HOH HOH A . G 5 HOH 77 377 54 HOH HOH A . G 5 HOH 78 378 86 HOH HOH A . G 5 HOH 79 379 60 HOH HOH A . G 5 HOH 80 380 139 HOH HOH A . G 5 HOH 81 381 55 HOH HOH A . G 5 HOH 82 382 71 HOH HOH A . G 5 HOH 83 383 144 HOH HOH A . G 5 HOH 84 384 39 HOH HOH A . G 5 HOH 85 385 127 HOH HOH A . G 5 HOH 86 386 184 HOH HOH A . G 5 HOH 87 387 53 HOH HOH A . G 5 HOH 88 388 85 HOH HOH A . G 5 HOH 89 389 151 HOH HOH A . G 5 HOH 90 390 206 HOH HOH A . G 5 HOH 91 391 101 HOH HOH A . G 5 HOH 92 392 231 HOH HOH A . G 5 HOH 93 393 58 HOH HOH A . G 5 HOH 94 394 12 HOH HOH A . G 5 HOH 95 395 158 HOH HOH A . G 5 HOH 96 396 100 HOH HOH A . G 5 HOH 97 397 113 HOH HOH A . G 5 HOH 98 398 159 HOH HOH A . G 5 HOH 99 399 66 HOH HOH A . G 5 HOH 100 400 125 HOH HOH A . G 5 HOH 101 401 14 HOH HOH A . G 5 HOH 102 402 24 HOH HOH A . G 5 HOH 103 403 132 HOH HOH A . G 5 HOH 104 404 225 HOH HOH A . G 5 HOH 105 405 89 HOH HOH A . G 5 HOH 106 406 255 HOH HOH A . G 5 HOH 107 407 3 HOH HOH A . G 5 HOH 108 408 188 HOH HOH A . G 5 HOH 109 409 112 HOH HOH A . G 5 HOH 110 410 25 HOH HOH A . G 5 HOH 111 411 42 HOH HOH A . G 5 HOH 112 412 172 HOH HOH A . G 5 HOH 113 413 83 HOH HOH A . G 5 HOH 114 414 195 HOH HOH A . G 5 HOH 115 415 99 HOH HOH A . G 5 HOH 116 416 84 HOH HOH A . G 5 HOH 117 417 135 HOH HOH A . G 5 HOH 118 418 44 HOH HOH A . G 5 HOH 119 419 205 HOH HOH A . G 5 HOH 120 420 52 HOH HOH A . G 5 HOH 121 421 35 HOH HOH A . G 5 HOH 122 422 73 HOH HOH A . G 5 HOH 123 423 34 HOH HOH A . G 5 HOH 124 424 62 HOH HOH A . G 5 HOH 125 425 50 HOH HOH A . G 5 HOH 126 426 180 HOH HOH A . G 5 HOH 127 427 68 HOH HOH A . G 5 HOH 128 428 87 HOH HOH A . G 5 HOH 129 429 59 HOH HOH A . G 5 HOH 130 430 238 HOH HOH A . G 5 HOH 131 431 252 HOH HOH A . G 5 HOH 132 432 220 HOH HOH A . G 5 HOH 133 433 204 HOH HOH A . G 5 HOH 134 434 123 HOH HOH A . G 5 HOH 135 435 161 HOH HOH A . G 5 HOH 136 436 190 HOH HOH A . G 5 HOH 137 437 10 HOH HOH A . G 5 HOH 138 438 221 HOH HOH A . G 5 HOH 139 439 226 HOH HOH A . G 5 HOH 140 440 177 HOH HOH A . G 5 HOH 141 441 223 HOH HOH A . G 5 HOH 142 442 183 HOH HOH A . G 5 HOH 143 443 17 HOH HOH A . G 5 HOH 144 444 27 HOH HOH A . G 5 HOH 145 445 185 HOH HOH A . G 5 HOH 146 446 234 HOH HOH A . G 5 HOH 147 447 241 HOH HOH A . G 5 HOH 148 448 217 HOH HOH A . G 5 HOH 149 449 107 HOH HOH A . G 5 HOH 150 450 104 HOH HOH A . G 5 HOH 151 451 134 HOH HOH A . G 5 HOH 152 452 13 HOH HOH A . G 5 HOH 153 453 143 HOH HOH A . G 5 HOH 154 454 227 HOH HOH A . G 5 HOH 155 455 250 HOH HOH A . G 5 HOH 156 456 122 HOH HOH A . G 5 HOH 157 457 64 HOH HOH A . G 5 HOH 158 458 237 HOH HOH A . G 5 HOH 159 459 56 HOH HOH A . G 5 HOH 160 460 167 HOH HOH A . G 5 HOH 161 461 168 HOH HOH A . G 5 HOH 162 462 202 HOH HOH A . G 5 HOH 163 463 191 HOH HOH A . G 5 HOH 164 464 9 HOH HOH A . G 5 HOH 165 465 16 HOH HOH A . G 5 HOH 166 466 30 HOH HOH A . G 5 HOH 167 467 88 HOH HOH A . G 5 HOH 168 468 128 HOH HOH A . G 5 HOH 169 469 208 HOH HOH A . G 5 HOH 170 470 119 HOH HOH A . G 5 HOH 171 471 229 HOH HOH A . G 5 HOH 172 472 150 HOH HOH A . G 5 HOH 173 473 193 HOH HOH A . G 5 HOH 174 474 244 HOH HOH A . G 5 HOH 175 475 61 HOH HOH A . G 5 HOH 176 476 157 HOH HOH A . G 5 HOH 177 477 115 HOH HOH A . G 5 HOH 178 478 199 HOH HOH A . G 5 HOH 179 479 47 HOH HOH A . G 5 HOH 180 480 160 HOH HOH A . G 5 HOH 181 481 72 HOH HOH A . G 5 HOH 182 482 23 HOH HOH A . G 5 HOH 183 483 149 HOH HOH A . G 5 HOH 184 484 239 HOH HOH A . G 5 HOH 185 485 121 HOH HOH A . G 5 HOH 186 486 216 HOH HOH A . G 5 HOH 187 487 153 HOH HOH A . G 5 HOH 188 488 106 HOH HOH A . G 5 HOH 189 489 138 HOH HOH A . G 5 HOH 190 490 228 HOH HOH A . G 5 HOH 191 491 207 HOH HOH A . G 5 HOH 192 492 254 HOH HOH A . G 5 HOH 193 493 70 HOH HOH A . G 5 HOH 194 494 164 HOH HOH A . G 5 HOH 195 495 110 HOH HOH A . G 5 HOH 196 496 200 HOH HOH A . G 5 HOH 197 497 49 HOH HOH A . G 5 HOH 198 498 80 HOH HOH A . G 5 HOH 199 499 210 HOH HOH A . G 5 HOH 200 500 156 HOH HOH A . G 5 HOH 201 501 245 HOH HOH A . G 5 HOH 202 502 197 HOH HOH A . G 5 HOH 203 503 130 HOH HOH A . G 5 HOH 204 504 222 HOH HOH A . G 5 HOH 205 505 194 HOH HOH A . G 5 HOH 206 506 147 HOH HOH A . G 5 HOH 207 507 219 HOH HOH A . G 5 HOH 208 508 201 HOH HOH A . G 5 HOH 209 509 242 HOH HOH A . G 5 HOH 210 510 253 HOH HOH A . G 5 HOH 211 511 209 HOH HOH A . G 5 HOH 212 512 109 HOH HOH A . G 5 HOH 213 513 105 HOH HOH A . G 5 HOH 214 514 196 HOH HOH A . G 5 HOH 215 515 95 HOH HOH A . G 5 HOH 216 516 182 HOH HOH A . G 5 HOH 217 517 141 HOH HOH A . G 5 HOH 218 518 78 HOH HOH A . G 5 HOH 219 519 117 HOH HOH A . G 5 HOH 220 520 38 HOH HOH A . G 5 HOH 221 521 214 HOH HOH A . G 5 HOH 222 522 213 HOH HOH A . G 5 HOH 223 523 96 HOH HOH A . G 5 HOH 224 524 146 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900003 _pdbx_molecule_features.name sucrose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Nutrient _pdbx_molecule_features.details 'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900003 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 492 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NA ? D HEM . ? A HEM 202 ? 1_555 90.3 ? 2 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NB ? D HEM . ? A HEM 202 ? 1_555 91.2 ? 3 NA ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NB ? D HEM . ? A HEM 202 ? 1_555 89.5 ? 4 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NC ? D HEM . ? A HEM 202 ? 1_555 94.3 ? 5 NA ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NC ? D HEM . ? A HEM 202 ? 1_555 175.4 ? 6 NB ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NC ? D HEM . ? A HEM 202 ? 1_555 89.9 ? 7 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 93.6 ? 8 NA ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 90.4 ? 9 NB ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 175.1 ? 10 NC ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 89.8 ? 11 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O ? G HOH . ? A HOH 395 ? 1_555 176.8 ? 12 NA ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O ? G HOH . ? A HOH 395 ? 1_555 86.5 ? 13 NB ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O ? G HOH . ? A HOH 395 ? 1_555 89.4 ? 14 NC ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O ? G HOH . ? A HOH 395 ? 1_555 88.9 ? 15 ND ? D HEM . ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O ? G HOH . ? A HOH 395 ? 1_555 85.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-23 2 'Structure model' 1 1 2019-06-12 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2023-10-11 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Non-polymer description' 7 3 'Structure model' 'Structure summary' 8 4 'Structure model' 'Data collection' 9 4 'Structure model' 'Database references' 10 4 'Structure model' 'Refinement description' 11 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_site 3 3 'Structure model' atom_site_anisotrop 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' entity_name_com 7 3 'Structure model' pdbx_branch_scheme 8 3 'Structure model' pdbx_chem_comp_identifier 9 3 'Structure model' pdbx_entity_branch 10 3 'Structure model' pdbx_entity_branch_descriptor 11 3 'Structure model' pdbx_entity_branch_link 12 3 'Structure model' pdbx_entity_branch_list 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' pdbx_molecule_features 15 3 'Structure model' pdbx_nonpoly_scheme 16 3 'Structure model' pdbx_struct_conn_angle 17 3 'Structure model' struct_asym 18 3 'Structure model' struct_conn 19 3 'Structure model' struct_conn_type 20 3 'Structure model' struct_site 21 3 'Structure model' struct_site_gen 22 4 'Structure model' chem_comp 23 4 'Structure model' chem_comp_atom 24 4 'Structure model' chem_comp_bond 25 4 'Structure model' database_2 26 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_atom_site.B_iso_or_equiv' 13 3 'Structure model' '_atom_site.Cartn_x' 14 3 'Structure model' '_atom_site.Cartn_y' 15 3 'Structure model' '_atom_site.Cartn_z' 16 3 'Structure model' '_atom_site.auth_asym_id' 17 3 'Structure model' '_atom_site.auth_atom_id' 18 3 'Structure model' '_atom_site.auth_comp_id' 19 3 'Structure model' '_atom_site.auth_seq_id' 20 3 'Structure model' '_atom_site.label_asym_id' 21 3 'Structure model' '_atom_site.label_atom_id' 22 3 'Structure model' '_atom_site.label_comp_id' 23 3 'Structure model' '_atom_site.label_entity_id' 24 3 'Structure model' '_atom_site.type_symbol' 25 3 'Structure model' '_atom_site_anisotrop.id' 26 3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 27 3 'Structure model' '_chem_comp.formula' 28 3 'Structure model' '_chem_comp.formula_weight' 29 3 'Structure model' '_chem_comp.id' 30 3 'Structure model' '_chem_comp.mon_nstd_flag' 31 3 'Structure model' '_chem_comp.name' 32 3 'Structure model' '_chem_comp.pdbx_synonyms' 33 3 'Structure model' '_chem_comp.type' 34 3 'Structure model' '_entity.formula_weight' 35 3 'Structure model' '_entity.pdbx_description' 36 3 'Structure model' '_entity.pdbx_number_of_molecules' 37 3 'Structure model' '_entity.src_method' 38 3 'Structure model' '_entity.type' 39 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 40 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 41 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 42 3 'Structure model' '_struct_asym.entity_id' 43 4 'Structure model' '_chem_comp.pdbx_synonyms' 44 4 'Structure model' '_database_2.pdbx_DOI' 45 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -157.08 73.81 2 1 PHE A 46 ? ? -144.59 26.83 3 1 LYS A 98 ? ? 61.94 61.85 4 1 PHE A 123 ? ? -141.46 49.78 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 523 ? 6.46 . 2 1 O ? A HOH 524 ? 6.55 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 102 ? CG ? A LYS 103 CG 2 1 Y 1 A LYS 102 ? CD ? A LYS 103 CD 3 1 Y 1 A LYS 102 ? CE ? A LYS 103 CE 4 1 Y 1 A LYS 102 ? NZ ? A LYS 103 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 FRU C1 C N N 74 FRU C2 C N R 75 FRU C3 C N S 76 FRU C4 C N S 77 FRU C5 C N R 78 FRU C6 C N N 79 FRU O1 O N N 80 FRU O2 O N N 81 FRU O3 O N N 82 FRU O4 O N N 83 FRU O5 O N N 84 FRU O6 O N N 85 FRU H11 H N N 86 FRU H12 H N N 87 FRU H3 H N N 88 FRU H4 H N N 89 FRU H5 H N N 90 FRU H61 H N N 91 FRU H62 H N N 92 FRU HO1 H N N 93 FRU HO2 H N N 94 FRU HO3 H N N 95 FRU HO4 H N N 96 FRU HO6 H N N 97 GLC C1 C N S 98 GLC C2 C N R 99 GLC C3 C N S 100 GLC C4 C N S 101 GLC C5 C N R 102 GLC C6 C N N 103 GLC O1 O N N 104 GLC O2 O N N 105 GLC O3 O N N 106 GLC O4 O N N 107 GLC O5 O N N 108 GLC O6 O N N 109 GLC H1 H N N 110 GLC H2 H N N 111 GLC H3 H N N 112 GLC H4 H N N 113 GLC H5 H N N 114 GLC H61 H N N 115 GLC H62 H N N 116 GLC HO1 H N N 117 GLC HO2 H N N 118 GLC HO3 H N N 119 GLC HO4 H N N 120 GLC HO6 H N N 121 GLN N N N N 122 GLN CA C N S 123 GLN C C N N 124 GLN O O N N 125 GLN CB C N N 126 GLN CG C N N 127 GLN CD C N N 128 GLN OE1 O N N 129 GLN NE2 N N N 130 GLN OXT O N N 131 GLN H H N N 132 GLN H2 H N N 133 GLN HA H N N 134 GLN HB2 H N N 135 GLN HB3 H N N 136 GLN HG2 H N N 137 GLN HG3 H N N 138 GLN HE21 H N N 139 GLN HE22 H N N 140 GLN HXT H N N 141 GLU N N N N 142 GLU CA C N S 143 GLU C C N N 144 GLU O O N N 145 GLU CB C N N 146 GLU CG C N N 147 GLU CD C N N 148 GLU OE1 O N N 149 GLU OE2 O N N 150 GLU OXT O N N 151 GLU H H N N 152 GLU H2 H N N 153 GLU HA H N N 154 GLU HB2 H N N 155 GLU HB3 H N N 156 GLU HG2 H N N 157 GLU HG3 H N N 158 GLU HE2 H N N 159 GLU HXT H N N 160 GLY N N N N 161 GLY CA C N N 162 GLY C C N N 163 GLY O O N N 164 GLY OXT O N N 165 GLY H H N N 166 GLY H2 H N N 167 GLY HA2 H N N 168 GLY HA3 H N N 169 GLY HXT H N N 170 HEM CHA C N N 171 HEM CHB C N N 172 HEM CHC C N N 173 HEM CHD C N N 174 HEM C1A C Y N 175 HEM C2A C Y N 176 HEM C3A C Y N 177 HEM C4A C Y N 178 HEM CMA C N N 179 HEM CAA C N N 180 HEM CBA C N N 181 HEM CGA C N N 182 HEM O1A O N N 183 HEM O2A O N N 184 HEM C1B C N N 185 HEM C2B C N N 186 HEM C3B C N N 187 HEM C4B C N N 188 HEM CMB C N N 189 HEM CAB C N N 190 HEM CBB C N N 191 HEM C1C C Y N 192 HEM C2C C Y N 193 HEM C3C C Y N 194 HEM C4C C Y N 195 HEM CMC C N N 196 HEM CAC C N N 197 HEM CBC C N N 198 HEM C1D C N N 199 HEM C2D C N N 200 HEM C3D C N N 201 HEM C4D C N N 202 HEM CMD C N N 203 HEM CAD C N N 204 HEM CBD C N N 205 HEM CGD C N N 206 HEM O1D O N N 207 HEM O2D O N N 208 HEM NA N Y N 209 HEM NB N N N 210 HEM NC N Y N 211 HEM ND N N N 212 HEM FE FE N N 213 HEM HHB H N N 214 HEM HHC H N N 215 HEM HHD H N N 216 HEM HMA H N N 217 HEM HMAA H N N 218 HEM HMAB H N N 219 HEM HAA H N N 220 HEM HAAA H N N 221 HEM HBA H N N 222 HEM HBAA H N N 223 HEM HMB H N N 224 HEM HMBA H N N 225 HEM HMBB H N N 226 HEM HAB H N N 227 HEM HBB H N N 228 HEM HBBA H N N 229 HEM HMC H N N 230 HEM HMCA H N N 231 HEM HMCB H N N 232 HEM HAC H N N 233 HEM HBC H N N 234 HEM HBCA H N N 235 HEM HMD H N N 236 HEM HMDA H N N 237 HEM HMDB H N N 238 HEM HAD H N N 239 HEM HADA H N N 240 HEM HBD H N N 241 HEM HBDA H N N 242 HEM H2A H N N 243 HEM H2D H N N 244 HEM HHA H N N 245 HIS N N N N 246 HIS CA C N S 247 HIS C C N N 248 HIS O O N N 249 HIS CB C N N 250 HIS CG C Y N 251 HIS ND1 N Y N 252 HIS CD2 C Y N 253 HIS CE1 C Y N 254 HIS NE2 N Y N 255 HIS OXT O N N 256 HIS H H N N 257 HIS H2 H N N 258 HIS HA H N N 259 HIS HB2 H N N 260 HIS HB3 H N N 261 HIS HD1 H N N 262 HIS HD2 H N N 263 HIS HE1 H N N 264 HIS HE2 H N N 265 HIS HXT H N N 266 HOH O O N N 267 HOH H1 H N N 268 HOH H2 H N N 269 ILE N N N N 270 ILE CA C N S 271 ILE C C N N 272 ILE O O N N 273 ILE CB C N S 274 ILE CG1 C N N 275 ILE CG2 C N N 276 ILE CD1 C N N 277 ILE OXT O N N 278 ILE H H N N 279 ILE H2 H N N 280 ILE HA H N N 281 ILE HB H N N 282 ILE HG12 H N N 283 ILE HG13 H N N 284 ILE HG21 H N N 285 ILE HG22 H N N 286 ILE HG23 H N N 287 ILE HD11 H N N 288 ILE HD12 H N N 289 ILE HD13 H N N 290 ILE HXT H N N 291 LEU N N N N 292 LEU CA C N S 293 LEU C C N N 294 LEU O O N N 295 LEU CB C N N 296 LEU CG C N N 297 LEU CD1 C N N 298 LEU CD2 C N N 299 LEU OXT O N N 300 LEU H H N N 301 LEU H2 H N N 302 LEU HA H N N 303 LEU HB2 H N N 304 LEU HB3 H N N 305 LEU HG H N N 306 LEU HD11 H N N 307 LEU HD12 H N N 308 LEU HD13 H N N 309 LEU HD21 H N N 310 LEU HD22 H N N 311 LEU HD23 H N N 312 LEU HXT H N N 313 LYS N N N N 314 LYS CA C N S 315 LYS C C N N 316 LYS O O N N 317 LYS CB C N N 318 LYS CG C N N 319 LYS CD C N N 320 LYS CE C N N 321 LYS NZ N N N 322 LYS OXT O N N 323 LYS H H N N 324 LYS H2 H N N 325 LYS HA H N N 326 LYS HB2 H N N 327 LYS HB3 H N N 328 LYS HG2 H N N 329 LYS HG3 H N N 330 LYS HD2 H N N 331 LYS HD3 H N N 332 LYS HE2 H N N 333 LYS HE3 H N N 334 LYS HZ1 H N N 335 LYS HZ2 H N N 336 LYS HZ3 H N N 337 LYS HXT H N N 338 MET N N N N 339 MET CA C N S 340 MET C C N N 341 MET O O N N 342 MET CB C N N 343 MET CG C N N 344 MET SD S N N 345 MET CE C N N 346 MET OXT O N N 347 MET H H N N 348 MET H2 H N N 349 MET HA H N N 350 MET HB2 H N N 351 MET HB3 H N N 352 MET HG2 H N N 353 MET HG3 H N N 354 MET HE1 H N N 355 MET HE2 H N N 356 MET HE3 H N N 357 MET HXT H N N 358 PHE N N N N 359 PHE CA C N S 360 PHE C C N N 361 PHE O O N N 362 PHE CB C N N 363 PHE CG C Y N 364 PHE CD1 C Y N 365 PHE CD2 C Y N 366 PHE CE1 C Y N 367 PHE CE2 C Y N 368 PHE CZ C Y N 369 PHE OXT O N N 370 PHE H H N N 371 PHE H2 H N N 372 PHE HA H N N 373 PHE HB2 H N N 374 PHE HB3 H N N 375 PHE HD1 H N N 376 PHE HD2 H N N 377 PHE HE1 H N N 378 PHE HE2 H N N 379 PHE HZ H N N 380 PHE HXT H N N 381 PRO N N N N 382 PRO CA C N S 383 PRO C C N N 384 PRO O O N N 385 PRO CB C N N 386 PRO CG C N N 387 PRO CD C N N 388 PRO OXT O N N 389 PRO H H N N 390 PRO HA H N N 391 PRO HB2 H N N 392 PRO HB3 H N N 393 PRO HG2 H N N 394 PRO HG3 H N N 395 PRO HD2 H N N 396 PRO HD3 H N N 397 PRO HXT H N N 398 SER N N N N 399 SER CA C N S 400 SER C C N N 401 SER O O N N 402 SER CB C N N 403 SER OG O N N 404 SER OXT O N N 405 SER H H N N 406 SER H2 H N N 407 SER HA H N N 408 SER HB2 H N N 409 SER HB3 H N N 410 SER HG H N N 411 SER HXT H N N 412 SO4 S S N N 413 SO4 O1 O N N 414 SO4 O2 O N N 415 SO4 O3 O N N 416 SO4 O4 O N N 417 THR N N N N 418 THR CA C N S 419 THR C C N N 420 THR O O N N 421 THR CB C N R 422 THR OG1 O N N 423 THR CG2 C N N 424 THR OXT O N N 425 THR H H N N 426 THR H2 H N N 427 THR HA H N N 428 THR HB H N N 429 THR HG1 H N N 430 THR HG21 H N N 431 THR HG22 H N N 432 THR HG23 H N N 433 THR HXT H N N 434 TRP N N N N 435 TRP CA C N S 436 TRP C C N N 437 TRP O O N N 438 TRP CB C N N 439 TRP CG C Y N 440 TRP CD1 C Y N 441 TRP CD2 C Y N 442 TRP NE1 N Y N 443 TRP CE2 C Y N 444 TRP CE3 C Y N 445 TRP CZ2 C Y N 446 TRP CZ3 C Y N 447 TRP CH2 C Y N 448 TRP OXT O N N 449 TRP H H N N 450 TRP H2 H N N 451 TRP HA H N N 452 TRP HB2 H N N 453 TRP HB3 H N N 454 TRP HD1 H N N 455 TRP HE1 H N N 456 TRP HE3 H N N 457 TRP HZ2 H N N 458 TRP HZ3 H N N 459 TRP HH2 H N N 460 TRP HXT H N N 461 TYR N N N N 462 TYR CA C N S 463 TYR C C N N 464 TYR O O N N 465 TYR CB C N N 466 TYR CG C Y N 467 TYR CD1 C Y N 468 TYR CD2 C Y N 469 TYR CE1 C Y N 470 TYR CE2 C Y N 471 TYR CZ C Y N 472 TYR OH O N N 473 TYR OXT O N N 474 TYR H H N N 475 TYR H2 H N N 476 TYR HA H N N 477 TYR HB2 H N N 478 TYR HB3 H N N 479 TYR HD1 H N N 480 TYR HD2 H N N 481 TYR HE1 H N N 482 TYR HE2 H N N 483 TYR HH H N N 484 TYR HXT H N N 485 VAL N N N N 486 VAL CA C N S 487 VAL C C N N 488 VAL O O N N 489 VAL CB C N N 490 VAL CG1 C N N 491 VAL CG2 C N N 492 VAL OXT O N N 493 VAL H H N N 494 VAL H2 H N N 495 VAL HA H N N 496 VAL HB H N N 497 VAL HG11 H N N 498 VAL HG12 H N N 499 VAL HG13 H N N 500 VAL HG21 H N N 501 VAL HG22 H N N 502 VAL HG23 H N N 503 VAL HXT H N N 504 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 FRU C1 C2 sing N N 70 FRU C1 O1 sing N N 71 FRU C1 H11 sing N N 72 FRU C1 H12 sing N N 73 FRU C2 C3 sing N N 74 FRU C2 O2 sing N N 75 FRU C2 O5 sing N N 76 FRU C3 C4 sing N N 77 FRU C3 O3 sing N N 78 FRU C3 H3 sing N N 79 FRU C4 C5 sing N N 80 FRU C4 O4 sing N N 81 FRU C4 H4 sing N N 82 FRU C5 C6 sing N N 83 FRU C5 O5 sing N N 84 FRU C5 H5 sing N N 85 FRU C6 O6 sing N N 86 FRU C6 H61 sing N N 87 FRU C6 H62 sing N N 88 FRU O1 HO1 sing N N 89 FRU O2 HO2 sing N N 90 FRU O3 HO3 sing N N 91 FRU O4 HO4 sing N N 92 FRU O6 HO6 sing N N 93 GLC C1 C2 sing N N 94 GLC C1 O1 sing N N 95 GLC C1 O5 sing N N 96 GLC C1 H1 sing N N 97 GLC C2 C3 sing N N 98 GLC C2 O2 sing N N 99 GLC C2 H2 sing N N 100 GLC C3 C4 sing N N 101 GLC C3 O3 sing N N 102 GLC C3 H3 sing N N 103 GLC C4 C5 sing N N 104 GLC C4 O4 sing N N 105 GLC C4 H4 sing N N 106 GLC C5 C6 sing N N 107 GLC C5 O5 sing N N 108 GLC C5 H5 sing N N 109 GLC C6 O6 sing N N 110 GLC C6 H61 sing N N 111 GLC C6 H62 sing N N 112 GLC O1 HO1 sing N N 113 GLC O2 HO2 sing N N 114 GLC O3 HO3 sing N N 115 GLC O4 HO4 sing N N 116 GLC O6 HO6 sing N N 117 GLN N CA sing N N 118 GLN N H sing N N 119 GLN N H2 sing N N 120 GLN CA C sing N N 121 GLN CA CB sing N N 122 GLN CA HA sing N N 123 GLN C O doub N N 124 GLN C OXT sing N N 125 GLN CB CG sing N N 126 GLN CB HB2 sing N N 127 GLN CB HB3 sing N N 128 GLN CG CD sing N N 129 GLN CG HG2 sing N N 130 GLN CG HG3 sing N N 131 GLN CD OE1 doub N N 132 GLN CD NE2 sing N N 133 GLN NE2 HE21 sing N N 134 GLN NE2 HE22 sing N N 135 GLN OXT HXT sing N N 136 GLU N CA sing N N 137 GLU N H sing N N 138 GLU N H2 sing N N 139 GLU CA C sing N N 140 GLU CA CB sing N N 141 GLU CA HA sing N N 142 GLU C O doub N N 143 GLU C OXT sing N N 144 GLU CB CG sing N N 145 GLU CB HB2 sing N N 146 GLU CB HB3 sing N N 147 GLU CG CD sing N N 148 GLU CG HG2 sing N N 149 GLU CG HG3 sing N N 150 GLU CD OE1 doub N N 151 GLU CD OE2 sing N N 152 GLU OE2 HE2 sing N N 153 GLU OXT HXT sing N N 154 GLY N CA sing N N 155 GLY N H sing N N 156 GLY N H2 sing N N 157 GLY CA C sing N N 158 GLY CA HA2 sing N N 159 GLY CA HA3 sing N N 160 GLY C O doub N N 161 GLY C OXT sing N N 162 GLY OXT HXT sing N N 163 HEM CHA C1A sing N N 164 HEM CHA C4D doub N N 165 HEM CHA HHA sing N N 166 HEM CHB C4A sing N N 167 HEM CHB C1B doub N N 168 HEM CHB HHB sing N N 169 HEM CHC C4B sing N N 170 HEM CHC C1C doub N N 171 HEM CHC HHC sing N N 172 HEM CHD C4C doub N N 173 HEM CHD C1D sing N N 174 HEM CHD HHD sing N N 175 HEM C1A C2A doub Y N 176 HEM C1A NA sing Y N 177 HEM C2A C3A sing Y N 178 HEM C2A CAA sing N N 179 HEM C3A C4A doub Y N 180 HEM C3A CMA sing N N 181 HEM C4A NA sing Y N 182 HEM CMA HMA sing N N 183 HEM CMA HMAA sing N N 184 HEM CMA HMAB sing N N 185 HEM CAA CBA sing N N 186 HEM CAA HAA sing N N 187 HEM CAA HAAA sing N N 188 HEM CBA CGA sing N N 189 HEM CBA HBA sing N N 190 HEM CBA HBAA sing N N 191 HEM CGA O1A doub N N 192 HEM CGA O2A sing N N 193 HEM C1B C2B sing N N 194 HEM C1B NB sing N N 195 HEM C2B C3B doub N N 196 HEM C2B CMB sing N N 197 HEM C3B C4B sing N N 198 HEM C3B CAB sing N N 199 HEM C4B NB doub N N 200 HEM CMB HMB sing N N 201 HEM CMB HMBA sing N N 202 HEM CMB HMBB sing N N 203 HEM CAB CBB doub N N 204 HEM CAB HAB sing N N 205 HEM CBB HBB sing N N 206 HEM CBB HBBA sing N N 207 HEM C1C C2C sing Y N 208 HEM C1C NC sing Y N 209 HEM C2C C3C doub Y N 210 HEM C2C CMC sing N N 211 HEM C3C C4C sing Y N 212 HEM C3C CAC sing N N 213 HEM C4C NC sing Y N 214 HEM CMC HMC sing N N 215 HEM CMC HMCA sing N N 216 HEM CMC HMCB sing N N 217 HEM CAC CBC doub N N 218 HEM CAC HAC sing N N 219 HEM CBC HBC sing N N 220 HEM CBC HBCA sing N N 221 HEM C1D C2D sing N N 222 HEM C1D ND doub N N 223 HEM C2D C3D doub N N 224 HEM C2D CMD sing N N 225 HEM C3D C4D sing N N 226 HEM C3D CAD sing N N 227 HEM C4D ND sing N N 228 HEM CMD HMD sing N N 229 HEM CMD HMDA sing N N 230 HEM CMD HMDB sing N N 231 HEM CAD CBD sing N N 232 HEM CAD HAD sing N N 233 HEM CAD HADA sing N N 234 HEM CBD CGD sing N N 235 HEM CBD HBD sing N N 236 HEM CBD HBDA sing N N 237 HEM CGD O1D doub N N 238 HEM CGD O2D sing N N 239 HEM O2A H2A sing N N 240 HEM O2D H2D sing N N 241 HEM FE NA sing N N 242 HEM FE NB sing N N 243 HEM FE NC sing N N 244 HEM FE ND sing N N 245 HIS N CA sing N N 246 HIS N H sing N N 247 HIS N H2 sing N N 248 HIS CA C sing N N 249 HIS CA CB sing N N 250 HIS CA HA sing N N 251 HIS C O doub N N 252 HIS C OXT sing N N 253 HIS CB CG sing N N 254 HIS CB HB2 sing N N 255 HIS CB HB3 sing N N 256 HIS CG ND1 sing Y N 257 HIS CG CD2 doub Y N 258 HIS ND1 CE1 doub Y N 259 HIS ND1 HD1 sing N N 260 HIS CD2 NE2 sing Y N 261 HIS CD2 HD2 sing N N 262 HIS CE1 NE2 sing Y N 263 HIS CE1 HE1 sing N N 264 HIS NE2 HE2 sing N N 265 HIS OXT HXT sing N N 266 HOH O H1 sing N N 267 HOH O H2 sing N N 268 ILE N CA sing N N 269 ILE N H sing N N 270 ILE N H2 sing N N 271 ILE CA C sing N N 272 ILE CA CB sing N N 273 ILE CA HA sing N N 274 ILE C O doub N N 275 ILE C OXT sing N N 276 ILE CB CG1 sing N N 277 ILE CB CG2 sing N N 278 ILE CB HB sing N N 279 ILE CG1 CD1 sing N N 280 ILE CG1 HG12 sing N N 281 ILE CG1 HG13 sing N N 282 ILE CG2 HG21 sing N N 283 ILE CG2 HG22 sing N N 284 ILE CG2 HG23 sing N N 285 ILE CD1 HD11 sing N N 286 ILE CD1 HD12 sing N N 287 ILE CD1 HD13 sing N N 288 ILE OXT HXT sing N N 289 LEU N CA sing N N 290 LEU N H sing N N 291 LEU N H2 sing N N 292 LEU CA C sing N N 293 LEU CA CB sing N N 294 LEU CA HA sing N N 295 LEU C O doub N N 296 LEU C OXT sing N N 297 LEU CB CG sing N N 298 LEU CB HB2 sing N N 299 LEU CB HB3 sing N N 300 LEU CG CD1 sing N N 301 LEU CG CD2 sing N N 302 LEU CG HG sing N N 303 LEU CD1 HD11 sing N N 304 LEU CD1 HD12 sing N N 305 LEU CD1 HD13 sing N N 306 LEU CD2 HD21 sing N N 307 LEU CD2 HD22 sing N N 308 LEU CD2 HD23 sing N N 309 LEU OXT HXT sing N N 310 LYS N CA sing N N 311 LYS N H sing N N 312 LYS N H2 sing N N 313 LYS CA C sing N N 314 LYS CA CB sing N N 315 LYS CA HA sing N N 316 LYS C O doub N N 317 LYS C OXT sing N N 318 LYS CB CG sing N N 319 LYS CB HB2 sing N N 320 LYS CB HB3 sing N N 321 LYS CG CD sing N N 322 LYS CG HG2 sing N N 323 LYS CG HG3 sing N N 324 LYS CD CE sing N N 325 LYS CD HD2 sing N N 326 LYS CD HD3 sing N N 327 LYS CE NZ sing N N 328 LYS CE HE2 sing N N 329 LYS CE HE3 sing N N 330 LYS NZ HZ1 sing N N 331 LYS NZ HZ2 sing N N 332 LYS NZ HZ3 sing N N 333 LYS OXT HXT sing N N 334 MET N CA sing N N 335 MET N H sing N N 336 MET N H2 sing N N 337 MET CA C sing N N 338 MET CA CB sing N N 339 MET CA HA sing N N 340 MET C O doub N N 341 MET C OXT sing N N 342 MET CB CG sing N N 343 MET CB HB2 sing N N 344 MET CB HB3 sing N N 345 MET CG SD sing N N 346 MET CG HG2 sing N N 347 MET CG HG3 sing N N 348 MET SD CE sing N N 349 MET CE HE1 sing N N 350 MET CE HE2 sing N N 351 MET CE HE3 sing N N 352 MET OXT HXT sing N N 353 PHE N CA sing N N 354 PHE N H sing N N 355 PHE N H2 sing N N 356 PHE CA C sing N N 357 PHE CA CB sing N N 358 PHE CA HA sing N N 359 PHE C O doub N N 360 PHE C OXT sing N N 361 PHE CB CG sing N N 362 PHE CB HB2 sing N N 363 PHE CB HB3 sing N N 364 PHE CG CD1 doub Y N 365 PHE CG CD2 sing Y N 366 PHE CD1 CE1 sing Y N 367 PHE CD1 HD1 sing N N 368 PHE CD2 CE2 doub Y N 369 PHE CD2 HD2 sing N N 370 PHE CE1 CZ doub Y N 371 PHE CE1 HE1 sing N N 372 PHE CE2 CZ sing Y N 373 PHE CE2 HE2 sing N N 374 PHE CZ HZ sing N N 375 PHE OXT HXT sing N N 376 PRO N CA sing N N 377 PRO N CD sing N N 378 PRO N H sing N N 379 PRO CA C sing N N 380 PRO CA CB sing N N 381 PRO CA HA sing N N 382 PRO C O doub N N 383 PRO C OXT sing N N 384 PRO CB CG sing N N 385 PRO CB HB2 sing N N 386 PRO CB HB3 sing N N 387 PRO CG CD sing N N 388 PRO CG HG2 sing N N 389 PRO CG HG3 sing N N 390 PRO CD HD2 sing N N 391 PRO CD HD3 sing N N 392 PRO OXT HXT sing N N 393 SER N CA sing N N 394 SER N H sing N N 395 SER N H2 sing N N 396 SER CA C sing N N 397 SER CA CB sing N N 398 SER CA HA sing N N 399 SER C O doub N N 400 SER C OXT sing N N 401 SER CB OG sing N N 402 SER CB HB2 sing N N 403 SER CB HB3 sing N N 404 SER OG HG sing N N 405 SER OXT HXT sing N N 406 SO4 S O1 doub N N 407 SO4 S O2 doub N N 408 SO4 S O3 sing N N 409 SO4 S O4 sing N N 410 THR N CA sing N N 411 THR N H sing N N 412 THR N H2 sing N N 413 THR CA C sing N N 414 THR CA CB sing N N 415 THR CA HA sing N N 416 THR C O doub N N 417 THR C OXT sing N N 418 THR CB OG1 sing N N 419 THR CB CG2 sing N N 420 THR CB HB sing N N 421 THR OG1 HG1 sing N N 422 THR CG2 HG21 sing N N 423 THR CG2 HG22 sing N N 424 THR CG2 HG23 sing N N 425 THR OXT HXT sing N N 426 TRP N CA sing N N 427 TRP N H sing N N 428 TRP N H2 sing N N 429 TRP CA C sing N N 430 TRP CA CB sing N N 431 TRP CA HA sing N N 432 TRP C O doub N N 433 TRP C OXT sing N N 434 TRP CB CG sing N N 435 TRP CB HB2 sing N N 436 TRP CB HB3 sing N N 437 TRP CG CD1 doub Y N 438 TRP CG CD2 sing Y N 439 TRP CD1 NE1 sing Y N 440 TRP CD1 HD1 sing N N 441 TRP CD2 CE2 doub Y N 442 TRP CD2 CE3 sing Y N 443 TRP NE1 CE2 sing Y N 444 TRP NE1 HE1 sing N N 445 TRP CE2 CZ2 sing Y N 446 TRP CE3 CZ3 doub Y N 447 TRP CE3 HE3 sing N N 448 TRP CZ2 CH2 doub Y N 449 TRP CZ2 HZ2 sing N N 450 TRP CZ3 CH2 sing Y N 451 TRP CZ3 HZ3 sing N N 452 TRP CH2 HH2 sing N N 453 TRP OXT HXT sing N N 454 TYR N CA sing N N 455 TYR N H sing N N 456 TYR N H2 sing N N 457 TYR CA C sing N N 458 TYR CA CB sing N N 459 TYR CA HA sing N N 460 TYR C O doub N N 461 TYR C OXT sing N N 462 TYR CB CG sing N N 463 TYR CB HB2 sing N N 464 TYR CB HB3 sing N N 465 TYR CG CD1 doub Y N 466 TYR CG CD2 sing Y N 467 TYR CD1 CE1 sing Y N 468 TYR CD1 HD1 sing N N 469 TYR CD2 CE2 doub Y N 470 TYR CD2 HD2 sing N N 471 TYR CE1 CZ doub Y N 472 TYR CE1 HE1 sing N N 473 TYR CE2 CZ sing Y N 474 TYR CE2 HE2 sing N N 475 TYR CZ OH sing N N 476 TYR OH HH sing N N 477 TYR OXT HXT sing N N 478 VAL N CA sing N N 479 VAL N H sing N N 480 VAL N H2 sing N N 481 VAL CA C sing N N 482 VAL CA CB sing N N 483 VAL CA HA sing N N 484 VAL C O doub N N 485 VAL C OXT sing N N 486 VAL CB CG1 sing N N 487 VAL CB CG2 sing N N 488 VAL CB HB sing N N 489 VAL CG1 HG11 sing N N 490 VAL CG1 HG12 sing N N 491 VAL CG1 HG13 sing N N 492 VAL CG2 HG21 sing N N 493 VAL CG2 HG22 sing N N 494 VAL CG2 HG23 sing N N 495 VAL OXT HXT sing N N 496 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 GLC 1 B GLC 1 C SUC 1 n B 2 FRU 2 B FRU 2 C SUC 1 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DFrufb FRU 'COMMON NAME' GMML 1.0 b-D-fructofuranose FRU 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Fruf FRU 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fru GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpa GLC 'COMMON NAME' GMML 1.0 a-D-glucopyranose GLC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Glcp GLC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DFrufb2-1DGlcpa 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 1 _pdbx_entity_branch_link.comp_id_1 GLC _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 2 _pdbx_entity_branch_link.comp_id_2 FRU _pdbx_entity_branch_link.atom_id_2 O2 _pdbx_entity_branch_link.leaving_atom_id_2 HO2 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 GLC 1 n 2 FRU 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 'PROTOPORPHYRIN IX CONTAINING FE' HEM 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1JW8 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #