data_6YIL # _entry.id 6YIL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YIL pdb_00006yil 10.2210/pdb6yil/pdb WWPDB D_1292107697 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-15 2 'Structure model' 1 1 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YIL _pdbx_database_status.recvd_initial_deposition_date 2020-04-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Picaud, S.' 1 ? 'Brand, M.' 2 ? 'Tobias, K.' 3 ? 'von Delft, F.' 4 ? 'Arrowsmith, C.H.' 5 ? 'Edwards, A.M.' 6 ? 'Bountra, C.' 7 ? 'Conway, S.' 8 ? 'Filippakopoulos, P.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the CREBBP bromodomain in complex with a tetrahydroquinoxaline ligand' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Picaud, S.' 1 ? primary 'Brand, M.' 2 ? primary 'Tobias, K.' 3 ? primary 'von Delft, F.' 4 ? primary 'Arrowsmith, C.H.' 5 ? primary 'Edwards, A.M.' 6 ? primary 'Bountra, C.' 7 ? primary 'Conway, S.' 8 ? primary 'Filippakopoulos, P.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CREBBP 14223.349 1 2.3.1.48,2.3.1.- ? ? ? 2 non-polymer syn ;(3~{R})-~{N}-[3-(3,4-dihydro-2~{H}-quinolin-1-yl)-2,2-bis(fluoranyl)propyl]-3-methyl-2-oxidanylidene-3,4-dihydro-1~{H}-quinoxaline-5-carboxamide ; 414.448 1 ? ? ? ? 3 water nat water 18.015 154 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_seq_one_letter_code_can ;SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(3~{R})-~{N}-[3-(3,4-dihydro-2~{H}-quinolin-1-yl)-2,2-bis(fluoranyl)propyl]-3-methyl-2-oxidanylidene-3,4-dihydro-1~{H}-quinoxaline-5-carboxamide ; OSQ 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ARG n 1 4 LYS n 1 5 LYS n 1 6 ILE n 1 7 PHE n 1 8 LYS n 1 9 PRO n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 ARG n 1 14 GLN n 1 15 ALA n 1 16 LEU n 1 17 MET n 1 18 PRO n 1 19 THR n 1 20 LEU n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 TYR n 1 25 ARG n 1 26 GLN n 1 27 ASP n 1 28 PRO n 1 29 GLU n 1 30 SER n 1 31 LEU n 1 32 PRO n 1 33 PHE n 1 34 ARG n 1 35 GLN n 1 36 PRO n 1 37 VAL n 1 38 ASP n 1 39 PRO n 1 40 GLN n 1 41 LEU n 1 42 LEU n 1 43 GLY n 1 44 ILE n 1 45 PRO n 1 46 ASP n 1 47 TYR n 1 48 PHE n 1 49 ASP n 1 50 ILE n 1 51 VAL n 1 52 LYS n 1 53 ASN n 1 54 PRO n 1 55 MET n 1 56 ASP n 1 57 LEU n 1 58 SER n 1 59 THR n 1 60 ILE n 1 61 LYS n 1 62 ARG n 1 63 LYS n 1 64 LEU n 1 65 ASP n 1 66 THR n 1 67 GLY n 1 68 GLN n 1 69 TYR n 1 70 GLN n 1 71 GLU n 1 72 PRO n 1 73 TRP n 1 74 GLN n 1 75 TYR n 1 76 VAL n 1 77 ASP n 1 78 ASP n 1 79 VAL n 1 80 TRP n 1 81 LEU n 1 82 MET n 1 83 PHE n 1 84 ASN n 1 85 ASN n 1 86 ALA n 1 87 TRP n 1 88 LEU n 1 89 TYR n 1 90 ASN n 1 91 ARG n 1 92 LYS n 1 93 THR n 1 94 SER n 1 95 ARG n 1 96 VAL n 1 97 TYR n 1 98 LYS n 1 99 PHE n 1 100 CYS n 1 101 SER n 1 102 LYS n 1 103 LEU n 1 104 ALA n 1 105 GLU n 1 106 VAL n 1 107 PHE n 1 108 GLU n 1 109 GLN n 1 110 GLU n 1 111 ILE n 1 112 ASP n 1 113 PRO n 1 114 VAL n 1 115 MET n 1 116 GLN n 1 117 SER n 1 118 LEU n 1 119 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 119 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OSQ non-polymer . ;(3~{R})-~{N}-[3-(3,4-dihydro-2~{H}-quinolin-1-yl)-2,2-bis(fluoranyl)propyl]-3-methyl-2-oxidanylidene-3,4-dihydro-1~{H}-quinoxaline-5-carboxamide ; ? 'C22 H24 F2 N4 O2' 414.448 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1079 ? ? ? A . n A 1 2 MET 2 1080 ? ? ? A . n A 1 3 ARG 3 1081 ? ? ? A . n A 1 4 LYS 4 1082 ? ? ? A . n A 1 5 LYS 5 1083 ? ? ? A . n A 1 6 ILE 6 1084 ? ? ? A . n A 1 7 PHE 7 1085 1085 PHE PHE A . n A 1 8 LYS 8 1086 1086 LYS LYS A . n A 1 9 PRO 9 1087 1087 PRO PRO A . n A 1 10 GLU 10 1088 1088 GLU GLU A . n A 1 11 GLU 11 1089 1089 GLU GLU A . n A 1 12 LEU 12 1090 1090 LEU LEU A . n A 1 13 ARG 13 1091 1091 ARG ARG A . n A 1 14 GLN 14 1092 1092 GLN GLN A . n A 1 15 ALA 15 1093 1093 ALA ALA A . n A 1 16 LEU 16 1094 1094 LEU LEU A . n A 1 17 MET 17 1095 1095 MET MET A . n A 1 18 PRO 18 1096 1096 PRO PRO A . n A 1 19 THR 19 1097 1097 THR THR A . n A 1 20 LEU 20 1098 1098 LEU LEU A . n A 1 21 GLU 21 1099 1099 GLU GLU A . n A 1 22 ALA 22 1100 1100 ALA ALA A . n A 1 23 LEU 23 1101 1101 LEU LEU A . n A 1 24 TYR 24 1102 1102 TYR TYR A . n A 1 25 ARG 25 1103 1103 ARG ARG A . n A 1 26 GLN 26 1104 1104 GLN GLN A . n A 1 27 ASP 27 1105 1105 ASP ASP A . n A 1 28 PRO 28 1106 1106 PRO PRO A . n A 1 29 GLU 29 1107 1107 GLU GLU A . n A 1 30 SER 30 1108 1108 SER SER A . n A 1 31 LEU 31 1109 1109 LEU LEU A . n A 1 32 PRO 32 1110 1110 PRO PRO A . n A 1 33 PHE 33 1111 1111 PHE PHE A . n A 1 34 ARG 34 1112 1112 ARG ARG A . n A 1 35 GLN 35 1113 1113 GLN GLN A . n A 1 36 PRO 36 1114 1114 PRO PRO A . n A 1 37 VAL 37 1115 1115 VAL VAL A . n A 1 38 ASP 38 1116 1116 ASP ASP A . n A 1 39 PRO 39 1117 1117 PRO PRO A . n A 1 40 GLN 40 1118 1118 GLN GLN A . n A 1 41 LEU 41 1119 1119 LEU LEU A . n A 1 42 LEU 42 1120 1120 LEU LEU A . n A 1 43 GLY 43 1121 1121 GLY GLY A . n A 1 44 ILE 44 1122 1122 ILE ILE A . n A 1 45 PRO 45 1123 1123 PRO PRO A . n A 1 46 ASP 46 1124 1124 ASP ASP A . n A 1 47 TYR 47 1125 1125 TYR TYR A . n A 1 48 PHE 48 1126 1126 PHE PHE A . n A 1 49 ASP 49 1127 1127 ASP ASP A . n A 1 50 ILE 50 1128 1128 ILE ILE A . n A 1 51 VAL 51 1129 1129 VAL VAL A . n A 1 52 LYS 52 1130 1130 LYS LYS A . n A 1 53 ASN 53 1131 1131 ASN ASN A . n A 1 54 PRO 54 1132 1132 PRO PRO A . n A 1 55 MET 55 1133 1133 MET MET A . n A 1 56 ASP 56 1134 1134 ASP ASP A . n A 1 57 LEU 57 1135 1135 LEU LEU A . n A 1 58 SER 58 1136 1136 SER SER A . n A 1 59 THR 59 1137 1137 THR THR A . n A 1 60 ILE 60 1138 1138 ILE ILE A . n A 1 61 LYS 61 1139 1139 LYS LYS A . n A 1 62 ARG 62 1140 1140 ARG ARG A . n A 1 63 LYS 63 1141 1141 LYS LYS A . n A 1 64 LEU 64 1142 1142 LEU LEU A . n A 1 65 ASP 65 1143 1143 ASP ASP A . n A 1 66 THR 66 1144 1144 THR THR A . n A 1 67 GLY 67 1145 1145 GLY GLY A . n A 1 68 GLN 68 1146 1146 GLN GLN A . n A 1 69 TYR 69 1147 1147 TYR TYR A . n A 1 70 GLN 70 1148 1148 GLN GLN A . n A 1 71 GLU 71 1149 1149 GLU GLU A . n A 1 72 PRO 72 1150 1150 PRO PRO A . n A 1 73 TRP 73 1151 1151 TRP TRP A . n A 1 74 GLN 74 1152 1152 GLN GLN A . n A 1 75 TYR 75 1153 1153 TYR TYR A . n A 1 76 VAL 76 1154 1154 VAL VAL A . n A 1 77 ASP 77 1155 1155 ASP ASP A . n A 1 78 ASP 78 1156 1156 ASP ASP A . n A 1 79 VAL 79 1157 1157 VAL VAL A . n A 1 80 TRP 80 1158 1158 TRP TRP A . n A 1 81 LEU 81 1159 1159 LEU LEU A . n A 1 82 MET 82 1160 1160 MET MET A . n A 1 83 PHE 83 1161 1161 PHE PHE A . n A 1 84 ASN 84 1162 1162 ASN ASN A . n A 1 85 ASN 85 1163 1163 ASN ASN A . n A 1 86 ALA 86 1164 1164 ALA ALA A . n A 1 87 TRP 87 1165 1165 TRP TRP A . n A 1 88 LEU 88 1166 1166 LEU LEU A . n A 1 89 TYR 89 1167 1167 TYR TYR A . n A 1 90 ASN 90 1168 1168 ASN ASN A . n A 1 91 ARG 91 1169 1169 ARG ARG A . n A 1 92 LYS 92 1170 1170 LYS LYS A . n A 1 93 THR 93 1171 1171 THR THR A . n A 1 94 SER 94 1172 1172 SER SER A . n A 1 95 ARG 95 1173 1173 ARG ARG A . n A 1 96 VAL 96 1174 1174 VAL VAL A . n A 1 97 TYR 97 1175 1175 TYR TYR A . n A 1 98 LYS 98 1176 1176 LYS LYS A . n A 1 99 PHE 99 1177 1177 PHE PHE A . n A 1 100 CYS 100 1178 1178 CYS CYS A . n A 1 101 SER 101 1179 1179 SER SER A . n A 1 102 LYS 102 1180 1180 LYS LYS A . n A 1 103 LEU 103 1181 1181 LEU LEU A . n A 1 104 ALA 104 1182 1182 ALA ALA A . n A 1 105 GLU 105 1183 1183 GLU GLU A . n A 1 106 VAL 106 1184 1184 VAL VAL A . n A 1 107 PHE 107 1185 1185 PHE PHE A . n A 1 108 GLU 108 1186 1186 GLU GLU A . n A 1 109 GLN 109 1187 1187 GLN GLN A . n A 1 110 GLU 110 1188 1188 GLU GLU A . n A 1 111 ILE 111 1189 1189 ILE ILE A . n A 1 112 ASP 112 1190 1190 ASP ASP A . n A 1 113 PRO 113 1191 1191 PRO PRO A . n A 1 114 VAL 114 1192 1192 VAL VAL A . n A 1 115 MET 115 1193 1193 MET MET A . n A 1 116 GLN 116 1194 1194 GLN GLN A . n A 1 117 SER 117 1195 1195 SER SER A . n A 1 118 LEU 118 1196 1196 LEU LEU A . n A 1 119 GLY 119 1197 1197 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 OSQ 1 1201 1 OSQ DRG A . C 3 HOH 1 1301 69 HOH HOH A . C 3 HOH 2 1302 50 HOH HOH A . C 3 HOH 3 1303 88 HOH HOH A . C 3 HOH 4 1304 3 HOH HOH A . C 3 HOH 5 1305 190 HOH HOH A . C 3 HOH 6 1306 192 HOH HOH A . C 3 HOH 7 1307 61 HOH HOH A . C 3 HOH 8 1308 39 HOH HOH A . C 3 HOH 9 1309 11 HOH HOH A . C 3 HOH 10 1310 36 HOH HOH A . C 3 HOH 11 1311 15 HOH HOH A . C 3 HOH 12 1312 21 HOH HOH A . C 3 HOH 13 1313 74 HOH HOH A . C 3 HOH 14 1314 53 HOH HOH A . C 3 HOH 15 1315 40 HOH HOH A . C 3 HOH 16 1316 193 HOH HOH A . C 3 HOH 17 1317 45 HOH HOH A . C 3 HOH 18 1318 75 HOH HOH A . C 3 HOH 19 1319 116 HOH HOH A . C 3 HOH 20 1320 6 HOH HOH A . C 3 HOH 21 1321 64 HOH HOH A . C 3 HOH 22 1322 47 HOH HOH A . C 3 HOH 23 1323 142 HOH HOH A . C 3 HOH 24 1324 16 HOH HOH A . C 3 HOH 25 1325 56 HOH HOH A . C 3 HOH 26 1326 185 HOH HOH A . C 3 HOH 27 1327 89 HOH HOH A . C 3 HOH 28 1328 133 HOH HOH A . C 3 HOH 29 1329 157 HOH HOH A . C 3 HOH 30 1330 12 HOH HOH A . C 3 HOH 31 1331 55 HOH HOH A . C 3 HOH 32 1332 127 HOH HOH A . C 3 HOH 33 1333 182 HOH HOH A . C 3 HOH 34 1334 52 HOH HOH A . C 3 HOH 35 1335 57 HOH HOH A . C 3 HOH 36 1336 33 HOH HOH A . C 3 HOH 37 1337 49 HOH HOH A . C 3 HOH 38 1338 14 HOH HOH A . C 3 HOH 39 1339 62 HOH HOH A . C 3 HOH 40 1340 10 HOH HOH A . C 3 HOH 41 1341 119 HOH HOH A . C 3 HOH 42 1342 58 HOH HOH A . C 3 HOH 43 1343 72 HOH HOH A . C 3 HOH 44 1344 23 HOH HOH A . C 3 HOH 45 1345 172 HOH HOH A . C 3 HOH 46 1346 18 HOH HOH A . C 3 HOH 47 1347 128 HOH HOH A . C 3 HOH 48 1348 65 HOH HOH A . C 3 HOH 49 1349 137 HOH HOH A . C 3 HOH 50 1350 2 HOH HOH A . C 3 HOH 51 1351 90 HOH HOH A . C 3 HOH 52 1352 19 HOH HOH A . C 3 HOH 53 1353 4 HOH HOH A . C 3 HOH 54 1354 60 HOH HOH A . C 3 HOH 55 1355 115 HOH HOH A . C 3 HOH 56 1356 126 HOH HOH A . C 3 HOH 57 1357 51 HOH HOH A . C 3 HOH 58 1358 34 HOH HOH A . C 3 HOH 59 1359 13 HOH HOH A . C 3 HOH 60 1360 8 HOH HOH A . C 3 HOH 61 1361 30 HOH HOH A . C 3 HOH 62 1362 96 HOH HOH A . C 3 HOH 63 1363 111 HOH HOH A . C 3 HOH 64 1364 48 HOH HOH A . C 3 HOH 65 1365 122 HOH HOH A . C 3 HOH 66 1366 146 HOH HOH A . C 3 HOH 67 1367 28 HOH HOH A . C 3 HOH 68 1368 26 HOH HOH A . C 3 HOH 69 1369 29 HOH HOH A . C 3 HOH 70 1370 44 HOH HOH A . C 3 HOH 71 1371 161 HOH HOH A . C 3 HOH 72 1372 43 HOH HOH A . C 3 HOH 73 1373 151 HOH HOH A . C 3 HOH 74 1374 145 HOH HOH A . C 3 HOH 75 1375 70 HOH HOH A . C 3 HOH 76 1376 176 HOH HOH A . C 3 HOH 77 1377 82 HOH HOH A . C 3 HOH 78 1378 37 HOH HOH A . C 3 HOH 79 1379 63 HOH HOH A . C 3 HOH 80 1380 189 HOH HOH A . C 3 HOH 81 1381 35 HOH HOH A . C 3 HOH 82 1382 77 HOH HOH A . C 3 HOH 83 1383 156 HOH HOH A . C 3 HOH 84 1384 84 HOH HOH A . C 3 HOH 85 1385 67 HOH HOH A . C 3 HOH 86 1386 27 HOH HOH A . C 3 HOH 87 1387 148 HOH HOH A . C 3 HOH 88 1388 25 HOH HOH A . C 3 HOH 89 1389 149 HOH HOH A . C 3 HOH 90 1390 130 HOH HOH A . C 3 HOH 91 1391 139 HOH HOH A . C 3 HOH 92 1392 186 HOH HOH A . C 3 HOH 93 1393 22 HOH HOH A . C 3 HOH 94 1394 168 HOH HOH A . C 3 HOH 95 1395 83 HOH HOH A . C 3 HOH 96 1396 78 HOH HOH A . C 3 HOH 97 1397 87 HOH HOH A . C 3 HOH 98 1398 80 HOH HOH A . C 3 HOH 99 1399 68 HOH HOH A . C 3 HOH 100 1400 138 HOH HOH A . C 3 HOH 101 1401 163 HOH HOH A . C 3 HOH 102 1402 136 HOH HOH A . C 3 HOH 103 1403 170 HOH HOH A . C 3 HOH 104 1404 41 HOH HOH A . C 3 HOH 105 1405 164 HOH HOH A . C 3 HOH 106 1406 147 HOH HOH A . C 3 HOH 107 1407 123 HOH HOH A . C 3 HOH 108 1408 175 HOH HOH A . C 3 HOH 109 1409 66 HOH HOH A . C 3 HOH 110 1410 177 HOH HOH A . C 3 HOH 111 1411 114 HOH HOH A . C 3 HOH 112 1412 173 HOH HOH A . C 3 HOH 113 1413 153 HOH HOH A . C 3 HOH 114 1414 106 HOH HOH A . C 3 HOH 115 1415 187 HOH HOH A . C 3 HOH 116 1416 140 HOH HOH A . C 3 HOH 117 1417 162 HOH HOH A . C 3 HOH 118 1418 183 HOH HOH A . C 3 HOH 119 1419 143 HOH HOH A . C 3 HOH 120 1420 158 HOH HOH A . C 3 HOH 121 1421 184 HOH HOH A . C 3 HOH 122 1422 188 HOH HOH A . C 3 HOH 123 1423 181 HOH HOH A . C 3 HOH 124 1424 121 HOH HOH A . C 3 HOH 125 1425 125 HOH HOH A . C 3 HOH 126 1426 141 HOH HOH A . C 3 HOH 127 1427 159 HOH HOH A . C 3 HOH 128 1428 171 HOH HOH A . C 3 HOH 129 1429 165 HOH HOH A . C 3 HOH 130 1430 117 HOH HOH A . C 3 HOH 131 1431 108 HOH HOH A . C 3 HOH 132 1432 180 HOH HOH A . C 3 HOH 133 1433 93 HOH HOH A . C 3 HOH 134 1434 104 HOH HOH A . C 3 HOH 135 1435 134 HOH HOH A . C 3 HOH 136 1436 169 HOH HOH A . C 3 HOH 137 1437 160 HOH HOH A . C 3 HOH 138 1438 155 HOH HOH A . C 3 HOH 139 1439 76 HOH HOH A . C 3 HOH 140 1440 152 HOH HOH A . C 3 HOH 141 1441 102 HOH HOH A . C 3 HOH 142 1442 174 HOH HOH A . C 3 HOH 143 1443 95 HOH HOH A . C 3 HOH 144 1444 107 HOH HOH A . C 3 HOH 145 1445 120 HOH HOH A . C 3 HOH 146 1446 167 HOH HOH A . C 3 HOH 147 1447 150 HOH HOH A . C 3 HOH 148 1448 179 HOH HOH A . C 3 HOH 149 1449 129 HOH HOH A . C 3 HOH 150 1450 195 HOH HOH A . C 3 HOH 151 1451 191 HOH HOH A . C 3 HOH 152 1452 194 HOH HOH A . C 3 HOH 153 1453 97 HOH HOH A . C 3 HOH 154 1454 154 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 1187 ? CD ? A GLN 109 CD 2 1 Y 1 A GLN 1187 ? OE1 ? A GLN 109 OE1 3 1 Y 1 A GLN 1187 ? NE2 ? A GLN 109 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.22 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.7 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0131 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 107.290 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YIL _cell.details ? _cell.formula_units_Z ? _cell.length_a 94.260 _cell.length_a_esd ? _cell.length_b 34.620 _cell.length_b_esd ? _cell.length_c 40.110 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YIL _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YIL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.01 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;20% PEG3350 10% ethylene glycol 0.2M sodium acetate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-09-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6YIL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.220 _reflns.d_resolution_low 38.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35941 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.000 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.061 _reflns.pdbx_netI_over_av_sigmaI 4.500 _reflns.pdbx_netI_over_sigmaI 15.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.074 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.220 1.290 ? 8.300 ? ? ? ? 5117 95.100 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 2.900 0.072 ? ? ? 0.088 0.050 ? 1 1 ? ? ? 1.290 1.360 ? 8.700 ? ? ? ? 4852 95.600 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 3.000 0.067 ? ? ? 0.081 0.046 ? 2 1 ? ? ? 1.360 1.460 ? 9.300 ? ? ? ? 4595 96.400 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 3.000 0.062 ? ? ? 0.076 0.043 ? 3 1 ? ? ? 1.460 1.580 ? 10.100 ? ? ? ? 4321 96.600 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 3.000 0.056 ? ? ? 0.068 0.038 ? 4 1 ? ? ? 1.580 1.730 ? 8.300 ? ? ? ? 3955 96.300 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 3.100 0.056 ? ? ? 0.068 0.037 ? 5 1 ? ? ? 1.730 1.930 ? 8.600 ? ? ? ? 3664 98.400 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 3.000 0.057 ? ? ? 0.069 0.039 ? 6 1 ? ? ? 1.930 2.230 ? 9.500 ? ? ? ? 3261 99.200 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 3.100 0.053 ? ? ? 0.065 0.036 ? 7 1 ? ? ? 2.230 2.730 ? 10.800 ? ? ? ? 2776 99.400 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 3.000 0.052 ? ? ? 0.063 0.036 ? 8 1 ? ? ? 2.730 3.860 ? 7.900 ? ? ? ? 2172 99.700 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 3.000 0.060 ? ? ? 0.073 0.042 ? 9 1 ? ? ? 3.860 38.0 ? 7.100 ? ? ? ? 1228 99.400 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 3.000 0.076 ? ? ? 0.092 0.051 ? 10 1 ? ? ? # _refine.aniso_B[1][1] -0.2800 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.1600 _refine.aniso_B[2][2] 0.5500 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.3000 _refine.B_iso_max 52.380 _refine.B_iso_mean 12.7500 _refine.B_iso_min 5.220 _refine.correlation_coeff_Fo_to_Fc 0.9650 _refine.correlation_coeff_Fo_to_Fc_free 0.9640 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YIL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2200 _refine.ls_d_res_low 38.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 34182 _refine.ls_number_reflns_R_free 1759 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.1100 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1330 _refine.ls_R_factor_R_free 0.1511 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1321 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3DWY _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0370 _refine.pdbx_overall_ESU_R_Free 0.0350 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.7640 _refine.overall_SU_ML 0.0160 _refine.overall_SU_R_Cruickshank_DPI 0.0366 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.2200 _refine_hist.d_res_low 38.00 _refine_hist.number_atoms_solvent 154 _refine_hist.number_atoms_total 1130 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 113 _refine_hist.pdbx_B_iso_mean_ligand 12.64 _refine_hist.pdbx_B_iso_mean_solvent 23.92 _refine_hist.pdbx_number_atoms_protein 946 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.020 1038 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 972 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.704 1.999 1416 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.964 2.970 2250 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.623 5.000 114 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.020 24.630 54 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.535 15.000 181 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.867 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.100 0.200 145 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 1139 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 236 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 1.732 3.000 2010 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 23.723 5.000 34 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 6.654 5.000 2098 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.2200 _refine_ls_shell.d_res_low 1.2520 _refine_ls_shell.number_reflns_all 2610 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 126 _refine_ls_shell.number_reflns_R_work 2484 _refine_ls_shell.percent_reflns_obs 95.1900 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.1250 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.1070 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YIL _struct.title 'Crystal structure of the CREBBP bromodomain in complex with a tetrahydroquinoxaline ligand' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YIL _struct_keywords.text 'Bromodomain, CREBBP, small molecule, benzo-diazepine, SGC, Structural Genomics Consortium, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBP_HUMAN _struct_ref.pdbx_db_accession Q92793 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLM FNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _struct_ref.pdbx_align_begin 1081 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YIL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92793 _struct_ref_seq.db_align_beg 1081 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1081 _struct_ref_seq.pdbx_auth_seq_align_end 1197 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YIL SER A 1 ? UNP Q92793 ? ? 'expression tag' 1079 1 1 6YIL MET A 2 ? UNP Q92793 ? ? 'expression tag' 1080 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6720 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 8 ? ARG A 25 ? LYS A 1086 ARG A 1103 1 ? 18 HELX_P HELX_P2 AA2 SER A 30 ? ARG A 34 ? SER A 1108 ARG A 1112 5 ? 5 HELX_P HELX_P3 AA3 ASP A 38 ? GLY A 43 ? ASP A 1116 GLY A 1121 1 ? 6 HELX_P HELX_P4 AA4 ASP A 46 ? VAL A 51 ? ASP A 1124 VAL A 1129 1 ? 6 HELX_P HELX_P5 AA5 ASP A 56 ? THR A 66 ? ASP A 1134 THR A 1144 1 ? 11 HELX_P HELX_P6 AA6 GLU A 71 ? ASN A 90 ? GLU A 1149 ASN A 1168 1 ? 20 HELX_P HELX_P7 AA7 SER A 94 ? GLY A 119 ? SER A 1172 GLY A 1197 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 1105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 12.74 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id OSQ _struct_site.pdbx_auth_seq_id 1201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue OSQ A 1201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 PRO A 32 ? PRO A 1110 . ? 1_555 ? 2 AC1 10 VAL A 37 ? VAL A 1115 . ? 1_555 ? 3 AC1 10 LEU A 42 ? LEU A 1120 . ? 1_555 ? 4 AC1 10 ASN A 90 ? ASN A 1168 . ? 1_555 ? 5 AC1 10 ARG A 95 ? ARG A 1173 . ? 1_555 ? 6 AC1 10 VAL A 96 ? VAL A 1174 . ? 1_555 ? 7 AC1 10 HOH C . ? HOH A 1304 . ? 1_555 ? 8 AC1 10 HOH C . ? HOH A 1364 . ? 1_555 ? 9 AC1 10 HOH C . ? HOH A 1390 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 1430 . ? 4_556 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 1395 ? ? O A HOH 1427 ? ? 2.00 2 1 O A HOH 1301 ? ? O A HOH 1403 ? ? 2.12 3 1 O A HOH 1313 ? ? O A HOH 1319 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 1421 ? ? 1_555 O A HOH 1448 ? ? 2_656 1.66 2 1 O A HOH 1319 ? ? 1_555 O A HOH 1403 ? ? 4_556 1.79 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 1103 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 1103 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 1103 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.47 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.17 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_phasing_MR.entry_id 6YIL _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.500 _pdbx_phasing_MR.d_res_low_rotation 38.300 _pdbx_phasing_MR.d_res_high_translation 3.500 _pdbx_phasing_MR.d_res_low_translation 38.300 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 6YIL _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1079 ? A SER 1 2 1 Y 1 A MET 1080 ? A MET 2 3 1 Y 1 A ARG 1081 ? A ARG 3 4 1 Y 1 A LYS 1082 ? A LYS 4 5 1 Y 1 A LYS 1083 ? A LYS 5 6 1 Y 1 A ILE 1084 ? A ILE 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 OSQ C4 C Y N 229 OSQ C14 C N N 230 OSQ C5 C Y N 231 OSQ C6 C Y N 232 OSQ C11 C N N 233 OSQ C7 C Y N 234 OSQ C8 C Y N 235 OSQ C9 C N N 236 OSQ C10 C N N 237 OSQ C12 C N N 238 OSQ C13 C N N 239 OSQ N1 N N N 240 OSQ N2 N N N 241 OSQ C3 C N N 242 OSQ N3 N N N 243 OSQ C1 C N N 244 OSQ C2 C N R 245 OSQ C15 C N N 246 OSQ C16 C Y N 247 OSQ C17 C Y N 248 OSQ C18 C Y N 249 OSQ C19 C Y N 250 OSQ C20 C Y N 251 OSQ C21 C Y N 252 OSQ F1 F N N 253 OSQ F2 F N N 254 OSQ O1 O N N 255 OSQ C22 C Y N 256 OSQ N4 N N N 257 OSQ O2 O N N 258 OSQ H1 H N N 259 OSQ H2 H N N 260 OSQ H3 H N N 261 OSQ H4 H N N 262 OSQ H5 H N N 263 OSQ H6 H N N 264 OSQ H7 H N N 265 OSQ H8 H N N 266 OSQ H9 H N N 267 OSQ H10 H N N 268 OSQ H11 H N N 269 OSQ H12 H N N 270 OSQ H13 H N N 271 OSQ H14 H N N 272 OSQ H15 H N N 273 OSQ H16 H N N 274 OSQ H17 H N N 275 OSQ H18 H N N 276 OSQ H19 H N N 277 OSQ H20 H N N 278 OSQ H21 H N N 279 OSQ H22 H N N 280 OSQ H23 H N N 281 OSQ H24 H N N 282 PHE N N N N 283 PHE CA C N S 284 PHE C C N N 285 PHE O O N N 286 PHE CB C N N 287 PHE CG C Y N 288 PHE CD1 C Y N 289 PHE CD2 C Y N 290 PHE CE1 C Y N 291 PHE CE2 C Y N 292 PHE CZ C Y N 293 PHE OXT O N N 294 PHE H H N N 295 PHE H2 H N N 296 PHE HA H N N 297 PHE HB2 H N N 298 PHE HB3 H N N 299 PHE HD1 H N N 300 PHE HD2 H N N 301 PHE HE1 H N N 302 PHE HE2 H N N 303 PHE HZ H N N 304 PHE HXT H N N 305 PRO N N N N 306 PRO CA C N S 307 PRO C C N N 308 PRO O O N N 309 PRO CB C N N 310 PRO CG C N N 311 PRO CD C N N 312 PRO OXT O N N 313 PRO H H N N 314 PRO HA H N N 315 PRO HB2 H N N 316 PRO HB3 H N N 317 PRO HG2 H N N 318 PRO HG3 H N N 319 PRO HD2 H N N 320 PRO HD3 H N N 321 PRO HXT H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 OSQ C14 C15 sing N N 216 OSQ C14 C13 sing N N 217 OSQ C15 C16 sing N N 218 OSQ C13 N3 sing N N 219 OSQ F1 C11 sing N N 220 OSQ F2 C11 sing N N 221 OSQ C16 C17 doub Y N 222 OSQ C16 C21 sing Y N 223 OSQ C11 C12 sing N N 224 OSQ C11 C10 sing N N 225 OSQ N3 C21 sing N N 226 OSQ N3 C12 sing N N 227 OSQ C17 C18 sing Y N 228 OSQ C21 C20 doub Y N 229 OSQ C10 N2 sing N N 230 OSQ O1 C9 doub N N 231 OSQ C1 C2 sing N N 232 OSQ C18 C19 doub Y N 233 OSQ C20 C19 sing Y N 234 OSQ C9 N2 sing N N 235 OSQ C9 C8 sing N N 236 OSQ N4 C2 sing N N 237 OSQ N4 C22 sing N N 238 OSQ C2 C3 sing N N 239 OSQ C8 C22 doub Y N 240 OSQ C8 C7 sing Y N 241 OSQ C22 C4 sing Y N 242 OSQ O2 C3 doub N N 243 OSQ C3 N1 sing N N 244 OSQ N1 C4 sing N N 245 OSQ C4 C5 doub Y N 246 OSQ C7 C6 doub Y N 247 OSQ C5 C6 sing Y N 248 OSQ C14 H1 sing N N 249 OSQ C14 H2 sing N N 250 OSQ C5 H3 sing N N 251 OSQ C6 H4 sing N N 252 OSQ C7 H5 sing N N 253 OSQ C10 H6 sing N N 254 OSQ C10 H7 sing N N 255 OSQ C12 H8 sing N N 256 OSQ C12 H9 sing N N 257 OSQ C13 H10 sing N N 258 OSQ C13 H11 sing N N 259 OSQ N1 H12 sing N N 260 OSQ N2 H13 sing N N 261 OSQ C1 H14 sing N N 262 OSQ C1 H15 sing N N 263 OSQ C1 H16 sing N N 264 OSQ C2 H17 sing N N 265 OSQ C15 H18 sing N N 266 OSQ C15 H19 sing N N 267 OSQ C17 H20 sing N N 268 OSQ C18 H21 sing N N 269 OSQ C19 H22 sing N N 270 OSQ C20 H23 sing N N 271 OSQ N4 H24 sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'Medical Research Council (MRC, United Kingdom)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number MR/N010051/1 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id OSQ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id OSQ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3DWY _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YIL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010609 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003302 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028885 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026111 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_