data_6NCK # _entry.id 6NCK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NCK pdb_00006nck 10.2210/pdb6nck/pdb WWPDB D_1000238546 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-06 2 'Structure model' 1 1 2019-11-13 3 'Structure model' 1 2 2019-11-27 4 'Structure model' 1 3 2023-10-11 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' struct_conn 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_struct_conn.pdbx_dist_value' 10 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NCK _pdbx_database_status.recvd_initial_deposition_date 2018-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'another structure of PHM 108A mutant' 6ALA unspecified PDB 'WT PHM' 1PHM unspecified PDB 'PHM H107A' 5WJA unspecified PDB 'PHM apo (no Cu)' 5WKW unspecified PDB 'PHM H108A' 6AY0 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Miller, M.S.' 1 0000-0003-1972-4503 'Maheshwari, S.' 2 ? 'Gabelli, S.B.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Molecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1420-3049 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Getting the Most Out of Your Crystals: Data Collection at the New High-Flux, Microfocus MX Beamlines at NSLS-II.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/molecules24030496 _citation.pdbx_database_id_PubMed 30704096 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miller, M.S.' 1 ? primary 'Maheshwari, S.' 2 ? primary 'Shi, W.' 3 ? primary 'Gao, Y.' 4 0000-0002-5435-8863 primary 'Chu, N.' 5 ? primary 'Soares, A.S.' 6 0000-0002-6565-8503 primary 'Cole, P.A.' 7 ? primary 'Amzel, L.M.' 8 ? primary 'Fuchs, M.R.' 9 0000-0001-9784-0927 primary 'Jakoncic, J.' 10 ? primary 'Gabelli, S.B.' 11 0000-0003-1205-5204 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-glycine alpha-amidating monooxygenase' 34706.812 1 1.14.17.3,4.3.2.5 H108A ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 4 water nat water 18.015 20 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PAM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHAMLLFGCNMPSSTGSYW FCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGM YLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVT FGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV ; _entity_poly.pdbx_seq_one_letter_code_can ;NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHAMLLFGCNMPSSTGSYW FCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGM YLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVT FGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'NICKEL (II) ION' NI 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 GLU n 1 3 CYS n 1 4 LEU n 1 5 GLY n 1 6 THR n 1 7 ILE n 1 8 GLY n 1 9 PRO n 1 10 VAL n 1 11 THR n 1 12 PRO n 1 13 LEU n 1 14 ASP n 1 15 ALA n 1 16 SER n 1 17 ASP n 1 18 PHE n 1 19 ALA n 1 20 LEU n 1 21 ASP n 1 22 ILE n 1 23 ARG n 1 24 MET n 1 25 PRO n 1 26 GLY n 1 27 VAL n 1 28 THR n 1 29 PRO n 1 30 LYS n 1 31 GLU n 1 32 SER n 1 33 ASP n 1 34 THR n 1 35 TYR n 1 36 PHE n 1 37 CYS n 1 38 MET n 1 39 SER n 1 40 MET n 1 41 ARG n 1 42 LEU n 1 43 PRO n 1 44 VAL n 1 45 ASP n 1 46 GLU n 1 47 GLU n 1 48 ALA n 1 49 PHE n 1 50 VAL n 1 51 ILE n 1 52 ASP n 1 53 PHE n 1 54 LYS n 1 55 PRO n 1 56 ARG n 1 57 ALA n 1 58 SER n 1 59 MET n 1 60 ASP n 1 61 THR n 1 62 VAL n 1 63 HIS n 1 64 ALA n 1 65 MET n 1 66 LEU n 1 67 LEU n 1 68 PHE n 1 69 GLY n 1 70 CYS n 1 71 ASN n 1 72 MET n 1 73 PRO n 1 74 SER n 1 75 SER n 1 76 THR n 1 77 GLY n 1 78 SER n 1 79 TYR n 1 80 TRP n 1 81 PHE n 1 82 CYS n 1 83 ASP n 1 84 GLU n 1 85 GLY n 1 86 THR n 1 87 CYS n 1 88 THR n 1 89 ASP n 1 90 LYS n 1 91 ALA n 1 92 ASN n 1 93 ILE n 1 94 LEU n 1 95 TYR n 1 96 ALA n 1 97 TRP n 1 98 ALA n 1 99 ARG n 1 100 ASN n 1 101 ALA n 1 102 PRO n 1 103 PRO n 1 104 THR n 1 105 ARG n 1 106 LEU n 1 107 PRO n 1 108 LYS n 1 109 GLY n 1 110 VAL n 1 111 GLY n 1 112 PHE n 1 113 ARG n 1 114 VAL n 1 115 GLY n 1 116 GLY n 1 117 GLU n 1 118 THR n 1 119 GLY n 1 120 SER n 1 121 LYS n 1 122 TYR n 1 123 PHE n 1 124 VAL n 1 125 LEU n 1 126 GLN n 1 127 VAL n 1 128 HIS n 1 129 TYR n 1 130 GLY n 1 131 ASP n 1 132 ILE n 1 133 SER n 1 134 ALA n 1 135 PHE n 1 136 ARG n 1 137 ASP n 1 138 ASN n 1 139 HIS n 1 140 LYS n 1 141 ASP n 1 142 CYS n 1 143 SER n 1 144 GLY n 1 145 VAL n 1 146 SER n 1 147 VAL n 1 148 HIS n 1 149 LEU n 1 150 THR n 1 151 ARG n 1 152 VAL n 1 153 PRO n 1 154 GLN n 1 155 PRO n 1 156 LEU n 1 157 ILE n 1 158 ALA n 1 159 GLY n 1 160 MET n 1 161 TYR n 1 162 LEU n 1 163 MET n 1 164 MET n 1 165 SER n 1 166 VAL n 1 167 ASP n 1 168 THR n 1 169 VAL n 1 170 ILE n 1 171 PRO n 1 172 PRO n 1 173 GLY n 1 174 GLU n 1 175 LYS n 1 176 VAL n 1 177 VAL n 1 178 ASN n 1 179 ALA n 1 180 ASP n 1 181 ILE n 1 182 SER n 1 183 CYS n 1 184 GLN n 1 185 TYR n 1 186 LYS n 1 187 MET n 1 188 TYR n 1 189 PRO n 1 190 MET n 1 191 HIS n 1 192 VAL n 1 193 PHE n 1 194 ALA n 1 195 TYR n 1 196 ARG n 1 197 VAL n 1 198 HIS n 1 199 THR n 1 200 HIS n 1 201 HIS n 1 202 LEU n 1 203 GLY n 1 204 LYS n 1 205 VAL n 1 206 VAL n 1 207 SER n 1 208 GLY n 1 209 TYR n 1 210 ARG n 1 211 VAL n 1 212 ARG n 1 213 ASN n 1 214 GLY n 1 215 GLN n 1 216 TRP n 1 217 THR n 1 218 LEU n 1 219 ILE n 1 220 GLY n 1 221 ARG n 1 222 GLN n 1 223 ASN n 1 224 PRO n 1 225 GLN n 1 226 LEU n 1 227 PRO n 1 228 GLN n 1 229 ALA n 1 230 PHE n 1 231 TYR n 1 232 PRO n 1 233 VAL n 1 234 GLU n 1 235 HIS n 1 236 PRO n 1 237 VAL n 1 238 ASP n 1 239 VAL n 1 240 THR n 1 241 PHE n 1 242 GLY n 1 243 ASP n 1 244 ILE n 1 245 LEU n 1 246 ALA n 1 247 ALA n 1 248 ARG n 1 249 CYS n 1 250 VAL n 1 251 PHE n 1 252 THR n 1 253 GLY n 1 254 GLU n 1 255 GLY n 1 256 ARG n 1 257 THR n 1 258 GLU n 1 259 ALA n 1 260 THR n 1 261 HIS n 1 262 ILE n 1 263 GLY n 1 264 GLY n 1 265 THR n 1 266 SER n 1 267 SER n 1 268 ASP n 1 269 GLU n 1 270 MET n 1 271 CYS n 1 272 ASN n 1 273 LEU n 1 274 TYR n 1 275 ILE n 1 276 MET n 1 277 TYR n 1 278 TYR n 1 279 MET n 1 280 GLU n 1 281 ALA n 1 282 LYS n 1 283 TYR n 1 284 ALA n 1 285 LEU n 1 286 SER n 1 287 PHE n 1 288 MET n 1 289 THR n 1 290 CYS n 1 291 THR n 1 292 LYS n 1 293 ASN n 1 294 VAL n 1 295 ALA n 1 296 PRO n 1 297 ASP n 1 298 MET n 1 299 PHE n 1 300 ARG n 1 301 THR n 1 302 ILE n 1 303 PRO n 1 304 ALA n 1 305 GLU n 1 306 ALA n 1 307 ASN n 1 308 ILE n 1 309 PRO n 1 310 ILE n 1 311 PRO n 1 312 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 312 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Pam _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 45 ? ? ? A . n A 1 2 GLU 2 46 ? ? ? A . n A 1 3 CYS 3 47 47 CYS CYS A . n A 1 4 LEU 4 48 ? ? ? A . n A 1 5 GLY 5 49 ? ? ? A . n A 1 6 THR 6 50 ? ? ? A . n A 1 7 ILE 7 51 ? ? ? A . n A 1 8 GLY 8 52 ? ? ? A . n A 1 9 PRO 9 53 53 PRO PRO A . n A 1 10 VAL 10 54 54 VAL VAL A . n A 1 11 THR 11 55 55 THR THR A . n A 1 12 PRO 12 56 56 PRO PRO A . n A 1 13 LEU 13 57 57 LEU LEU A . n A 1 14 ASP 14 58 58 ASP ASP A . n A 1 15 ALA 15 59 59 ALA ALA A . n A 1 16 SER 16 60 60 SER SER A . n A 1 17 ASP 17 61 61 ASP ASP A . n A 1 18 PHE 18 62 62 PHE PHE A . n A 1 19 ALA 19 63 63 ALA ALA A . n A 1 20 LEU 20 64 64 LEU LEU A . n A 1 21 ASP 21 65 65 ASP ASP A . n A 1 22 ILE 22 66 66 ILE ILE A . n A 1 23 ARG 23 67 67 ARG ARG A . n A 1 24 MET 24 68 68 MET MET A . n A 1 25 PRO 25 69 69 PRO PRO A . n A 1 26 GLY 26 70 70 GLY GLY A . n A 1 27 VAL 27 71 71 VAL VAL A . n A 1 28 THR 28 72 72 THR THR A . n A 1 29 PRO 29 73 73 PRO PRO A . n A 1 30 LYS 30 74 74 LYS LYS A . n A 1 31 GLU 31 75 75 GLU GLU A . n A 1 32 SER 32 76 76 SER SER A . n A 1 33 ASP 33 77 77 ASP ASP A . n A 1 34 THR 34 78 78 THR THR A . n A 1 35 TYR 35 79 79 TYR TYR A . n A 1 36 PHE 36 80 80 PHE PHE A . n A 1 37 CYS 37 81 81 CYS CYS A . n A 1 38 MET 38 82 82 MET MET A . n A 1 39 SER 39 83 83 SER SER A . n A 1 40 MET 40 84 84 MET MET A . n A 1 41 ARG 41 85 85 ARG ARG A . n A 1 42 LEU 42 86 86 LEU LEU A . n A 1 43 PRO 43 87 87 PRO PRO A . n A 1 44 VAL 44 88 88 VAL VAL A . n A 1 45 ASP 45 89 89 ASP ASP A . n A 1 46 GLU 46 90 90 GLU GLU A . n A 1 47 GLU 47 91 91 GLU GLU A . n A 1 48 ALA 48 92 92 ALA ALA A . n A 1 49 PHE 49 93 93 PHE PHE A . n A 1 50 VAL 50 94 94 VAL VAL A . n A 1 51 ILE 51 95 95 ILE ILE A . n A 1 52 ASP 52 96 96 ASP ASP A . n A 1 53 PHE 53 97 97 PHE PHE A . n A 1 54 LYS 54 98 98 LYS LYS A . n A 1 55 PRO 55 99 99 PRO PRO A . n A 1 56 ARG 56 100 100 ARG ARG A . n A 1 57 ALA 57 101 101 ALA ALA A . n A 1 58 SER 58 102 102 SER SER A . n A 1 59 MET 59 103 103 MET MET A . n A 1 60 ASP 60 104 104 ASP ASP A . n A 1 61 THR 61 105 105 THR THR A . n A 1 62 VAL 62 106 106 VAL VAL A . n A 1 63 HIS 63 107 107 HIS HIS A . n A 1 64 ALA 64 108 108 ALA ALA A . n A 1 65 MET 65 109 109 MET MET A . n A 1 66 LEU 66 110 110 LEU LEU A . n A 1 67 LEU 67 111 111 LEU LEU A . n A 1 68 PHE 68 112 112 PHE PHE A . n A 1 69 GLY 69 113 113 GLY GLY A . n A 1 70 CYS 70 114 114 CYS CYS A . n A 1 71 ASN 71 115 115 ASN ASN A . n A 1 72 MET 72 116 116 MET MET A . n A 1 73 PRO 73 117 117 PRO PRO A . n A 1 74 SER 74 118 118 SER SER A . n A 1 75 SER 75 119 119 SER SER A . n A 1 76 THR 76 120 120 THR THR A . n A 1 77 GLY 77 121 121 GLY GLY A . n A 1 78 SER 78 122 122 SER SER A . n A 1 79 TYR 79 123 123 TYR TYR A . n A 1 80 TRP 80 124 124 TRP TRP A . n A 1 81 PHE 81 125 125 PHE PHE A . n A 1 82 CYS 82 126 126 CYS CYS A . n A 1 83 ASP 83 127 127 ASP ASP A . n A 1 84 GLU 84 128 128 GLU GLU A . n A 1 85 GLY 85 129 129 GLY GLY A . n A 1 86 THR 86 130 130 THR THR A . n A 1 87 CYS 87 131 131 CYS CYS A . n A 1 88 THR 88 132 132 THR THR A . n A 1 89 ASP 89 133 133 ASP ASP A . n A 1 90 LYS 90 134 134 LYS LYS A . n A 1 91 ALA 91 135 135 ALA ALA A . n A 1 92 ASN 92 136 136 ASN ASN A . n A 1 93 ILE 93 137 137 ILE ILE A . n A 1 94 LEU 94 138 138 LEU LEU A . n A 1 95 TYR 95 139 139 TYR TYR A . n A 1 96 ALA 96 140 140 ALA ALA A . n A 1 97 TRP 97 141 141 TRP TRP A . n A 1 98 ALA 98 142 142 ALA ALA A . n A 1 99 ARG 99 143 143 ARG ARG A . n A 1 100 ASN 100 144 144 ASN ASN A . n A 1 101 ALA 101 145 145 ALA ALA A . n A 1 102 PRO 102 146 146 PRO PRO A . n A 1 103 PRO 103 147 147 PRO PRO A . n A 1 104 THR 104 148 148 THR THR A . n A 1 105 ARG 105 149 149 ARG ARG A . n A 1 106 LEU 106 150 150 LEU LEU A . n A 1 107 PRO 107 151 151 PRO PRO A . n A 1 108 LYS 108 152 152 LYS LYS A . n A 1 109 GLY 109 153 153 GLY GLY A . n A 1 110 VAL 110 154 154 VAL VAL A . n A 1 111 GLY 111 155 155 GLY GLY A . n A 1 112 PHE 112 156 156 PHE PHE A . n A 1 113 ARG 113 157 157 ARG ARG A . n A 1 114 VAL 114 158 158 VAL VAL A . n A 1 115 GLY 115 159 159 GLY GLY A . n A 1 116 GLY 116 160 160 GLY GLY A . n A 1 117 GLU 117 161 161 GLU GLU A . n A 1 118 THR 118 162 162 THR THR A . n A 1 119 GLY 119 163 163 GLY GLY A . n A 1 120 SER 120 164 164 SER SER A . n A 1 121 LYS 121 165 165 LYS LYS A . n A 1 122 TYR 122 166 166 TYR TYR A . n A 1 123 PHE 123 167 167 PHE PHE A . n A 1 124 VAL 124 168 168 VAL VAL A . n A 1 125 LEU 125 169 169 LEU LEU A . n A 1 126 GLN 126 170 170 GLN GLN A . n A 1 127 VAL 127 171 171 VAL VAL A . n A 1 128 HIS 128 172 172 HIS HIS A . n A 1 129 TYR 129 173 173 TYR TYR A . n A 1 130 GLY 130 174 174 GLY GLY A . n A 1 131 ASP 131 175 175 ASP ASP A . n A 1 132 ILE 132 176 176 ILE ILE A . n A 1 133 SER 133 177 177 SER SER A . n A 1 134 ALA 134 178 178 ALA ALA A . n A 1 135 PHE 135 179 179 PHE PHE A . n A 1 136 ARG 136 180 180 ARG ARG A . n A 1 137 ASP 137 181 181 ASP ASP A . n A 1 138 ASN 138 182 182 ASN ASN A . n A 1 139 HIS 139 183 183 HIS HIS A . n A 1 140 LYS 140 184 184 LYS LYS A . n A 1 141 ASP 141 185 185 ASP ASP A . n A 1 142 CYS 142 186 186 CYS CYS A . n A 1 143 SER 143 187 187 SER SER A . n A 1 144 GLY 144 188 188 GLY GLY A . n A 1 145 VAL 145 189 189 VAL VAL A . n A 1 146 SER 146 190 190 SER SER A . n A 1 147 VAL 147 191 191 VAL VAL A . n A 1 148 HIS 148 192 192 HIS HIS A . n A 1 149 LEU 149 193 193 LEU LEU A . n A 1 150 THR 150 194 194 THR THR A . n A 1 151 ARG 151 195 195 ARG ARG A . n A 1 152 VAL 152 196 196 VAL VAL A . n A 1 153 PRO 153 197 197 PRO PRO A . n A 1 154 GLN 154 198 198 GLN GLN A . n A 1 155 PRO 155 199 199 PRO PRO A . n A 1 156 LEU 156 200 200 LEU LEU A . n A 1 157 ILE 157 201 201 ILE ILE A . n A 1 158 ALA 158 202 202 ALA ALA A . n A 1 159 GLY 159 203 203 GLY GLY A . n A 1 160 MET 160 204 204 MET MET A . n A 1 161 TYR 161 205 205 TYR TYR A . n A 1 162 LEU 162 206 206 LEU LEU A . n A 1 163 MET 163 207 207 MET MET A . n A 1 164 MET 164 208 208 MET MET A . n A 1 165 SER 165 209 209 SER SER A . n A 1 166 VAL 166 210 210 VAL VAL A . n A 1 167 ASP 167 211 211 ASP ASP A . n A 1 168 THR 168 212 212 THR THR A . n A 1 169 VAL 169 213 213 VAL VAL A . n A 1 170 ILE 170 214 214 ILE ILE A . n A 1 171 PRO 171 215 215 PRO PRO A . n A 1 172 PRO 172 216 216 PRO PRO A . n A 1 173 GLY 173 217 217 GLY GLY A . n A 1 174 GLU 174 218 218 GLU GLU A . n A 1 175 LYS 175 219 219 LYS LYS A . n A 1 176 VAL 176 220 220 VAL VAL A . n A 1 177 VAL 177 221 221 VAL VAL A . n A 1 178 ASN 178 222 222 ASN ASN A . n A 1 179 ALA 179 223 223 ALA ALA A . n A 1 180 ASP 180 224 224 ASP ASP A . n A 1 181 ILE 181 225 225 ILE ILE A . n A 1 182 SER 182 226 226 SER SER A . n A 1 183 CYS 183 227 227 CYS CYS A . n A 1 184 GLN 184 228 228 GLN GLN A . n A 1 185 TYR 185 229 229 TYR TYR A . n A 1 186 LYS 186 230 230 LYS LYS A . n A 1 187 MET 187 231 231 MET MET A . n A 1 188 TYR 188 232 232 TYR TYR A . n A 1 189 PRO 189 233 233 PRO PRO A . n A 1 190 MET 190 234 234 MET MET A . n A 1 191 HIS 191 235 235 HIS HIS A . n A 1 192 VAL 192 236 236 VAL VAL A . n A 1 193 PHE 193 237 237 PHE PHE A . n A 1 194 ALA 194 238 238 ALA ALA A . n A 1 195 TYR 195 239 239 TYR TYR A . n A 1 196 ARG 196 240 240 ARG ARG A . n A 1 197 VAL 197 241 241 VAL VAL A . n A 1 198 HIS 198 242 242 HIS HIS A . n A 1 199 THR 199 243 243 THR THR A . n A 1 200 HIS 200 244 244 HIS HIS A . n A 1 201 HIS 201 245 245 HIS HIS A . n A 1 202 LEU 202 246 246 LEU LEU A . n A 1 203 GLY 203 247 247 GLY GLY A . n A 1 204 LYS 204 248 248 LYS LYS A . n A 1 205 VAL 205 249 249 VAL VAL A . n A 1 206 VAL 206 250 250 VAL VAL A . n A 1 207 SER 207 251 251 SER SER A . n A 1 208 GLY 208 252 252 GLY GLY A . n A 1 209 TYR 209 253 253 TYR TYR A . n A 1 210 ARG 210 254 254 ARG ARG A . n A 1 211 VAL 211 255 255 VAL VAL A . n A 1 212 ARG 212 256 256 ARG ARG A . n A 1 213 ASN 213 257 257 ASN ASN A . n A 1 214 GLY 214 258 258 GLY GLY A . n A 1 215 GLN 215 259 259 GLN GLN A . n A 1 216 TRP 216 260 260 TRP TRP A . n A 1 217 THR 217 261 261 THR THR A . n A 1 218 LEU 218 262 262 LEU LEU A . n A 1 219 ILE 219 263 263 ILE ILE A . n A 1 220 GLY 220 264 264 GLY GLY A . n A 1 221 ARG 221 265 265 ARG ARG A . n A 1 222 GLN 222 266 266 GLN GLN A . n A 1 223 ASN 223 267 267 ASN ASN A . n A 1 224 PRO 224 268 268 PRO PRO A . n A 1 225 GLN 225 269 269 GLN GLN A . n A 1 226 LEU 226 270 270 LEU LEU A . n A 1 227 PRO 227 271 271 PRO PRO A . n A 1 228 GLN 228 272 272 GLN GLN A . n A 1 229 ALA 229 273 273 ALA ALA A . n A 1 230 PHE 230 274 274 PHE PHE A . n A 1 231 TYR 231 275 275 TYR TYR A . n A 1 232 PRO 232 276 276 PRO PRO A . n A 1 233 VAL 233 277 277 VAL VAL A . n A 1 234 GLU 234 278 278 GLU GLU A . n A 1 235 HIS 235 279 279 HIS HIS A . n A 1 236 PRO 236 280 280 PRO PRO A . n A 1 237 VAL 237 281 281 VAL VAL A . n A 1 238 ASP 238 282 282 ASP ASP A . n A 1 239 VAL 239 283 283 VAL VAL A . n A 1 240 THR 240 284 284 THR THR A . n A 1 241 PHE 241 285 285 PHE PHE A . n A 1 242 GLY 242 286 286 GLY GLY A . n A 1 243 ASP 243 287 287 ASP ASP A . n A 1 244 ILE 244 288 288 ILE ILE A . n A 1 245 LEU 245 289 289 LEU LEU A . n A 1 246 ALA 246 290 290 ALA ALA A . n A 1 247 ALA 247 291 291 ALA ALA A . n A 1 248 ARG 248 292 292 ARG ARG A . n A 1 249 CYS 249 293 293 CYS CYS A . n A 1 250 VAL 250 294 294 VAL VAL A . n A 1 251 PHE 251 295 295 PHE PHE A . n A 1 252 THR 252 296 296 THR THR A . n A 1 253 GLY 253 297 297 GLY GLY A . n A 1 254 GLU 254 298 298 GLU GLU A . n A 1 255 GLY 255 299 299 GLY GLY A . n A 1 256 ARG 256 300 300 ARG ARG A . n A 1 257 THR 257 301 301 THR THR A . n A 1 258 GLU 258 302 302 GLU GLU A . n A 1 259 ALA 259 303 303 ALA ALA A . n A 1 260 THR 260 304 304 THR THR A . n A 1 261 HIS 261 305 305 HIS HIS A . n A 1 262 ILE 262 306 306 ILE ILE A . n A 1 263 GLY 263 307 ? ? ? A . n A 1 264 GLY 264 308 ? ? ? A . n A 1 265 THR 265 309 ? ? ? A . n A 1 266 SER 266 310 310 SER SER A . n A 1 267 SER 267 311 311 SER SER A . n A 1 268 ASP 268 312 312 ASP ASP A . n A 1 269 GLU 269 313 313 GLU GLU A . n A 1 270 MET 270 314 314 MET MET A . n A 1 271 CYS 271 315 315 CYS CYS A . n A 1 272 ASN 272 316 316 ASN ASN A . n A 1 273 LEU 273 317 317 LEU LEU A . n A 1 274 TYR 274 318 318 TYR TYR A . n A 1 275 ILE 275 319 319 ILE ILE A . n A 1 276 MET 276 320 320 MET MET A . n A 1 277 TYR 277 321 321 TYR TYR A . n A 1 278 TYR 278 322 322 TYR TYR A . n A 1 279 MET 279 323 323 MET MET A . n A 1 280 GLU 280 324 324 GLU GLU A . n A 1 281 ALA 281 325 325 ALA ALA A . n A 1 282 LYS 282 326 326 LYS LYS A . n A 1 283 TYR 283 327 327 TYR TYR A . n A 1 284 ALA 284 328 328 ALA ALA A . n A 1 285 LEU 285 329 329 LEU LEU A . n A 1 286 SER 286 330 330 SER SER A . n A 1 287 PHE 287 331 331 PHE PHE A . n A 1 288 MET 288 332 332 MET MET A . n A 1 289 THR 289 333 333 THR THR A . n A 1 290 CYS 290 334 334 CYS CYS A . n A 1 291 THR 291 335 335 THR THR A . n A 1 292 LYS 292 336 336 LYS LYS A . n A 1 293 ASN 293 337 337 ASN ASN A . n A 1 294 VAL 294 338 338 VAL VAL A . n A 1 295 ALA 295 339 339 ALA ALA A . n A 1 296 PRO 296 340 340 PRO PRO A . n A 1 297 ASP 297 341 341 ASP ASP A . n A 1 298 MET 298 342 342 MET MET A . n A 1 299 PHE 299 343 343 PHE PHE A . n A 1 300 ARG 300 344 344 ARG ARG A . n A 1 301 THR 301 345 345 THR THR A . n A 1 302 ILE 302 346 346 ILE ILE A . n A 1 303 PRO 303 347 347 PRO PRO A . n A 1 304 ALA 304 348 348 ALA ALA A . n A 1 305 GLU 305 349 349 GLU GLU A . n A 1 306 ALA 306 350 350 ALA ALA A . n A 1 307 ASN 307 351 351 ASN ASN A . n A 1 308 ILE 308 352 352 ILE ILE A . n A 1 309 PRO 309 353 353 PRO PRO A . n A 1 310 ILE 310 354 354 ILE ILE A . n A 1 311 PRO 311 355 ? ? ? A . n A 1 312 VAL 312 356 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 401 401 CU CU A . C 3 NI 1 402 501 NI NI A . D 4 HOH 1 501 11 HOH HOH A . D 4 HOH 2 502 4 HOH HOH A . D 4 HOH 3 503 19 HOH HOH A . D 4 HOH 4 504 17 HOH HOH A . D 4 HOH 5 505 6 HOH HOH A . D 4 HOH 6 506 15 HOH HOH A . D 4 HOH 7 507 13 HOH HOH A . D 4 HOH 8 508 16 HOH HOH A . D 4 HOH 9 509 8 HOH HOH A . D 4 HOH 10 510 20 HOH HOH A . D 4 HOH 11 511 1 HOH HOH A . D 4 HOH 12 512 18 HOH HOH A . D 4 HOH 13 513 14 HOH HOH A . D 4 HOH 14 514 9 HOH HOH A . D 4 HOH 15 515 2 HOH HOH A . D 4 HOH 16 516 7 HOH HOH A . D 4 HOH 17 517 10 HOH HOH A . D 4 HOH 18 518 12 HOH HOH A . D 4 HOH 19 519 5 HOH HOH A . D 4 HOH 20 520 3 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6NCK _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.310 _cell.length_a_esd ? _cell.length_b 65.880 _cell.length_b_esd ? _cell.length_c 69.750 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NCK _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NCK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.96 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '19-24% PEG 4000, Tris HCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 53.452 _reflns.entry_id 6NCK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 44.080 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7872 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.873 _reflns.pdbx_Rmerge_I_obs 0.130 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.190 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.975 _reflns.pdbx_scaling_rejects 36 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.145 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 38364 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.770 ? 2.680 ? ? ? ? 574 99.100 ? ? ? ? 0.606 ? ? ? ? ? ? ? ? 4.054 ? ? ? ? 0.692 ? ? 1 1 0.815 ? 2.770 2.850 ? 3.370 ? ? ? ? 531 99.400 ? ? ? ? 0.474 ? ? ? ? ? ? ? ? 4.591 ? ? ? ? 0.534 ? ? 2 1 0.901 ? 2.850 2.930 ? 4.190 ? ? ? ? 544 100.000 ? ? ? ? 0.366 ? ? ? ? ? ? ? ? 4.915 ? ? ? ? 0.408 ? ? 3 1 0.935 ? 2.930 3.020 ? 4.540 ? ? ? ? 532 99.400 ? ? ? ? 0.317 ? ? ? ? ? ? ? ? 4.739 ? ? ? ? 0.356 ? ? 4 1 0.958 ? 3.020 3.120 ? 5.920 ? ? ? ? 512 100.000 ? ? ? ? 0.267 ? ? ? ? ? ? ? ? 5.342 ? ? ? ? 0.296 ? ? 5 1 0.958 ? 3.120 3.230 ? 6.340 ? ? ? ? 493 100.000 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 5.239 ? ? ? ? 0.251 ? ? 6 1 0.972 ? 3.230 3.350 ? 7.670 ? ? ? ? 479 100.000 ? ? ? ? 0.185 ? ? ? ? ? ? ? ? 5.305 ? ? ? ? 0.204 ? ? 7 1 0.976 ? 3.350 3.490 ? 8.430 ? ? ? ? 474 100.000 ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 5.230 ? ? ? ? 0.178 ? ? 8 1 0.982 ? 3.490 3.640 ? 9.250 ? ? ? ? 439 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 5.155 ? ? ? ? 0.161 ? ? 9 1 0.983 ? 3.640 3.820 ? 9.880 ? ? ? ? 430 100.000 ? ? ? ? 0.134 ? ? ? ? ? ? ? ? 5.114 ? ? ? ? 0.149 ? ? 10 1 0.986 ? 3.820 4.030 ? 10.600 ? ? ? ? 409 99.500 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 5.032 ? ? ? ? 0.140 ? ? 11 1 0.988 ? 4.030 4.270 ? 11.780 ? ? ? ? 373 99.200 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? 5.056 ? ? ? ? 0.127 ? ? 12 1 0.987 ? 4.270 4.560 ? 12.140 ? ? ? ? 372 99.700 ? ? ? ? 0.108 ? ? ? ? ? ? ? ? 4.793 ? ? ? ? 0.119 ? ? 13 1 0.988 ? 4.560 4.930 ? 12.210 ? ? ? ? 339 99.100 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 4.681 ? ? ? ? 0.111 ? ? 14 1 0.991 ? 4.930 5.400 ? 11.280 ? ? ? ? 320 99.400 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 4.094 ? ? ? ? 0.112 ? ? 15 1 0.987 ? 5.400 6.040 ? 11.550 ? ? ? ? 286 99.300 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 4.402 ? ? ? ? 0.111 ? ? 16 1 0.988 ? 6.040 6.970 ? 12.480 ? ? ? ? 255 99.200 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 5.024 ? ? ? ? 0.105 ? ? 17 1 0.985 ? 6.970 8.540 ? 13.480 ? ? ? ? 227 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 5.079 ? ? ? ? 0.098 ? ? 18 1 0.990 ? 8.540 12.080 ? 13.550 ? ? ? ? 179 98.900 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 4.743 ? ? ? ? 0.092 ? ? 19 1 0.995 ? 12.080 44.080 ? 12.790 ? ? ? ? 104 94.500 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 4.212 ? ? ? ? 0.097 ? ? 20 1 0.990 ? # _refine.aniso_B[1][1] -2.8700 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 7.8500 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -4.9800 _refine.B_iso_max 134.890 _refine.B_iso_mean 54.2820 _refine.B_iso_min 29.710 _refine.correlation_coeff_Fo_to_Fc 0.9340 _refine.correlation_coeff_Fo_to_Fc_free 0.8710 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NCK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7000 _refine.ls_d_res_low 44.0800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7477 _refine.ls_number_reflns_R_free 394 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5700 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2233 _refine.ls_R_factor_R_free 0.2949 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2196 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6AO6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4570 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 18.7660 _refine.overall_SU_ML 0.3760 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7000 _refine_hist.d_res_low 44.0800 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 2372 _refine_hist.pdbx_number_residues_total 300 _refine_hist.pdbx_B_iso_mean_ligand 109.36 _refine_hist.pdbx_B_iso_mean_solvent 41.62 _refine_hist.pdbx_number_atoms_protein 2350 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 2420 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2185 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.541 1.652 3291 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.346 1.569 5071 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.513 5.000 297 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.074 21.417 120 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.900 15.000 381 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.021 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.068 0.200 314 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2693 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 524 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7000 _refine_ls_shell.d_res_low 2.7700 _refine_ls_shell.number_reflns_all 571 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 29 _refine_ls_shell.number_reflns_R_work 542 _refine_ls_shell.percent_reflns_obs 99.1300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3420 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3220 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6NCK _struct.title 'Crystal structure of H108A peptidylglycine alpha-hydroxylating monooxygenase (PHM)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NCK _struct_keywords.text 'PHM, peptidylglycine alpha-hydroxylating monooxygenase, PAL, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AMD_RAT _struct_ref.pdbx_db_accession P14925 _struct_ref.pdbx_db_isoform P14925-3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYW FCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGM YLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVT FGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV ; _struct_ref.pdbx_align_begin 45 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NCK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 312 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14925 _struct_ref_seq.db_align_beg 45 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 356 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 45 _struct_ref_seq.pdbx_auth_seq_align_end 356 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6NCK _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 64 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P14925 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 108 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 108 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 282 ? ALA A 284 ? LYS A 326 ALA A 328 5 ? 3 HELX_P HELX_P2 AA2 ALA A 295 ? ILE A 302 ? ALA A 339 ILE A 346 5 ? 8 HELX_P HELX_P3 AA3 PRO A 303 ? ILE A 308 ? PRO A 347 ILE A 352 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 47 A CYS 186 1_555 ? ? ? ? ? ? ? 2.062 ? ? disulf2 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 81 A CYS 126 1_555 ? ? ? ? ? ? ? 2.015 ? ? disulf3 disulf ? ? A CYS 70 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 114 A CYS 131 1_555 ? ? ? ? ? ? ? 2.048 ? ? disulf4 disulf ? ? A CYS 183 SG ? ? ? 1_555 A CYS 290 SG ? ? A CYS 227 A CYS 334 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf5 disulf ? ? A CYS 249 SG ? ? ? 1_555 A CYS 271 SG ? ? A CYS 293 A CYS 315 1_555 ? ? ? ? ? ? ? 2.019 ? ? metalc1 metalc ? ? A HIS 198 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 242 A CU 401 1_555 ? ? ? ? ? ? ? 2.110 ? ? metalc2 metalc ? ? A HIS 200 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 244 A CU 401 1_555 ? ? ? ? ? ? ? 2.204 ? ? metalc3 metalc ? ? A HIS 235 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 279 A NI 402 3_555 ? ? ? ? ? ? ? 2.663 ? ? metalc4 metalc ? ? A MET 270 SD ? ? ? 1_555 B CU . CU ? ? A MET 314 A CU 401 1_555 ? ? ? ? ? ? ? 2.470 ? ? metalc5 metalc ? ? B CU . CU ? ? ? 1_555 D HOH . O ? ? A CU 401 A HOH 518 1_555 ? ? ? ? ? ? ? 2.684 ? ? metalc6 metalc ? ? C NI . NI ? ? ? 1_555 D HOH . O ? ? A NI 402 A HOH 510 3_545 ? ? ? ? ? ? ? 2.734 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 198 ? A HIS 242 ? 1_555 CU ? B CU . ? A CU 401 ? 1_555 NE2 ? A HIS 200 ? A HIS 244 ? 1_555 98.1 ? 2 NE2 ? A HIS 198 ? A HIS 242 ? 1_555 CU ? B CU . ? A CU 401 ? 1_555 SD ? A MET 270 ? A MET 314 ? 1_555 106.0 ? 3 NE2 ? A HIS 200 ? A HIS 244 ? 1_555 CU ? B CU . ? A CU 401 ? 1_555 SD ? A MET 270 ? A MET 314 ? 1_555 93.2 ? 4 NE2 ? A HIS 198 ? A HIS 242 ? 1_555 CU ? B CU . ? A CU 401 ? 1_555 O ? D HOH . ? A HOH 518 ? 1_555 124.4 ? 5 NE2 ? A HIS 200 ? A HIS 244 ? 1_555 CU ? B CU . ? A CU 401 ? 1_555 O ? D HOH . ? A HOH 518 ? 1_555 118.9 ? 6 SD ? A MET 270 ? A MET 314 ? 1_555 CU ? B CU . ? A CU 401 ? 1_555 O ? D HOH . ? A HOH 518 ? 1_555 111.3 ? 7 NE2 ? A HIS 235 ? A HIS 279 ? 1_555 NI ? C NI . ? A NI 402 ? 3_555 O ? D HOH . ? A HOH 510 ? 3_545 70.7 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 142 ? CYS A 47 ? 1_555 CYS A 186 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 37 ? CYS A 82 ? CYS A 81 ? 1_555 CYS A 126 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 70 ? CYS A 87 ? CYS A 114 ? 1_555 CYS A 131 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 183 ? CYS A 290 ? CYS A 227 ? 1_555 CYS A 334 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 249 ? CYS A 271 ? CYS A 293 ? 1_555 CYS A 315 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 7 ? AA3 ? 5 ? AA4 ? 2 ? AA5 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? parallel AA2 6 7 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 10 ? PRO A 12 ? VAL A 54 PRO A 56 AA1 2 ASP A 17 ? ARG A 23 ? ASP A 61 ARG A 67 AA1 3 GLY A 144 ? THR A 150 ? GLY A 188 THR A 194 AA1 4 ALA A 48 ? ARG A 56 ? ALA A 92 ARG A 100 AA1 5 VAL A 110 ? VAL A 114 ? VAL A 154 VAL A 158 AA1 6 LEU A 156 ? MET A 164 ? LEU A 200 MET A 208 AA1 7 ASN A 272 ? GLU A 280 ? ASN A 316 GLU A 324 AA1 8 MET A 190 ? HIS A 198 ? MET A 234 HIS A 242 AA1 9 TYR A 231 ? VAL A 239 ? TYR A 275 VAL A 283 AA2 1 VAL A 10 ? PRO A 12 ? VAL A 54 PRO A 56 AA2 2 ASP A 17 ? ARG A 23 ? ASP A 61 ARG A 67 AA2 3 GLY A 144 ? THR A 150 ? GLY A 188 THR A 194 AA2 4 ALA A 48 ? ARG A 56 ? ALA A 92 ARG A 100 AA2 5 VAL A 110 ? VAL A 114 ? VAL A 154 VAL A 158 AA2 6 LEU A 156 ? MET A 164 ? LEU A 200 MET A 208 AA2 7 PHE A 287 ? CYS A 290 ? PHE A 331 CYS A 334 AA3 1 TRP A 80 ? PHE A 81 ? TRP A 124 PHE A 125 AA3 2 THR A 34 ? ARG A 41 ? THR A 78 ARG A 85 AA3 3 TYR A 122 ? TYR A 129 ? TYR A 166 TYR A 173 AA3 4 ALA A 64 ? CYS A 70 ? ALA A 108 CYS A 114 AA3 5 ASN A 92 ? ALA A 98 ? ASN A 136 ALA A 142 AA4 1 VAL A 169 ? ILE A 170 ? VAL A 213 ILE A 214 AA4 2 THR A 260 ? HIS A 261 ? THR A 304 HIS A 305 AA5 1 VAL A 177 ? GLN A 184 ? VAL A 221 GLN A 228 AA5 2 ILE A 244 ? PHE A 251 ? ILE A 288 PHE A 295 AA5 3 GLY A 203 ? ARG A 212 ? GLY A 247 ARG A 256 AA5 4 GLN A 215 ? GLN A 222 ? GLN A 259 GLN A 266 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 11 ? N THR A 55 O ALA A 19 ? O ALA A 63 AA1 2 3 N LEU A 20 ? N LEU A 64 O VAL A 147 ? O VAL A 191 AA1 3 4 O SER A 146 ? O SER A 190 N LYS A 54 ? N LYS A 98 AA1 4 5 N ALA A 48 ? N ALA A 92 O VAL A 114 ? O VAL A 158 AA1 5 6 N GLY A 111 ? N GLY A 155 O ALA A 158 ? O ALA A 202 AA1 6 7 N MET A 163 ? N MET A 207 O LEU A 273 ? O LEU A 317 AA1 7 8 O TYR A 274 ? O TYR A 318 N ARG A 196 ? N ARG A 240 AA1 8 9 N MET A 190 ? N MET A 234 O VAL A 239 ? O VAL A 283 AA2 1 2 N THR A 11 ? N THR A 55 O ALA A 19 ? O ALA A 63 AA2 2 3 N LEU A 20 ? N LEU A 64 O VAL A 147 ? O VAL A 191 AA2 3 4 O SER A 146 ? O SER A 190 N LYS A 54 ? N LYS A 98 AA2 4 5 N ALA A 48 ? N ALA A 92 O VAL A 114 ? O VAL A 158 AA2 5 6 N GLY A 111 ? N GLY A 155 O ALA A 158 ? O ALA A 202 AA2 6 7 N LEU A 162 ? N LEU A 206 O MET A 288 ? O MET A 332 AA3 1 2 O TRP A 80 ? O TRP A 124 N CYS A 37 ? N CYS A 81 AA3 2 3 N THR A 34 ? N THR A 78 O TYR A 129 ? O TYR A 173 AA3 3 4 O HIS A 128 ? O HIS A 172 N ALA A 64 ? N ALA A 108 AA3 4 5 N LEU A 67 ? N LEU A 111 O LEU A 94 ? O LEU A 138 AA4 1 2 N ILE A 170 ? N ILE A 214 O THR A 260 ? O THR A 304 AA5 1 2 N ALA A 179 ? N ALA A 223 O CYS A 249 ? O CYS A 293 AA5 2 3 O VAL A 250 ? O VAL A 294 N LYS A 204 ? N LYS A 248 AA5 3 4 N ARG A 210 ? N ARG A 254 O THR A 217 ? O THR A 261 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 401 ? 4 'binding site for residue CU A 401' AC2 Software A NI 402 ? 3 'binding site for residue NI A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 198 ? HIS A 242 . ? 1_555 ? 2 AC1 4 HIS A 200 ? HIS A 244 . ? 1_555 ? 3 AC1 4 MET A 270 ? MET A 314 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 518 . ? 1_555 ? 5 AC2 3 SER A 75 ? SER A 119 . ? 1_555 ? 6 AC2 3 HIS A 235 ? HIS A 279 . ? 3_545 ? 7 AC2 3 HOH D . ? HOH A 510 . ? 3_545 ? # _pdbx_entry_details.entry_id 6NCK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 130 ? ? -96.12 -66.00 2 1 HIS A 244 ? ? -117.74 74.01 3 1 HIS A 245 ? ? 71.35 -13.41 4 1 ASP A 312 ? ? 54.94 -137.53 # _pdbx_phasing_MR.entry_id 6NCK _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body 0.506 _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 44.080 _pdbx_phasing_MR.d_res_low_rotation 3.500 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 45 ? A ASN 1 2 1 Y 1 A GLU 46 ? A GLU 2 3 1 Y 1 A LEU 48 ? A LEU 4 4 1 Y 1 A GLY 49 ? A GLY 5 5 1 Y 1 A THR 50 ? A THR 6 6 1 Y 1 A ILE 51 ? A ILE 7 7 1 Y 1 A GLY 52 ? A GLY 8 8 1 Y 1 A GLY 307 ? A GLY 263 9 1 Y 1 A GLY 308 ? A GLY 264 10 1 Y 1 A THR 309 ? A THR 265 11 1 Y 1 A PRO 355 ? A PRO 311 12 1 Y 1 A VAL 356 ? A VAL 312 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NI NI NI N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA062924 1 'National Science Foundation (NSF, United States)' 'United States' MCB-1517522 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6AO6 _pdbx_initial_refinement_model.details ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _atom_sites.entry_id 6NCK _atom_sites.fract_transf_matrix[1][1] 0.016861 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015179 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014337 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CU N NI O S # loop_