data_6RPH # _entry.id 6RPH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6RPH WWPDB D_1292101099 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'closed-state (0-5 ms) of bacteriorhodopsin' _pdbx_database_related.db_id 6RNJ _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RPH _pdbx_database_status.recvd_initial_deposition_date 2019-05-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Weinert, T.' 1 0000-0002-0339-3722 'Skopintsev, P.' 2 ? 'James, D.' 3 ? 'Kekilli, D.' 4 ? 'Furrer, A.' 5 ? 'Bruenle, S.' 6 ? 'Mous, S.' 7 ? 'Nogly, P.' 8 ? 'Standfuss, J.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 365 _citation.language ? _citation.page_first 61 _citation.page_last 65 _citation.title 'Proton uptake mechanism in bacteriorhodopsin captured by serial synchrotron crystallography.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aaw8634 _citation.pdbx_database_id_PubMed 31273117 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weinert, T.' 1 0000-0002-0339-3722 primary 'Skopintsev, P.' 2 ? primary 'James, D.' 3 0000-0002-8348-6661 primary 'Dworkowski, F.' 4 0000-0001-5004-8684 primary 'Panepucci, E.' 5 0000-0003-3388-997X primary 'Kekilli, D.' 6 0000-0003-4422-923X primary 'Furrer, A.' 7 0000-0001-9894-6985 primary 'Brunle, S.' 8 0000-0002-8057-245X primary 'Mous, S.' 9 0000-0002-3532-5978 primary 'Ozerov, D.' 10 ? primary 'Nogly, P.' 11 0000-0002-8040-7753 primary 'Wang, M.' 12 0000-0002-5340-3036 primary 'Standfuss, J.' 13 0000-0001-8825-386X # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6RPH _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.000 _cell.length_a_esd ? _cell.length_b 62.000 _cell.length_b_esd ? _cell.length_c 110.300 _cell.length_c_esd ? _cell.volume 367188.882 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RPH _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall 'P 6c' _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Bacteriorhodopsin 26254.041 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name BR,Bacterioopsin,BO # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLT MVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLY ILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR ; _entity_poly.pdbx_seq_one_letter_code_can ;MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLT MVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLY ILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 GLU n 1 4 LEU n 1 5 LEU n 1 6 PRO n 1 7 THR n 1 8 ALA n 1 9 VAL n 1 10 GLU n 1 11 GLY n 1 12 VAL n 1 13 SER n 1 14 GLN n 1 15 ALA n 1 16 GLN n 1 17 ILE n 1 18 THR n 1 19 GLY n 1 20 ARG n 1 21 PRO n 1 22 GLU n 1 23 TRP n 1 24 ILE n 1 25 TRP n 1 26 LEU n 1 27 ALA n 1 28 LEU n 1 29 GLY n 1 30 THR n 1 31 ALA n 1 32 LEU n 1 33 MET n 1 34 GLY n 1 35 LEU n 1 36 GLY n 1 37 THR n 1 38 LEU n 1 39 TYR n 1 40 PHE n 1 41 LEU n 1 42 VAL n 1 43 LYS n 1 44 GLY n 1 45 MET n 1 46 GLY n 1 47 VAL n 1 48 SER n 1 49 ASP n 1 50 PRO n 1 51 ASP n 1 52 ALA n 1 53 LYS n 1 54 LYS n 1 55 PHE n 1 56 TYR n 1 57 ALA n 1 58 ILE n 1 59 THR n 1 60 THR n 1 61 LEU n 1 62 VAL n 1 63 PRO n 1 64 ALA n 1 65 ILE n 1 66 ALA n 1 67 PHE n 1 68 THR n 1 69 MET n 1 70 TYR n 1 71 LEU n 1 72 SER n 1 73 MET n 1 74 LEU n 1 75 LEU n 1 76 GLY n 1 77 TYR n 1 78 GLY n 1 79 LEU n 1 80 THR n 1 81 MET n 1 82 VAL n 1 83 PRO n 1 84 PHE n 1 85 GLY n 1 86 GLY n 1 87 GLU n 1 88 GLN n 1 89 ASN n 1 90 PRO n 1 91 ILE n 1 92 TYR n 1 93 TRP n 1 94 ALA n 1 95 ARG n 1 96 TYR n 1 97 ALA n 1 98 ASP n 1 99 TRP n 1 100 LEU n 1 101 PHE n 1 102 THR n 1 103 THR n 1 104 PRO n 1 105 LEU n 1 106 LEU n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 LEU n 1 111 ALA n 1 112 LEU n 1 113 LEU n 1 114 VAL n 1 115 ASP n 1 116 ALA n 1 117 ASP n 1 118 GLN n 1 119 GLY n 1 120 THR n 1 121 ILE n 1 122 LEU n 1 123 ALA n 1 124 LEU n 1 125 VAL n 1 126 GLY n 1 127 ALA n 1 128 ASP n 1 129 GLY n 1 130 ILE n 1 131 MET n 1 132 ILE n 1 133 GLY n 1 134 THR n 1 135 GLY n 1 136 LEU n 1 137 VAL n 1 138 GLY n 1 139 ALA n 1 140 LEU n 1 141 THR n 1 142 LYS n 1 143 VAL n 1 144 TYR n 1 145 SER n 1 146 TYR n 1 147 ARG n 1 148 PHE n 1 149 VAL n 1 150 TRP n 1 151 TRP n 1 152 ALA n 1 153 ILE n 1 154 SER n 1 155 THR n 1 156 ALA n 1 157 ALA n 1 158 MET n 1 159 LEU n 1 160 TYR n 1 161 ILE n 1 162 LEU n 1 163 TYR n 1 164 VAL n 1 165 LEU n 1 166 PHE n 1 167 PHE n 1 168 GLY n 1 169 PHE n 1 170 THR n 1 171 SER n 1 172 LYS n 1 173 ALA n 1 174 GLU n 1 175 SER n 1 176 MET n 1 177 ARG n 1 178 PRO n 1 179 GLU n 1 180 VAL n 1 181 ALA n 1 182 SER n 1 183 THR n 1 184 PHE n 1 185 LYS n 1 186 VAL n 1 187 LEU n 1 188 ARG n 1 189 ASN n 1 190 VAL n 1 191 THR n 1 192 VAL n 1 193 VAL n 1 194 LEU n 1 195 TRP n 1 196 SER n 1 197 ALA n 1 198 TYR n 1 199 PRO n 1 200 VAL n 1 201 VAL n 1 202 TRP n 1 203 LEU n 1 204 ILE n 1 205 GLY n 1 206 SER n 1 207 GLU n 1 208 GLY n 1 209 ALA n 1 210 GLY n 1 211 ILE n 1 212 VAL n 1 213 PRO n 1 214 LEU n 1 215 ASN n 1 216 ILE n 1 217 GLU n 1 218 THR n 1 219 LEU n 1 220 LEU n 1 221 PHE n 1 222 MET n 1 223 VAL n 1 224 LEU n 1 225 ASP n 1 226 VAL n 1 227 SER n 1 228 ALA n 1 229 LYS n 1 230 VAL n 1 231 GLY n 1 232 PHE n 1 233 GLY n 1 234 LEU n 1 235 ILE n 1 236 LEU n 1 237 LEU n 1 238 ARG n 1 239 SER n 1 240 ARG n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 240 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)' _entity_src_nat.pdbx_ncbi_taxonomy_id 64091 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain 'ATCC 700922 / JCM 11081 / NRC-1' _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BACR_HALSA _struct_ref.pdbx_db_accession P02945 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLT MVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLY ILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RPH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02945 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -12 _struct_ref_seq.pdbx_auth_seq_align_end 227 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RPH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Na/K Phosphate buffer pH 5.6 30 % PEG 2000' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 298 ? ? 1 ? ? ? 1 ? ? ? ? ? ? Y ? 298 ? ? 1 ? ? ? 2 ? ? ? ? ? ? Y ? 298 ? ? 1 ? ? ? 3 ? ? ? ? ? ? Y # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency ? PIXEL 1 'DECTRIS EIGER X 16M' ? ? ? ? 2018-07-22 ? ? PIXEL 2 'DECTRIS EIGER X 16M' ? ? ? ? 2018-07-22 ? ? PIXEL 3 'DECTRIS EIGER X 16M' ? ? ? ? 2018-07-22 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 3 ? ? ? ? ? ? ? ? 3 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.0 1.0 2 . 1.0 3 . 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'SLS BEAMLINE X06SA' ? ? 1.0 ? X06SA SLS ? ? 2 ? ? SYNCHROTRON ? 'SLS BEAMLINE X06SA' ? ? 1.0 ? X06SA SLS ? ? 3 ? ? SYNCHROTRON ? 'SLS BEAMLINE X06SA' ? ? 1.0 ? X06SA SLS # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split 58.16 6RPH ? ? 2.6 31.0 ? ? ? ? ? ? ? ? 6477 ? ? ? ? ? ? ? 87.3 ? ? ? ? ? ? 1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? 6RPH ? ? 2.3 38.5 ? ? ? ? ? ? ? ? 10589 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 254.9 ? ? ? ? 6.77 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 0.99 0.075 ? 6RPH ? ? 2.1 38.5 ? ? ? ? ? ? ? ? 13882 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 984.9 ? ? ? ? 13.3 ? ? ? ? ? ? ? ? ? ? ? ? 3 3 0.99 0.034 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.6 2.98 ? ? ? ? ? ? 1838 80 ? ? ? ? ? ? ? ? ? ? ? ? ? 1 ? ? ? ? ? ? ? 1 1 ? ? 2.3 2.37 ? 0.94 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 2 0.13 1.73 2.1 2.18 ? 1.33 ? ? ? ? ? 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 24.6 ? ? ? ? ? ? ? 3 3 0.52 0.86 # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 92.17 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RPH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 31.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6477 _refine.ls_number_reflns_R_free 410 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 87.33 _refine.ls_percent_reflns_R_free 6.33 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3202 _refine.ls_R_factor_R_free 0.3599 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3173 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.02 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 52.0519 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5951 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 31.00 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 1755 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1748 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0016 ? 1795 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3682 ? 2452 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0341 ? 288 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0033 ? 298 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 8.4725 ? 1023 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.60 2.98 . . 124 1838 80.08 . . . 0.5445 . 0.4718 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.98 3.75 . . 145 2016 87.99 . . . 0.4536 . 0.3607 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.75 31.00 . . 141 2213 93.75 . . . 0.2964 . 0.2739 . . . . . . . . . . # _struct.entry_id 6RPH _struct.title 'TR-SMX open state structure (10-15ms) of bacteriorhodopsin' _struct.pdbx_descriptor Bacteriorhodopsin _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RPH _struct_keywords.text 'Retinal, time resolved crystallography, serial crystallography, SMX, PROTON TRANSPORT' _struct_keywords.pdbx_keywords 'PROTON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 22 ? GLY A 44 ? GLU A 9 GLY A 31 1 ? 23 HELX_P HELX_P2 AA2 ASP A 49 ? LEU A 75 ? ASP A 36 LEU A 62 1 ? 27 HELX_P HELX_P3 AA3 TYR A 92 ? ASP A 115 ? TYR A 79 ASP A 102 1 ? 24 HELX_P HELX_P4 AA4 ASP A 117 ? LEU A 140 ? ASP A 104 LEU A 127 1 ? 24 HELX_P HELX_P5 AA5 VAL A 143 ? SER A 171 ? VAL A 130 SER A 158 1 ? 29 HELX_P HELX_P6 AA6 ARG A 177 ? GLY A 205 ? ARG A 164 GLY A 192 1 ? 29 HELX_P HELX_P7 AA7 PRO A 213 ? VAL A 230 ? PRO A 200 VAL A 217 1 ? 18 HELX_P HELX_P8 AA8 VAL A 230 ? ARG A 238 ? VAL A 217 ARG A 225 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 229 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id RET _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C15 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 216 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id RET _struct_conn.ptnr2_auth_seq_id 501 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.420 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 80 ? PHE A 84 ? THR A 67 PHE A 71 AA1 2 GLU A 87 ? ILE A 91 ? GLU A 74 ILE A 78 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 80 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 67 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 91 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 78 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id RET _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue RET A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 TRP A 99 ? TRP A 86 . ? 1_555 ? 2 AC1 12 THR A 103 ? THR A 90 . ? 1_555 ? 3 AC1 12 MET A 131 ? MET A 118 . ? 1_555 ? 4 AC1 12 TRP A 151 ? TRP A 138 . ? 1_555 ? 5 AC1 12 SER A 154 ? SER A 141 . ? 1_555 ? 6 AC1 12 THR A 155 ? THR A 142 . ? 1_555 ? 7 AC1 12 TRP A 195 ? TRP A 182 . ? 1_555 ? 8 AC1 12 TYR A 198 ? TYR A 185 . ? 1_555 ? 9 AC1 12 PRO A 199 ? PRO A 186 . ? 1_555 ? 10 AC1 12 TRP A 202 ? TRP A 189 . ? 1_555 ? 11 AC1 12 ASP A 225 ? ASP A 212 . ? 1_555 ? 12 AC1 12 LYS A 229 ? LYS A 216 . ? 1_555 ? # _atom_sites.entry_id 6RPH _atom_sites.fract_transf_matrix[1][1] 0.016129 _atom_sites.fract_transf_matrix[1][2] 0.009312 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018624 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009066 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 LEU 2 -11 ? ? ? A . n A 1 3 GLU 3 -10 ? ? ? A . n A 1 4 LEU 4 -9 ? ? ? A . n A 1 5 LEU 5 -8 ? ? ? A . n A 1 6 PRO 6 -7 ? ? ? A . n A 1 7 THR 7 -6 ? ? ? A . n A 1 8 ALA 8 -5 ? ? ? A . n A 1 9 VAL 9 -4 ? ? ? A . n A 1 10 GLU 10 -3 ? ? ? A . n A 1 11 GLY 11 -2 ? ? ? A . n A 1 12 VAL 12 -1 ? ? ? A . n A 1 13 SER 13 0 ? ? ? A . n A 1 14 GLN 14 1 ? ? ? A . n A 1 15 ALA 15 2 ? ? ? A . n A 1 16 GLN 16 3 ? ? ? A . n A 1 17 ILE 17 4 ? ? ? A . n A 1 18 THR 18 5 5 THR THR A . n A 1 19 GLY 19 6 6 GLY GLY A . n A 1 20 ARG 20 7 7 ARG ARG A . n A 1 21 PRO 21 8 8 PRO PRO A . n A 1 22 GLU 22 9 9 GLU GLU A . n A 1 23 TRP 23 10 10 TRP TRP A . n A 1 24 ILE 24 11 11 ILE ILE A . n A 1 25 TRP 25 12 12 TRP TRP A . n A 1 26 LEU 26 13 13 LEU LEU A . n A 1 27 ALA 27 14 14 ALA ALA A . n A 1 28 LEU 28 15 15 LEU LEU A . n A 1 29 GLY 29 16 16 GLY GLY A . n A 1 30 THR 30 17 17 THR THR A . n A 1 31 ALA 31 18 18 ALA ALA A . n A 1 32 LEU 32 19 19 LEU LEU A . n A 1 33 MET 33 20 20 MET MET A . n A 1 34 GLY 34 21 21 GLY GLY A . n A 1 35 LEU 35 22 22 LEU LEU A . n A 1 36 GLY 36 23 23 GLY GLY A . n A 1 37 THR 37 24 24 THR THR A . n A 1 38 LEU 38 25 25 LEU LEU A . n A 1 39 TYR 39 26 26 TYR TYR A . n A 1 40 PHE 40 27 27 PHE PHE A . n A 1 41 LEU 41 28 28 LEU LEU A . n A 1 42 VAL 42 29 29 VAL VAL A . n A 1 43 LYS 43 30 30 LYS LYS A . n A 1 44 GLY 44 31 31 GLY GLY A . n A 1 45 MET 45 32 32 MET MET A . n A 1 46 GLY 46 33 33 GLY GLY A . n A 1 47 VAL 47 34 34 VAL VAL A . n A 1 48 SER 48 35 35 SER SER A . n A 1 49 ASP 49 36 36 ASP ASP A . n A 1 50 PRO 50 37 37 PRO PRO A . n A 1 51 ASP 51 38 38 ASP ASP A . n A 1 52 ALA 52 39 39 ALA ALA A . n A 1 53 LYS 53 40 40 LYS LYS A . n A 1 54 LYS 54 41 41 LYS LYS A . n A 1 55 PHE 55 42 42 PHE PHE A . n A 1 56 TYR 56 43 43 TYR TYR A . n A 1 57 ALA 57 44 44 ALA ALA A . n A 1 58 ILE 58 45 45 ILE ILE A . n A 1 59 THR 59 46 46 THR THR A . n A 1 60 THR 60 47 47 THR THR A . n A 1 61 LEU 61 48 48 LEU LEU A . n A 1 62 VAL 62 49 49 VAL VAL A . n A 1 63 PRO 63 50 50 PRO PRO A . n A 1 64 ALA 64 51 51 ALA ALA A . n A 1 65 ILE 65 52 52 ILE ILE A . n A 1 66 ALA 66 53 53 ALA ALA A . n A 1 67 PHE 67 54 54 PHE PHE A . n A 1 68 THR 68 55 55 THR THR A . n A 1 69 MET 69 56 56 MET MET A . n A 1 70 TYR 70 57 57 TYR TYR A . n A 1 71 LEU 71 58 58 LEU LEU A . n A 1 72 SER 72 59 59 SER SER A . n A 1 73 MET 73 60 60 MET MET A . n A 1 74 LEU 74 61 61 LEU LEU A . n A 1 75 LEU 75 62 62 LEU LEU A . n A 1 76 GLY 76 63 63 GLY GLY A . n A 1 77 TYR 77 64 64 TYR TYR A . n A 1 78 GLY 78 65 65 GLY GLY A . n A 1 79 LEU 79 66 66 LEU LEU A . n A 1 80 THR 80 67 67 THR THR A . n A 1 81 MET 81 68 68 MET MET A . n A 1 82 VAL 82 69 69 VAL VAL A . n A 1 83 PRO 83 70 70 PRO PRO A . n A 1 84 PHE 84 71 71 PHE PHE A . n A 1 85 GLY 85 72 72 GLY GLY A . n A 1 86 GLY 86 73 73 GLY GLY A . n A 1 87 GLU 87 74 74 GLU GLU A . n A 1 88 GLN 88 75 75 GLN GLN A . n A 1 89 ASN 89 76 76 ASN ASN A . n A 1 90 PRO 90 77 77 PRO PRO A . n A 1 91 ILE 91 78 78 ILE ILE A . n A 1 92 TYR 92 79 79 TYR TYR A . n A 1 93 TRP 93 80 80 TRP TRP A . n A 1 94 ALA 94 81 81 ALA ALA A . n A 1 95 ARG 95 82 82 ARG ARG A . n A 1 96 TYR 96 83 83 TYR TYR A . n A 1 97 ALA 97 84 84 ALA ALA A . n A 1 98 ASP 98 85 85 ASP ASP A . n A 1 99 TRP 99 86 86 TRP TRP A . n A 1 100 LEU 100 87 87 LEU LEU A . n A 1 101 PHE 101 88 88 PHE PHE A . n A 1 102 THR 102 89 89 THR THR A . n A 1 103 THR 103 90 90 THR THR A . n A 1 104 PRO 104 91 91 PRO PRO A . n A 1 105 LEU 105 92 92 LEU LEU A . n A 1 106 LEU 106 93 93 LEU LEU A . n A 1 107 LEU 107 94 94 LEU LEU A . n A 1 108 LEU 108 95 95 LEU LEU A . n A 1 109 ASP 109 96 96 ASP ASP A . n A 1 110 LEU 110 97 97 LEU LEU A . n A 1 111 ALA 111 98 98 ALA ALA A . n A 1 112 LEU 112 99 99 LEU LEU A . n A 1 113 LEU 113 100 100 LEU LEU A . n A 1 114 VAL 114 101 101 VAL VAL A . n A 1 115 ASP 115 102 102 ASP ASP A . n A 1 116 ALA 116 103 103 ALA ALA A . n A 1 117 ASP 117 104 104 ASP ASP A . n A 1 118 GLN 118 105 105 GLN GLN A . n A 1 119 GLY 119 106 106 GLY GLY A . n A 1 120 THR 120 107 107 THR THR A . n A 1 121 ILE 121 108 108 ILE ILE A . n A 1 122 LEU 122 109 109 LEU LEU A . n A 1 123 ALA 123 110 110 ALA ALA A . n A 1 124 LEU 124 111 111 LEU LEU A . n A 1 125 VAL 125 112 112 VAL VAL A . n A 1 126 GLY 126 113 113 GLY GLY A . n A 1 127 ALA 127 114 114 ALA ALA A . n A 1 128 ASP 128 115 115 ASP ASP A . n A 1 129 GLY 129 116 116 GLY GLY A . n A 1 130 ILE 130 117 117 ILE ILE A . n A 1 131 MET 131 118 118 MET MET A . n A 1 132 ILE 132 119 119 ILE ILE A . n A 1 133 GLY 133 120 120 GLY GLY A . n A 1 134 THR 134 121 121 THR THR A . n A 1 135 GLY 135 122 122 GLY GLY A . n A 1 136 LEU 136 123 123 LEU LEU A . n A 1 137 VAL 137 124 124 VAL VAL A . n A 1 138 GLY 138 125 125 GLY GLY A . n A 1 139 ALA 139 126 126 ALA ALA A . n A 1 140 LEU 140 127 127 LEU LEU A . n A 1 141 THR 141 128 128 THR THR A . n A 1 142 LYS 142 129 129 LYS LYS A . n A 1 143 VAL 143 130 130 VAL VAL A . n A 1 144 TYR 144 131 131 TYR TYR A . n A 1 145 SER 145 132 132 SER SER A . n A 1 146 TYR 146 133 133 TYR TYR A . n A 1 147 ARG 147 134 134 ARG ARG A . n A 1 148 PHE 148 135 135 PHE PHE A . n A 1 149 VAL 149 136 136 VAL VAL A . n A 1 150 TRP 150 137 137 TRP TRP A . n A 1 151 TRP 151 138 138 TRP TRP A . n A 1 152 ALA 152 139 139 ALA ALA A . n A 1 153 ILE 153 140 140 ILE ILE A . n A 1 154 SER 154 141 141 SER SER A . n A 1 155 THR 155 142 142 THR THR A . n A 1 156 ALA 156 143 143 ALA ALA A . n A 1 157 ALA 157 144 144 ALA ALA A . n A 1 158 MET 158 145 145 MET MET A . n A 1 159 LEU 159 146 146 LEU LEU A . n A 1 160 TYR 160 147 147 TYR TYR A . n A 1 161 ILE 161 148 148 ILE ILE A . n A 1 162 LEU 162 149 149 LEU LEU A . n A 1 163 TYR 163 150 150 TYR TYR A . n A 1 164 VAL 164 151 151 VAL VAL A . n A 1 165 LEU 165 152 152 LEU LEU A . n A 1 166 PHE 166 153 153 PHE PHE A . n A 1 167 PHE 167 154 154 PHE PHE A . n A 1 168 GLY 168 155 155 GLY GLY A . n A 1 169 PHE 169 156 156 PHE PHE A . n A 1 170 THR 170 157 157 THR THR A . n A 1 171 SER 171 158 158 SER SER A . n A 1 172 LYS 172 159 159 LYS LYS A . n A 1 173 ALA 173 160 160 ALA ALA A . n A 1 174 GLU 174 161 161 GLU GLU A . n A 1 175 SER 175 162 162 SER SER A . n A 1 176 MET 176 163 163 MET MET A . n A 1 177 ARG 177 164 164 ARG ARG A . n A 1 178 PRO 178 165 165 PRO PRO A . n A 1 179 GLU 179 166 166 GLU GLU A . n A 1 180 VAL 180 167 167 VAL VAL A . n A 1 181 ALA 181 168 168 ALA ALA A . n A 1 182 SER 182 169 169 SER SER A . n A 1 183 THR 183 170 170 THR THR A . n A 1 184 PHE 184 171 171 PHE PHE A . n A 1 185 LYS 185 172 172 LYS LYS A . n A 1 186 VAL 186 173 173 VAL VAL A . n A 1 187 LEU 187 174 174 LEU LEU A . n A 1 188 ARG 188 175 175 ARG ARG A . n A 1 189 ASN 189 176 176 ASN ASN A . n A 1 190 VAL 190 177 177 VAL VAL A . n A 1 191 THR 191 178 178 THR THR A . n A 1 192 VAL 192 179 179 VAL VAL A . n A 1 193 VAL 193 180 180 VAL VAL A . n A 1 194 LEU 194 181 181 LEU LEU A . n A 1 195 TRP 195 182 182 TRP TRP A . n A 1 196 SER 196 183 183 SER SER A . n A 1 197 ALA 197 184 184 ALA ALA A . n A 1 198 TYR 198 185 185 TYR TYR A . n A 1 199 PRO 199 186 186 PRO PRO A . n A 1 200 VAL 200 187 187 VAL VAL A . n A 1 201 VAL 201 188 188 VAL VAL A . n A 1 202 TRP 202 189 189 TRP TRP A . n A 1 203 LEU 203 190 190 LEU LEU A . n A 1 204 ILE 204 191 191 ILE ILE A . n A 1 205 GLY 205 192 192 GLY GLY A . n A 1 206 SER 206 193 193 SER SER A . n A 1 207 GLU 207 194 194 GLU GLU A . n A 1 208 GLY 208 195 195 GLY GLY A . n A 1 209 ALA 209 196 196 ALA ALA A . n A 1 210 GLY 210 197 197 GLY GLY A . n A 1 211 ILE 211 198 198 ILE ILE A . n A 1 212 VAL 212 199 199 VAL VAL A . n A 1 213 PRO 213 200 200 PRO PRO A . n A 1 214 LEU 214 201 201 LEU LEU A . n A 1 215 ASN 215 202 202 ASN ASN A . n A 1 216 ILE 216 203 203 ILE ILE A . n A 1 217 GLU 217 204 204 GLU GLU A . n A 1 218 THR 218 205 205 THR THR A . n A 1 219 LEU 219 206 206 LEU LEU A . n A 1 220 LEU 220 207 207 LEU LEU A . n A 1 221 PHE 221 208 208 PHE PHE A . n A 1 222 MET 222 209 209 MET MET A . n A 1 223 VAL 223 210 210 VAL VAL A . n A 1 224 LEU 224 211 211 LEU LEU A . n A 1 225 ASP 225 212 212 ASP ASP A . n A 1 226 VAL 226 213 213 VAL VAL A . n A 1 227 SER 227 214 214 SER SER A . n A 1 228 ALA 228 215 215 ALA ALA A . n A 1 229 LYS 229 216 216 LYS LYS A . n A 1 230 VAL 230 217 217 VAL VAL A . n A 1 231 GLY 231 218 218 GLY GLY A . n A 1 232 PHE 232 219 219 PHE PHE A . n A 1 233 GLY 233 220 220 GLY GLY A . n A 1 234 LEU 234 221 221 LEU LEU A . n A 1 235 ILE 235 222 222 ILE ILE A . n A 1 236 LEU 236 223 223 LEU LEU A . n A 1 237 LEU 237 224 224 LEU LEU A . n A 1 238 ARG 238 225 225 ARG ARG A . n A 1 239 SER 239 226 226 SER SER A . n A 1 240 ARG 240 227 227 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 501 501 RET RET A . C 3 HOH 1 453 453 HOH HOH A . C 3 HOH 2 458 6 HOH HOH A . C 3 HOH 3 451 451 HOH HOH A . C 3 HOH 4 403 403 HOH HOH A . C 3 HOH 5 406 406 HOH HOH A . C 3 HOH 6 404 404 HOH HOH A . C 3 HOH 7 454 454 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6460 ? 1 MORE -51 ? 1 'SSA (A^2)' 29280 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 31.0000000000 0.8660254038 -0.5000000000 0.0000000000 53.6935750346 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -31.0000000000 -0.8660254038 -0.5000000000 0.0000000000 53.6935750346 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-17 2 'Structure model' 2 0 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_site_anisotrop 3 2 'Structure model' pdbx_nonpoly_scheme 4 2 'Structure model' pdbx_validate_close_contact # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.auth_seq_id' 2 2 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 3 2 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num' 4 2 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 17.3727838803 _pdbx_refine_tls.origin_y 39.5874483686 _pdbx_refine_tls.origin_z 36.1591924597 _pdbx_refine_tls.T[1][1] 0.289842447348 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0211474326615 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0800332586199 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.414010604095 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0357636784923 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.563079957839 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.37772496754 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.874924624088 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.647410256314 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.36362872118 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.196618946642 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.10523823566 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0622769468753 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.142586650849 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0897547541725 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0789991643264 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0787203022347 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.087373560563 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.033226123333 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.171061627379 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0888945165204 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 215 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 453 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.02 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 161 ? ? -79.53 -155.03 2 1 SER A 162 ? ? 62.57 -125.82 3 1 ARG A 164 ? ? -158.18 69.08 4 1 ARG A 225 ? ? -87.68 31.64 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A LEU -11 ? A LEU 2 3 1 Y 1 A GLU -10 ? A GLU 3 4 1 Y 1 A LEU -9 ? A LEU 4 5 1 Y 1 A LEU -8 ? A LEU 5 6 1 Y 1 A PRO -7 ? A PRO 6 7 1 Y 1 A THR -6 ? A THR 7 8 1 Y 1 A ALA -5 ? A ALA 8 9 1 Y 1 A VAL -4 ? A VAL 9 10 1 Y 1 A GLU -3 ? A GLU 10 11 1 Y 1 A GLY -2 ? A GLY 11 12 1 Y 1 A VAL -1 ? A VAL 12 13 1 Y 1 A SER 0 ? A SER 13 14 1 Y 1 A GLN 1 ? A GLN 14 15 1 Y 1 A ALA 2 ? A ALA 15 16 1 Y 1 A GLN 3 ? A GLN 16 17 1 Y 1 A ILE 4 ? A ILE 17 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id RET _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id RET _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 water HOH # loop_ _pdbx_serial_crystallography_sample_delivery.diffrn_id _pdbx_serial_crystallography_sample_delivery.description _pdbx_serial_crystallography_sample_delivery.method 1 ? injection 2 ? injection 3 ? injection # loop_ _pdbx_serial_crystallography_sample_delivery_injection.diffrn_id _pdbx_serial_crystallography_sample_delivery_injection.description _pdbx_serial_crystallography_sample_delivery_injection.injector_diameter _pdbx_serial_crystallography_sample_delivery_injection.injector_temperature _pdbx_serial_crystallography_sample_delivery_injection.injector_pressure _pdbx_serial_crystallography_sample_delivery_injection.flow_rate _pdbx_serial_crystallography_sample_delivery_injection.carrier_solvent _pdbx_serial_crystallography_sample_delivery_injection.crystal_concentration _pdbx_serial_crystallography_sample_delivery_injection.preparation _pdbx_serial_crystallography_sample_delivery_injection.power_by _pdbx_serial_crystallography_sample_delivery_injection.injector_nozzle _pdbx_serial_crystallography_sample_delivery_injection.jet_diameter _pdbx_serial_crystallography_sample_delivery_injection.filter_size 1 ? ? ? ? ? LCP ? ? ? ? 50 ? 2 ? ? ? ? ? LCP ? ? ? ? 50 ? 3 ? ? ? ? ? LCP ? ? ? ? 50 ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.id 1 _space_group.name_H-M_alt 'P 63' _space_group.name_Hall 'P 6c' _space_group.IT_number 173 _space_group.crystal_system hexagonal # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/2 3 y,-x+y,z+1/2 4 -y,x-y,z 5 -x+y,-x,z 6 -x,-y,z+1/2 #