data_6R1L # _entry.id 6R1L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6R1L pdb_00006r1l 10.2210/pdb6r1l/pdb WWPDB D_1292101280 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-01 2 'Structure model' 1 1 2021-10-13 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Source and taxonomy' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' database_PDB_rev 5 2 'Structure model' database_PDB_rev_record 6 2 'Structure model' entity_src_gen 7 2 'Structure model' pdbx_database_proc 8 2 'Structure model' pdbx_struct_conn_angle 9 2 'Structure model' struct_conn 10 3 'Structure model' chem_comp_atom 11 3 'Structure model' chem_comp_bond 12 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_database_2.pdbx_DOI' 13 2 'Structure model' '_database_2.pdbx_database_accession' 14 2 'Structure model' '_entity_src_gen.gene_src_strain' 15 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 23 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 24 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 25 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 26 2 'Structure model' '_pdbx_struct_conn_angle.value' 27 2 'Structure model' '_struct_conn.pdbx_dist_value' 28 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 29 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 30 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 31 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 32 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 33 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 34 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 35 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 36 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 37 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 38 2 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6R1L _pdbx_database_status.recvd_initial_deposition_date 2019-03-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Reddem, R.' 1 ? 'Thunnissen, A.M.W.H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Catalysis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2155-5435 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 11783 _citation.page_last 11790 _citation.title 'Cofactor Binding Dynamics Influence the Catalytic Activity and Selectivity of an Artificial Metalloenzyme.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acscatal.0c01619 _citation.pdbx_database_id_PubMed 33101759 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Villarino, L.' 1 ? primary 'Chordia, S.' 2 ? primary 'Alonso-Cotchico, L.' 3 ? primary 'Reddem, E.' 4 ? primary 'Zhou, Z.' 5 ? primary 'Thunnissen, A.M.W.H.' 6 ? primary 'Marechal, J.D.' 7 ? primary 'Roelfes, G.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator, PadR-like family' 14764.789 1 ? ? ? 'LmrR carrying a C-terminal strep-tag' 2 non-polymer syn 1,10-PHENANTHROLINE 180.205 1 ? ? ? ? 3 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 4 water nat water 18.015 22 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYR LTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIKSRWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYR LTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIKSRWSHPQFEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,10-PHENANTHROLINE PHN 3 'COPPER (II) ION' CU 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ILE n 1 5 PRO n 1 6 LYS n 1 7 GLU n 1 8 MET n 1 9 LEU n 1 10 ARG n 1 11 ALA n 1 12 GLN n 1 13 THR n 1 14 ASN n 1 15 VAL n 1 16 ILE n 1 17 LEU n 1 18 LEU n 1 19 ASN n 1 20 VAL n 1 21 LEU n 1 22 LYS n 1 23 GLN n 1 24 GLY n 1 25 ASP n 1 26 ASN n 1 27 TYR n 1 28 VAL n 1 29 TYR n 1 30 GLY n 1 31 ILE n 1 32 ILE n 1 33 LYS n 1 34 GLN n 1 35 VAL n 1 36 LYS n 1 37 GLU n 1 38 ALA n 1 39 SER n 1 40 ASN n 1 41 GLY n 1 42 GLU n 1 43 MET n 1 44 GLU n 1 45 LEU n 1 46 ASN n 1 47 GLU n 1 48 ALA n 1 49 THR n 1 50 LEU n 1 51 TYR n 1 52 THR n 1 53 ILE n 1 54 PHE n 1 55 LYS n 1 56 ARG n 1 57 LEU n 1 58 GLU n 1 59 LYS n 1 60 ASP n 1 61 GLY n 1 62 ILE n 1 63 ILE n 1 64 SER n 1 65 SER n 1 66 TYR n 1 67 TRP n 1 68 GLY n 1 69 ASP n 1 70 GLU n 1 71 SER n 1 72 GLN n 1 73 GLY n 1 74 GLY n 1 75 ARG n 1 76 ARG n 1 77 LYS n 1 78 TYR n 1 79 TYR n 1 80 ARG n 1 81 LEU n 1 82 THR n 1 83 GLU n 1 84 ILE n 1 85 GLY n 1 86 HIS n 1 87 GLU n 1 88 ASN n 1 89 MET n 1 90 ARG n 1 91 LEU n 1 92 ALA n 1 93 PHE n 1 94 GLU n 1 95 SER n 1 96 TRP n 1 97 SER n 1 98 ARG n 1 99 VAL n 1 100 ASP n 1 101 LYS n 1 102 ILE n 1 103 ILE n 1 104 GLU n 1 105 ASN n 1 106 LEU n 1 107 GLU n 1 108 ALA n 1 109 ASN n 1 110 LYS n 1 111 LYS n 1 112 SER n 1 113 GLU n 1 114 ALA n 1 115 ILE n 1 116 LYS n 1 117 SER n 1 118 ARG n 1 119 TRP n 1 120 SER n 1 121 HIS n 1 122 PRO n 1 123 GLN n 1 124 PHE n 1 125 GLU n 1 126 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 126 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene llmg_0323 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis subsp. cremoris MG1363' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 416870 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PHN non-polymer . 1,10-PHENANTHROLINE ? 'C12 H8 N2' 180.205 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLU 70 70 ? ? ? A . n A 1 71 SER 71 71 ? ? ? A . n A 1 72 GLN 72 72 ? ? ? A . n A 1 73 GLY 73 73 ? ? ? A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ASN 109 109 ? ? ? A . n A 1 110 LYS 110 110 ? ? ? A . n A 1 111 LYS 111 111 ? ? ? A . n A 1 112 SER 112 112 ? ? ? A . n A 1 113 GLU 113 113 ? ? ? A . n A 1 114 ALA 114 114 ? ? ? A . n A 1 115 ILE 115 115 ? ? ? A . n A 1 116 LYS 116 116 ? ? ? A . n A 1 117 SER 117 117 ? ? ? A . n A 1 118 ARG 118 118 ? ? ? A . n A 1 119 TRP 119 119 ? ? ? A . n A 1 120 SER 120 120 ? ? ? A . n A 1 121 HIS 121 121 ? ? ? A . n A 1 122 PRO 122 122 ? ? ? A . n A 1 123 GLN 123 123 ? ? ? A . n A 1 124 PHE 124 124 ? ? ? A . n A 1 125 GLU 125 125 ? ? ? A . n A 1 126 LYS 126 126 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PHN 1 201 1 PHN PHN A . C 3 CU 1 202 2 CU CU A . D 4 HOH 1 301 15 HOH HOH A . D 4 HOH 2 302 14 HOH HOH A . D 4 HOH 3 303 20 HOH HOH A . D 4 HOH 4 304 16 HOH HOH A . D 4 HOH 5 305 3 HOH HOH A . D 4 HOH 6 306 22 HOH HOH A . D 4 HOH 7 307 11 HOH HOH A . D 4 HOH 8 308 9 HOH HOH A . D 4 HOH 9 309 5 HOH HOH A . D 4 HOH 10 310 1 HOH HOH A . D 4 HOH 11 311 2 HOH HOH A . D 4 HOH 12 312 21 HOH HOH A . D 4 HOH 13 313 13 HOH HOH A . D 4 HOH 14 314 8 HOH HOH A . D 4 HOH 15 315 10 HOH HOH A . D 4 HOH 16 316 6 HOH HOH A . D 4 HOH 17 317 19 HOH HOH A . D 4 HOH 18 318 4 HOH HOH A . D 4 HOH 19 319 7 HOH HOH A . D 4 HOH 20 320 17 HOH HOH A . D 4 HOH 21 321 18 HOH HOH A . D 4 HOH 22 322 12 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14rc1_3161 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.27 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6R1L _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.851 _cell.length_a_esd ? _cell.length_b 34.851 _cell.length_b_esd ? _cell.length_c 177.469 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6R1L _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6R1L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM cacodylate, 300 mM sodium acetate, 25% PEG 200 MME, 5 mM Cu-phenanthroline' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9660 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9660 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6R1L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.090 _reflns.d_resolution_low 34.850 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7167 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.200 _reflns.pdbx_Rmerge_I_obs 0.092 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.097 _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.090 2.160 ? ? ? ? ? ? 556 98.300 ? ? ? ? 0.932 ? ? ? ? ? ? ? ? 9.400 ? ? ? ? 0.984 0.312 ? 1 1 0.811 ? 8.890 34.850 ? ? ? ? ? ? 135 99.700 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 6.700 ? ? ? ? 0.054 0.019 ? 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 95.080 _refine.B_iso_mean 45.1711 _refine.B_iso_min 20.730 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6R1L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0950 _refine.ls_d_res_low 34.1980 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12273 _refine.ls_number_reflns_R_free 1232 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8000 _refine.ls_percent_reflns_R_free 10.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2063 _refine.ls_R_factor_R_free 0.2484 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2012 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.650 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 3F8C' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.4400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0950 _refine_hist.d_res_low 34.1980 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 861 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 100 _refine_hist.pdbx_B_iso_mean_ligand 70.05 _refine_hist.pdbx_B_iso_mean_solvent 43.12 _refine_hist.pdbx_number_atoms_protein 824 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0952 2.1791 1372 . 137 1235 98.0000 . . . 0.3068 0.0000 0.2702 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.1791 2.2782 1342 . 130 1212 100.0000 . . . 0.2955 0.0000 0.2356 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.2782 2.3983 1352 . 134 1218 100.0000 . . . 0.2936 0.0000 0.2398 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.3983 2.5485 1364 . 146 1218 100.0000 . . . 0.3207 0.0000 0.2339 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.5485 2.7452 1393 . 141 1252 100.0000 . . . 0.2468 0.0000 0.2193 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.7452 3.0213 1347 . 138 1209 100.0000 . . . 0.2928 0.0000 0.2077 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.0213 3.4581 1381 . 133 1248 100.0000 . . . 0.2415 0.0000 0.2017 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.4581 4.3555 1369 . 141 1228 100.0000 . . . 0.2068 0.0000 0.1730 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 4.3555 34.2024 1353 . 132 1221 100.0000 . . . 0.2306 0.0000 0.1858 . . . . . . 9 . . . # _struct.entry_id 6R1L _struct.title 'Crystal structure of LmrR with bound copper phenanthroline' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6R1L _struct_keywords.text 'PadR family, transcriptional regulator, artificial metalloenzyme, phenanthroline, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A2RI36_LACLM _struct_ref.pdbx_db_accession A2RI36 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYR LTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6R1L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A2RI36 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6R1L SER A 117 ? UNP A2RI36 ? ? 'expression tag' 117 1 1 6R1L ARG A 118 ? UNP A2RI36 ? ? 'expression tag' 118 2 1 6R1L TRP A 119 ? UNP A2RI36 ? ? 'expression tag' 119 3 1 6R1L SER A 120 ? UNP A2RI36 ? ? 'expression tag' 120 4 1 6R1L HIS A 121 ? UNP A2RI36 ? ? 'expression tag' 121 5 1 6R1L PRO A 122 ? UNP A2RI36 ? ? 'expression tag' 122 6 1 6R1L GLN A 123 ? UNP A2RI36 ? ? 'expression tag' 123 7 1 6R1L PHE A 124 ? UNP A2RI36 ? ? 'expression tag' 124 8 1 6R1L GLU A 125 ? UNP A2RI36 ? ? 'expression tag' 125 9 1 6R1L LYS A 126 ? UNP A2RI36 ? ? 'expression tag' 126 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3920 ? 1 MORE -48 ? 1 'SSA (A^2)' 11940 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 5 ? GLN A 23 ? PRO A 5 GLN A 23 1 ? 19 HELX_P HELX_P2 AA2 VAL A 28 ? SER A 39 ? VAL A 28 SER A 39 1 ? 12 HELX_P HELX_P3 AA3 ASN A 46 ? ASP A 60 ? ASN A 46 ASP A 60 1 ? 15 HELX_P HELX_P4 AA4 THR A 82 ? ALA A 108 ? THR A 82 ALA A 108 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B PHN . N1 ? ? ? 1_555 C CU . CU ? ? A PHN 201 A CU 202 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc2 metalc ? ? B PHN . N10 ? ? ? 1_555 C CU . CU ? ? A PHN 201 A CU 202 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc3 metalc ? ? B PHN . N1 ? ? ? 1_555 C CU . CU ? ? A PHN 201 A CU 202 7_555 ? ? ? ? ? ? ? 2.007 ? ? metalc4 metalc ? ? B PHN . N10 ? ? ? 1_555 C CU . CU ? ? A PHN 201 A CU 202 7_555 ? ? ? ? ? ? ? 2.119 ? ? metalc5 metalc ? ? C CU . CU ? ? ? 1_555 D HOH . O ? ? A CU 202 A HOH 306 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc6 metalc ? ? C CU . CU ? ? ? 1_555 D HOH . O ? ? A CU 202 A HOH 306 7_555 ? ? ? ? ? ? ? 2.386 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 N10 ? B PHN . ? A PHN 201 ? 1_555 86.8 ? 2 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 N1 ? B PHN . ? A PHN 201 ? 1_555 0.0 ? 3 N10 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 N1 ? B PHN . ? A PHN 201 ? 1_555 86.8 ? 4 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 N10 ? B PHN . ? A PHN 201 ? 1_555 86.8 ? 5 N10 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 N10 ? B PHN . ? A PHN 201 ? 1_555 0.0 ? 6 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 N10 ? B PHN . ? A PHN 201 ? 1_555 86.8 ? 7 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 133.2 ? 8 N10 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 112.3 ? 9 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 133.2 ? 10 N10 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 112.3 ? 11 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 7_555 104.3 ? 12 N10 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 7_555 122.5 ? 13 N1 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 7_555 104.3 ? 14 N10 ? B PHN . ? A PHN 201 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 7_555 122.5 ? 15 O ? D HOH . ? A HOH 306 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 O ? D HOH . ? A HOH 306 ? 7_555 100.1 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 26 ? TYR A 27 ? ASN A 26 TYR A 27 AA1 2 ARG A 76 ? LEU A 81 ? ARG A 76 LEU A 81 AA1 3 ILE A 63 ? GLY A 68 ? ILE A 63 GLY A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 26 ? N ASN A 26 O TYR A 79 ? O TYR A 79 AA1 2 3 O TYR A 78 ? O TYR A 78 N TYR A 66 ? N TYR A 66 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PHN 201 ? 5 'binding site for residue PHN A 201' AC2 Software A CU 202 ? 4 'binding site for residue CU A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 VAL A 15 ? VAL A 15 . ? 7_555 ? 2 AC1 5 TRP A 96 ? TRP A 96 . ? 1_555 ? 3 AC1 5 TRP A 96 ? TRP A 96 . ? 7_555 ? 4 AC1 5 CU C . ? CU A 202 . ? 7_555 ? 5 AC1 5 CU C . ? CU A 202 . ? 1_555 ? 6 AC2 4 PHN B . ? PHN A 201 . ? 1_555 ? 7 AC2 4 PHN B . ? PHN A 201 . ? 7_555 ? 8 AC2 4 HOH D . ? HOH A 306 . ? 1_555 ? 9 AC2 4 HOH D . ? HOH A 306 . ? 7_555 ? # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CU _pdbx_struct_special_symmetry.auth_seq_id 202 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id CU _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A GLU 70 ? A GLU 70 6 1 Y 1 A SER 71 ? A SER 71 7 1 Y 1 A GLN 72 ? A GLN 72 8 1 Y 1 A GLY 73 ? A GLY 73 9 1 Y 1 A ASN 109 ? A ASN 109 10 1 Y 1 A LYS 110 ? A LYS 110 11 1 Y 1 A LYS 111 ? A LYS 111 12 1 Y 1 A SER 112 ? A SER 112 13 1 Y 1 A GLU 113 ? A GLU 113 14 1 Y 1 A ALA 114 ? A ALA 114 15 1 Y 1 A ILE 115 ? A ILE 115 16 1 Y 1 A LYS 116 ? A LYS 116 17 1 Y 1 A SER 117 ? A SER 117 18 1 Y 1 A ARG 118 ? A ARG 118 19 1 Y 1 A TRP 119 ? A TRP 119 20 1 Y 1 A SER 120 ? A SER 120 21 1 Y 1 A HIS 121 ? A HIS 121 22 1 Y 1 A PRO 122 ? A PRO 122 23 1 Y 1 A GLN 123 ? A GLN 123 24 1 Y 1 A PHE 124 ? A PHE 124 25 1 Y 1 A GLU 125 ? A GLU 125 26 1 Y 1 A LYS 126 ? A LYS 126 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PHN N1 N Y N 260 PHN C2 C Y N 261 PHN C3 C Y N 262 PHN C4 C Y N 263 PHN C4A C Y N 264 PHN C5 C Y N 265 PHN C6 C Y N 266 PHN C6A C Y N 267 PHN C7 C Y N 268 PHN C8 C Y N 269 PHN C9 C Y N 270 PHN N10 N Y N 271 PHN C10 C Y N 272 PHN C1A C Y N 273 PHN H2 H N N 274 PHN H3 H N N 275 PHN H4 H N N 276 PHN H5 H N N 277 PHN H6 H N N 278 PHN H7 H N N 279 PHN H8 H N N 280 PHN H9 H N N 281 PRO N N N N 282 PRO CA C N S 283 PRO C C N N 284 PRO O O N N 285 PRO CB C N N 286 PRO CG C N N 287 PRO CD C N N 288 PRO OXT O N N 289 PRO H H N N 290 PRO HA H N N 291 PRO HB2 H N N 292 PRO HB3 H N N 293 PRO HG2 H N N 294 PRO HG3 H N N 295 PRO HD2 H N N 296 PRO HD3 H N N 297 PRO HXT H N N 298 SER N N N N 299 SER CA C N S 300 SER C C N N 301 SER O O N N 302 SER CB C N N 303 SER OG O N N 304 SER OXT O N N 305 SER H H N N 306 SER H2 H N N 307 SER HA H N N 308 SER HB2 H N N 309 SER HB3 H N N 310 SER HG H N N 311 SER HXT H N N 312 THR N N N N 313 THR CA C N S 314 THR C C N N 315 THR O O N N 316 THR CB C N R 317 THR OG1 O N N 318 THR CG2 C N N 319 THR OXT O N N 320 THR H H N N 321 THR H2 H N N 322 THR HA H N N 323 THR HB H N N 324 THR HG1 H N N 325 THR HG21 H N N 326 THR HG22 H N N 327 THR HG23 H N N 328 THR HXT H N N 329 TRP N N N N 330 TRP CA C N S 331 TRP C C N N 332 TRP O O N N 333 TRP CB C N N 334 TRP CG C Y N 335 TRP CD1 C Y N 336 TRP CD2 C Y N 337 TRP NE1 N Y N 338 TRP CE2 C Y N 339 TRP CE3 C Y N 340 TRP CZ2 C Y N 341 TRP CZ3 C Y N 342 TRP CH2 C Y N 343 TRP OXT O N N 344 TRP H H N N 345 TRP H2 H N N 346 TRP HA H N N 347 TRP HB2 H N N 348 TRP HB3 H N N 349 TRP HD1 H N N 350 TRP HE1 H N N 351 TRP HE3 H N N 352 TRP HZ2 H N N 353 TRP HZ3 H N N 354 TRP HH2 H N N 355 TRP HXT H N N 356 TYR N N N N 357 TYR CA C N S 358 TYR C C N N 359 TYR O O N N 360 TYR CB C N N 361 TYR CG C Y N 362 TYR CD1 C Y N 363 TYR CD2 C Y N 364 TYR CE1 C Y N 365 TYR CE2 C Y N 366 TYR CZ C Y N 367 TYR OH O N N 368 TYR OXT O N N 369 TYR H H N N 370 TYR H2 H N N 371 TYR HA H N N 372 TYR HB2 H N N 373 TYR HB3 H N N 374 TYR HD1 H N N 375 TYR HD2 H N N 376 TYR HE1 H N N 377 TYR HE2 H N N 378 TYR HH H N N 379 TYR HXT H N N 380 VAL N N N N 381 VAL CA C N S 382 VAL C C N N 383 VAL O O N N 384 VAL CB C N N 385 VAL CG1 C N N 386 VAL CG2 C N N 387 VAL OXT O N N 388 VAL H H N N 389 VAL H2 H N N 390 VAL HA H N N 391 VAL HB H N N 392 VAL HG11 H N N 393 VAL HG12 H N N 394 VAL HG13 H N N 395 VAL HG21 H N N 396 VAL HG22 H N N 397 VAL HG23 H N N 398 VAL HXT H N N 399 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PHN N1 C2 doub Y N 247 PHN N1 C1A sing Y N 248 PHN C2 C3 sing Y N 249 PHN C2 H2 sing N N 250 PHN C3 C4 doub Y N 251 PHN C3 H3 sing N N 252 PHN C4 C4A sing Y N 253 PHN C4 H4 sing N N 254 PHN C4A C5 doub Y N 255 PHN C4A C1A sing Y N 256 PHN C5 C6 sing Y N 257 PHN C5 H5 sing N N 258 PHN C6 C6A doub Y N 259 PHN C6 H6 sing N N 260 PHN C6A C7 sing Y N 261 PHN C6A C10 sing Y N 262 PHN C7 C8 doub Y N 263 PHN C7 H7 sing N N 264 PHN C8 C9 sing Y N 265 PHN C8 H8 sing N N 266 PHN C9 N10 doub Y N 267 PHN C9 H9 sing N N 268 PHN N10 C10 sing Y N 269 PHN C10 C1A doub Y N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TRP N CA sing N N 317 TRP N H sing N N 318 TRP N H2 sing N N 319 TRP CA C sing N N 320 TRP CA CB sing N N 321 TRP CA HA sing N N 322 TRP C O doub N N 323 TRP C OXT sing N N 324 TRP CB CG sing N N 325 TRP CB HB2 sing N N 326 TRP CB HB3 sing N N 327 TRP CG CD1 doub Y N 328 TRP CG CD2 sing Y N 329 TRP CD1 NE1 sing Y N 330 TRP CD1 HD1 sing N N 331 TRP CD2 CE2 doub Y N 332 TRP CD2 CE3 sing Y N 333 TRP NE1 CE2 sing Y N 334 TRP NE1 HE1 sing N N 335 TRP CE2 CZ2 sing Y N 336 TRP CE3 CZ3 doub Y N 337 TRP CE3 HE3 sing N N 338 TRP CZ2 CH2 doub Y N 339 TRP CZ2 HZ2 sing N N 340 TRP CZ3 CH2 sing Y N 341 TRP CZ3 HZ3 sing N N 342 TRP CH2 HH2 sing N N 343 TRP OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 # _pdbx_audit_support.funding_organization 'Netherlands Organisation for Scientific Research' _pdbx_audit_support.country Netherlands _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3F8C _pdbx_initial_refinement_model.details 'PDB entry 3F8C' # _atom_sites.entry_id 6R1L _atom_sites.fract_transf_matrix[1][1] 0.028694 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028694 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005635 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CU N O S # loop_