data_6YL7 # _entry.id 6YL7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YL7 pdb_00006yl7 10.2210/pdb6yl7/pdb WWPDB D_1292107797 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-10 2 'Structure model' 1 1 2020-11-11 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_struct_assembly 2 2 'Structure model' pdbx_struct_assembly_gen 3 2 'Structure model' pdbx_struct_assembly_prop 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 8 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_struct_assembly.details' 2 2 'Structure model' '_pdbx_struct_assembly.method_details' 3 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 2 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 6 2 'Structure model' '_pdbx_struct_assembly_prop.value' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YL7 _pdbx_database_status.recvd_initial_deposition_date 2020-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Angeli, A.' 1 ? 'Ferraroni, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Molecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1420-3049 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 25 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of a Tetrameric Type II beta-Carbonic Anhydrase from the Pathogenic BacteriumBurkholderia pseudomallei.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/molecules25102269 _citation.pdbx_database_id_PubMed 32408533 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Angeli, A.' 1 0000-0002-1470-7192 primary 'Ferraroni, M.' 2 0000-0001-7258-738X primary 'Pinteala, M.' 3 0000-0002-4021-982X primary 'Maier, S.S.' 4 ? primary 'Simionescu, B.C.' 5 ? primary 'Carta, F.' 6 0000-0002-1141-6146 primary 'Del Prete, S.' 7 ? primary 'Capasso, C.' 8 0000-0003-3314-2411 primary 'Supuran, C.T.' 9 0000-0003-4262-0323 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Beta carbonic anhydrase' 28269.016 1 4.2.1.1 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Carbonate dehydratase,Carbonic anhydrase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNKNDHPLSHLFDNNDAWVKRKLADDPQYFSRLADQQAPEYLWIGCSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLN CLSVIQFAVDLLKVKHVMVVGHYGCSGVNAALHNRRVGLADNWLHHVQDVREKHAALLEDWPLGEARYRRLIELNAIEQV VNVCRTTIVNDAWARGQPLTVHALVYGVHDGRMRNLGMAVSHAEQLDATYRRAVAALSASGAHSADNDVVAADAAQLAGA VDLIAQTIKETKHDGC ; _entity_poly.pdbx_seq_one_letter_code_can ;MNKNDHPLSHLFDNNDAWVKRKLADDPQYFSRLADQQAPEYLWIGCSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLN CLSVIQFAVDLLKVKHVMVVGHYGCSGVNAALHNRRVGLADNWLHHVQDVREKHAALLEDWPLGEARYRRLIELNAIEQV VNVCRTTIVNDAWARGQPLTVHALVYGVHDGRMRNLGMAVSHAEQLDATYRRAVAALSASGAHSADNDVVAADAAQLAGA VDLIAQTIKETKHDGC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LYS n 1 4 ASN n 1 5 ASP n 1 6 HIS n 1 7 PRO n 1 8 LEU n 1 9 SER n 1 10 HIS n 1 11 LEU n 1 12 PHE n 1 13 ASP n 1 14 ASN n 1 15 ASN n 1 16 ASP n 1 17 ALA n 1 18 TRP n 1 19 VAL n 1 20 LYS n 1 21 ARG n 1 22 LYS n 1 23 LEU n 1 24 ALA n 1 25 ASP n 1 26 ASP n 1 27 PRO n 1 28 GLN n 1 29 TYR n 1 30 PHE n 1 31 SER n 1 32 ARG n 1 33 LEU n 1 34 ALA n 1 35 ASP n 1 36 GLN n 1 37 GLN n 1 38 ALA n 1 39 PRO n 1 40 GLU n 1 41 TYR n 1 42 LEU n 1 43 TRP n 1 44 ILE n 1 45 GLY n 1 46 CYS n 1 47 SER n 1 48 ASP n 1 49 SER n 1 50 ARG n 1 51 VAL n 1 52 PRO n 1 53 ALA n 1 54 ASN n 1 55 GLN n 1 56 ILE n 1 57 ILE n 1 58 GLY n 1 59 LEU n 1 60 PRO n 1 61 PRO n 1 62 GLY n 1 63 GLU n 1 64 VAL n 1 65 PHE n 1 66 VAL n 1 67 HIS n 1 68 ARG n 1 69 ASN n 1 70 ILE n 1 71 ALA n 1 72 ASN n 1 73 VAL n 1 74 VAL n 1 75 VAL n 1 76 HIS n 1 77 THR n 1 78 ASP n 1 79 LEU n 1 80 ASN n 1 81 CYS n 1 82 LEU n 1 83 SER n 1 84 VAL n 1 85 ILE n 1 86 GLN n 1 87 PHE n 1 88 ALA n 1 89 VAL n 1 90 ASP n 1 91 LEU n 1 92 LEU n 1 93 LYS n 1 94 VAL n 1 95 LYS n 1 96 HIS n 1 97 VAL n 1 98 MET n 1 99 VAL n 1 100 VAL n 1 101 GLY n 1 102 HIS n 1 103 TYR n 1 104 GLY n 1 105 CYS n 1 106 SER n 1 107 GLY n 1 108 VAL n 1 109 ASN n 1 110 ALA n 1 111 ALA n 1 112 LEU n 1 113 HIS n 1 114 ASN n 1 115 ARG n 1 116 ARG n 1 117 VAL n 1 118 GLY n 1 119 LEU n 1 120 ALA n 1 121 ASP n 1 122 ASN n 1 123 TRP n 1 124 LEU n 1 125 HIS n 1 126 HIS n 1 127 VAL n 1 128 GLN n 1 129 ASP n 1 130 VAL n 1 131 ARG n 1 132 GLU n 1 133 LYS n 1 134 HIS n 1 135 ALA n 1 136 ALA n 1 137 LEU n 1 138 LEU n 1 139 GLU n 1 140 ASP n 1 141 TRP n 1 142 PRO n 1 143 LEU n 1 144 GLY n 1 145 GLU n 1 146 ALA n 1 147 ARG n 1 148 TYR n 1 149 ARG n 1 150 ARG n 1 151 LEU n 1 152 ILE n 1 153 GLU n 1 154 LEU n 1 155 ASN n 1 156 ALA n 1 157 ILE n 1 158 GLU n 1 159 GLN n 1 160 VAL n 1 161 VAL n 1 162 ASN n 1 163 VAL n 1 164 CYS n 1 165 ARG n 1 166 THR n 1 167 THR n 1 168 ILE n 1 169 VAL n 1 170 ASN n 1 171 ASP n 1 172 ALA n 1 173 TRP n 1 174 ALA n 1 175 ARG n 1 176 GLY n 1 177 GLN n 1 178 PRO n 1 179 LEU n 1 180 THR n 1 181 VAL n 1 182 HIS n 1 183 ALA n 1 184 LEU n 1 185 VAL n 1 186 TYR n 1 187 GLY n 1 188 VAL n 1 189 HIS n 1 190 ASP n 1 191 GLY n 1 192 ARG n 1 193 MET n 1 194 ARG n 1 195 ASN n 1 196 LEU n 1 197 GLY n 1 198 MET n 1 199 ALA n 1 200 VAL n 1 201 SER n 1 202 HIS n 1 203 ALA n 1 204 GLU n 1 205 GLN n 1 206 LEU n 1 207 ASP n 1 208 ALA n 1 209 THR n 1 210 TYR n 1 211 ARG n 1 212 ARG n 1 213 ALA n 1 214 VAL n 1 215 ALA n 1 216 ALA n 1 217 LEU n 1 218 SER n 1 219 ALA n 1 220 SER n 1 221 GLY n 1 222 ALA n 1 223 HIS n 1 224 SER n 1 225 ALA n 1 226 ASP n 1 227 ASN n 1 228 ASP n 1 229 VAL n 1 230 VAL n 1 231 ALA n 1 232 ALA n 1 233 ASP n 1 234 ALA n 1 235 ALA n 1 236 GLN n 1 237 LEU n 1 238 ALA n 1 239 GLY n 1 240 ALA n 1 241 VAL n 1 242 ASP n 1 243 LEU n 1 244 ILE n 1 245 ALA n 1 246 GLN n 1 247 THR n 1 248 ILE n 1 249 LYS n 1 250 GLU n 1 251 THR n 1 252 LYS n 1 253 HIS n 1 254 ASP n 1 255 GLY n 1 256 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 256 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'can_1, can_2, BOC42_16450, CXQ84_19645, DF122_01465, ERS013345_01543, SAMEA1968934_03740' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia pseudomallei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28450 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 HIS 189 189 189 HIS HIS A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 MET 193 193 193 MET MET A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 HIS 202 202 202 HIS HIS A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 TYR 210 210 210 TYR TYR A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ARG 212 212 212 ARG ARG A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 ALA 219 219 ? ? ? A . n A 1 220 SER 220 220 ? ? ? A . n A 1 221 GLY 221 221 ? ? ? A . n A 1 222 ALA 222 222 ? ? ? A . n A 1 223 HIS 223 223 ? ? ? A . n A 1 224 SER 224 224 ? ? ? A . n A 1 225 ALA 225 225 ? ? ? A . n A 1 226 ASP 226 226 ? ? ? A . n A 1 227 ASN 227 227 ? ? ? A . n A 1 228 ASP 228 228 ? ? ? A . n A 1 229 VAL 229 229 ? ? ? A . n A 1 230 VAL 230 230 ? ? ? A . n A 1 231 ALA 231 231 ? ? ? A . n A 1 232 ALA 232 232 ? ? ? A . n A 1 233 ASP 233 233 ? ? ? A . n A 1 234 ALA 234 234 ? ? ? A . n A 1 235 ALA 235 235 ? ? ? A . n A 1 236 GLN 236 236 ? ? ? A . n A 1 237 LEU 237 237 ? ? ? A . n A 1 238 ALA 238 238 ? ? ? A . n A 1 239 GLY 239 239 ? ? ? A . n A 1 240 ALA 240 240 ? ? ? A . n A 1 241 VAL 241 241 ? ? ? A . n A 1 242 ASP 242 242 ? ? ? A . n A 1 243 LEU 243 243 ? ? ? A . n A 1 244 ILE 244 244 ? ? ? A . n A 1 245 ALA 245 245 ? ? ? A . n A 1 246 GLN 246 246 ? ? ? A . n A 1 247 THR 247 247 ? ? ? A . n A 1 248 ILE 248 248 ? ? ? A . n A 1 249 LYS 249 249 ? ? ? A . n A 1 250 GLU 250 250 ? ? ? A . n A 1 251 THR 251 251 ? ? ? A . n A 1 252 LYS 252 252 ? ? ? A . n A 1 253 HIS 253 253 ? ? ? A . n A 1 254 ASP 254 254 ? ? ? A . n A 1 255 GLY 255 255 ? ? ? A . n A 1 256 CYS 256 256 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 1 ZN ZN A . C 3 HOH 1 401 60 HOH HOH A . C 3 HOH 2 402 62 HOH HOH A . C 3 HOH 3 403 77 HOH HOH A . C 3 HOH 4 404 75 HOH HOH A . C 3 HOH 5 405 15 HOH HOH A . C 3 HOH 6 406 76 HOH HOH A . C 3 HOH 7 407 20 HOH HOH A . C 3 HOH 8 408 69 HOH HOH A . C 3 HOH 9 409 64 HOH HOH A . C 3 HOH 10 410 70 HOH HOH A . C 3 HOH 11 411 71 HOH HOH A . C 3 HOH 12 412 39 HOH HOH A . C 3 HOH 13 413 61 HOH HOH A . C 3 HOH 14 414 73 HOH HOH A . C 3 HOH 15 415 67 HOH HOH A . C 3 HOH 16 416 74 HOH HOH A . C 3 HOH 17 417 65 HOH HOH A . C 3 HOH 18 418 72 HOH HOH A . C 3 HOH 19 419 63 HOH HOH A . C 3 HOH 20 420 66 HOH HOH A . C 3 HOH 21 421 68 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 9 ? OG ? A SER 9 OG 2 1 Y 1 A HIS 10 ? CG ? A HIS 10 CG 3 1 Y 1 A HIS 10 ? ND1 ? A HIS 10 ND1 4 1 Y 1 A HIS 10 ? CD2 ? A HIS 10 CD2 5 1 Y 1 A HIS 10 ? CE1 ? A HIS 10 CE1 6 1 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 7 1 Y 1 A PHE 12 ? CG ? A PHE 12 CG 8 1 Y 1 A PHE 12 ? CD1 ? A PHE 12 CD1 9 1 Y 1 A PHE 12 ? CD2 ? A PHE 12 CD2 10 1 Y 1 A PHE 12 ? CE1 ? A PHE 12 CE1 11 1 Y 1 A PHE 12 ? CE2 ? A PHE 12 CE2 12 1 Y 1 A PHE 12 ? CZ ? A PHE 12 CZ 13 1 Y 1 A TRP 18 ? CE3 ? A TRP 18 CE3 14 1 Y 1 A TRP 18 ? CZ2 ? A TRP 18 CZ2 15 1 Y 1 A TRP 18 ? CZ3 ? A TRP 18 CZ3 16 1 Y 1 A TRP 18 ? CH2 ? A TRP 18 CH2 17 1 Y 1 A LYS 20 ? CG ? A LYS 20 CG 18 1 Y 1 A LYS 20 ? CD ? A LYS 20 CD 19 1 Y 1 A LYS 20 ? CE ? A LYS 20 CE 20 1 Y 1 A LYS 20 ? NZ ? A LYS 20 NZ 21 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 22 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 23 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 24 1 Y 1 A LEU 23 ? CG ? A LEU 23 CG 25 1 Y 1 A LEU 23 ? CD1 ? A LEU 23 CD1 26 1 Y 1 A LEU 23 ? CD2 ? A LEU 23 CD2 27 1 Y 1 A GLN 28 ? CG ? A GLN 28 CG 28 1 Y 1 A GLN 28 ? CD ? A GLN 28 CD 29 1 Y 1 A GLN 28 ? OE1 ? A GLN 28 OE1 30 1 Y 1 A GLN 28 ? NE2 ? A GLN 28 NE2 31 1 Y 1 A ARG 32 ? CG ? A ARG 32 CG 32 1 Y 1 A ARG 32 ? CD ? A ARG 32 CD 33 1 Y 1 A ARG 32 ? NE ? A ARG 32 NE 34 1 Y 1 A ARG 32 ? CZ ? A ARG 32 CZ 35 1 Y 1 A ARG 32 ? NH1 ? A ARG 32 NH1 36 1 Y 1 A ARG 32 ? NH2 ? A ARG 32 NH2 37 1 Y 1 A ASP 35 ? CG ? A ASP 35 CG 38 1 Y 1 A ASP 35 ? OD1 ? A ASP 35 OD1 39 1 Y 1 A ASP 35 ? OD2 ? A ASP 35 OD2 40 1 Y 1 A GLN 36 ? CG ? A GLN 36 CG 41 1 Y 1 A GLN 36 ? CD ? A GLN 36 CD 42 1 Y 1 A GLN 36 ? OE1 ? A GLN 36 OE1 43 1 Y 1 A GLN 36 ? NE2 ? A GLN 36 NE2 44 1 Y 1 A GLN 37 ? CG ? A GLN 37 CG 45 1 Y 1 A GLN 37 ? CD ? A GLN 37 CD 46 1 Y 1 A GLN 37 ? OE1 ? A GLN 37 OE1 47 1 Y 1 A GLN 37 ? NE2 ? A GLN 37 NE2 48 1 Y 1 A VAL 51 ? CG1 ? A VAL 51 CG1 49 1 Y 1 A VAL 51 ? CG2 ? A VAL 51 CG2 50 1 Y 1 A ILE 57 ? CD1 ? A ILE 57 CD1 51 1 Y 1 A GLU 63 ? CG ? A GLU 63 CG 52 1 Y 1 A GLU 63 ? CD ? A GLU 63 CD 53 1 Y 1 A GLU 63 ? OE1 ? A GLU 63 OE1 54 1 Y 1 A GLU 63 ? OE2 ? A GLU 63 OE2 55 1 Y 1 A ILE 70 ? CD1 ? A ILE 70 CD1 56 1 Y 1 A LYS 93 ? CG ? A LYS 93 CG 57 1 Y 1 A LYS 93 ? CD ? A LYS 93 CD 58 1 Y 1 A LYS 93 ? CE ? A LYS 93 CE 59 1 Y 1 A LYS 93 ? NZ ? A LYS 93 NZ 60 1 Y 1 A LYS 95 ? CG ? A LYS 95 CG 61 1 Y 1 A LYS 95 ? CD ? A LYS 95 CD 62 1 Y 1 A LYS 95 ? CE ? A LYS 95 CE 63 1 Y 1 A LYS 95 ? NZ ? A LYS 95 NZ 64 1 Y 1 A ARG 115 ? CG ? A ARG 115 CG 65 1 Y 1 A ARG 115 ? CD ? A ARG 115 CD 66 1 Y 1 A ARG 115 ? NE ? A ARG 115 NE 67 1 Y 1 A ARG 115 ? CZ ? A ARG 115 CZ 68 1 Y 1 A ARG 115 ? NH1 ? A ARG 115 NH1 69 1 Y 1 A ARG 115 ? NH2 ? A ARG 115 NH2 70 1 Y 1 A ARG 116 ? CG ? A ARG 116 CG 71 1 Y 1 A ARG 116 ? CD ? A ARG 116 CD 72 1 Y 1 A ARG 116 ? NE ? A ARG 116 NE 73 1 Y 1 A ARG 116 ? CZ ? A ARG 116 CZ 74 1 Y 1 A ARG 116 ? NH1 ? A ARG 116 NH1 75 1 Y 1 A ARG 116 ? NH2 ? A ARG 116 NH2 76 1 Y 1 A ARG 131 ? CZ ? A ARG 131 CZ 77 1 Y 1 A ARG 131 ? NH1 ? A ARG 131 NH1 78 1 Y 1 A ARG 131 ? NH2 ? A ARG 131 NH2 79 1 Y 1 A LEU 143 ? CG ? A LEU 143 CG 80 1 Y 1 A LEU 143 ? CD1 ? A LEU 143 CD1 81 1 Y 1 A LEU 143 ? CD2 ? A LEU 143 CD2 82 1 Y 1 A GLU 145 ? CG ? A GLU 145 CG 83 1 Y 1 A GLU 145 ? CD ? A GLU 145 CD 84 1 Y 1 A GLU 145 ? OE1 ? A GLU 145 OE1 85 1 Y 1 A GLU 145 ? OE2 ? A GLU 145 OE2 86 1 Y 1 A ARG 149 ? NE ? A ARG 149 NE 87 1 Y 1 A ARG 149 ? CZ ? A ARG 149 CZ 88 1 Y 1 A ARG 149 ? NH1 ? A ARG 149 NH1 89 1 Y 1 A ARG 149 ? NH2 ? A ARG 149 NH2 90 1 Y 1 A VAL 161 ? CG1 ? A VAL 161 CG1 91 1 Y 1 A VAL 161 ? CG2 ? A VAL 161 CG2 92 1 Y 1 A ARG 165 ? CG ? A ARG 165 CG 93 1 Y 1 A ARG 165 ? CD ? A ARG 165 CD 94 1 Y 1 A ARG 165 ? NE ? A ARG 165 NE 95 1 Y 1 A ARG 165 ? CZ ? A ARG 165 CZ 96 1 Y 1 A ARG 165 ? NH1 ? A ARG 165 NH1 97 1 Y 1 A ARG 165 ? NH2 ? A ARG 165 NH2 98 1 Y 1 A ALA 183 ? CB ? A ALA 183 CB 99 1 Y 1 A LEU 206 ? CG ? A LEU 206 CG 100 1 Y 1 A LEU 206 ? CD1 ? A LEU 206 CD1 101 1 Y 1 A LEU 206 ? CD2 ? A LEU 206 CD2 102 1 Y 1 A ASP 207 ? CG ? A ASP 207 CG 103 1 Y 1 A ASP 207 ? OD1 ? A ASP 207 OD1 104 1 Y 1 A ASP 207 ? OD2 ? A ASP 207 OD2 105 1 Y 1 A ARG 212 ? CG ? A ARG 212 CG 106 1 Y 1 A ARG 212 ? CD ? A ARG 212 CD 107 1 Y 1 A ARG 212 ? NE ? A ARG 212 NE 108 1 Y 1 A ARG 212 ? CZ ? A ARG 212 CZ 109 1 Y 1 A ARG 212 ? NH1 ? A ARG 212 NH1 110 1 Y 1 A ARG 212 ? NH2 ? A ARG 212 NH2 111 1 Y 1 A LEU 217 ? CG ? A LEU 217 CG 112 1 Y 1 A LEU 217 ? CD1 ? A LEU 217 CD1 113 1 Y 1 A LEU 217 ? CD2 ? A LEU 217 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6YL7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.738 _cell.length_a_esd ? _cell.length_b 88.738 _cell.length_b_esd ? _cell.length_c 112.428 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YL7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YL7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '22% PEG 4000, 10% isopropanol, 100 mM HEPES pH 7.5 and 3% v/v 1,5-Diaminopentene di-HCl.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-08-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0399 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0399 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6YL7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.17 _reflns.d_resolution_low 45.41 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4883 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.7 _reflns.pdbx_Rmerge_I_obs 0.341 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.354 _reflns.pdbx_Rpim_I_all 0.093 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1. _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.17 _reflns_shell.d_res_low 3.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 849 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.96 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.08 _reflns_shell.pdbx_Rpim_I_all 0.84 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 1 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 2.0100 _refine.aniso_B[1][2] 1.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 2.0100 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -6.5100 _refine.B_iso_max 199.450 _refine.B_iso_mean 90.2960 _refine.B_iso_min 45.040 _refine.correlation_coeff_Fo_to_Fc 0.9590 _refine.correlation_coeff_Fo_to_Fc_free 0.9270 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YL7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.1700 _refine.ls_d_res_low 45.4100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4605 _refine.ls_number_reflns_R_free 208 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4600 _refine.ls_percent_reflns_R_free 4.3000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1970 _refine.ls_R_factor_R_free 0.2962 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1926 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4rxy _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.5570 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 33.6990 _refine.overall_SU_ML 0.5360 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.1700 _refine_hist.d_res_low 45.4100 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1570 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 210 _refine_hist.pdbx_B_iso_mean_ligand 100.46 _refine_hist.pdbx_B_iso_mean_solvent 75.26 _refine_hist.pdbx_number_atoms_protein 1548 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 1583 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 1374 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.587 1.619 2171 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.276 1.570 3140 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.946 5.000 209 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.684 22.375 80 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 22.128 15.000 205 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.564 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.059 0.200 210 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1853 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 334 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.17 _refine_ls_shell.d_res_low 3.2480 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 15 _refine_ls_shell.number_reflns_R_work 305 _refine_ls_shell.percent_reflns_obs 93.2900 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4930 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3900 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YL7 _struct.title 'Crystal structure of beta carbonic anhydrase from the pathogenic bacterium Burkholderia pseudomallei' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YL7 _struct_keywords.text 'carbonic anhydrase, beta carbonic anhydrase, Burkholderia pseudomallei, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A069AXA0_BURPE _struct_ref.pdbx_db_accession A0A069AXA0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNKNDHPLSHLFDNNDAWVKRKLADDPQYFSRLADQQAPEYLWIGCSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLN CLSVIQFAVDLLKVKHVMVVGHYGCSGVNAALHNRRVGLADNWLHHVQDVREKHAALLEDWPLGEARYRRLIELNAIEQV VNVCRTTIVNDAWARGQPLTVHALVYGVHDGRMRNLGMAVSHAEQLDATYRRAVAALSASGAHSADNDVVAADAAQLAGA VDLIAQTIKETKHDGC ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YL7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 256 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A069AXA0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 256 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 256 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14200 ? 1 MORE -82 ? 1 'SSA (A^2)' 30110 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 -44.3690000000 0.0000000000 -1.0000000000 0.0000000000 76.8493622810 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 9_554 -x,-x+y,-z-1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -37.4760000000 4 'crystal symmetry operation' 12_564 x,x-y+1,-z-1/3 0.5000000000 0.8660254038 0.0000000000 -44.3690000000 0.8660254038 -0.5000000000 0.0000000000 76.8493622810 0.0000000000 0.0000000000 -1.0000000000 -37.4760000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 11 ? ASP A 25 ? LEU A 11 ASP A 25 1 ? 15 HELX_P HELX_P2 AA2 TYR A 29 ? ALA A 34 ? TYR A 29 ALA A 34 1 ? 6 HELX_P HELX_P3 AA3 PRO A 52 ? GLY A 58 ? PRO A 52 GLY A 58 1 ? 7 HELX_P HELX_P4 AA4 ILE A 70 ? VAL A 73 ? ILE A 70 VAL A 73 5 ? 4 HELX_P HELX_P5 AA5 ASP A 78 ? LYS A 93 ? ASP A 78 LYS A 93 1 ? 16 HELX_P HELX_P6 AA6 CYS A 105 ? HIS A 113 ? CYS A 105 HIS A 113 1 ? 9 HELX_P HELX_P7 AA7 LEU A 119 ? HIS A 134 ? LEU A 119 HIS A 134 1 ? 16 HELX_P HELX_P8 AA8 HIS A 134 ? ASP A 140 ? HIS A 134 ASP A 140 1 ? 7 HELX_P HELX_P9 AA9 GLY A 144 ? THR A 166 ? GLY A 144 THR A 166 1 ? 23 HELX_P HELX_P10 AB1 THR A 166 ? ARG A 175 ? THR A 166 ARG A 175 1 ? 10 HELX_P HELX_P11 AB2 GLU A 204 ? ALA A 215 ? GLU A 204 ALA A 215 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 46 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 46 A ZN 301 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc2 metalc ? ? A ASP 48 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 48 A ZN 301 1_555 ? ? ? ? ? ? ? 2.092 ? ? metalc3 metalc ? ? A HIS 102 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 102 A ZN 301 1_555 ? ? ? ? ? ? ? 1.712 ? ? metalc4 metalc ? ? A CYS 105 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 105 A ZN 301 1_555 ? ? ? ? ? ? ? 2.008 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 48 ? A ASP 48 ? 1_555 106.1 ? 2 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 137.7 ? 3 OD2 ? A ASP 48 ? A ASP 48 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 96.3 ? 4 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 105 ? A CYS 105 ? 1_555 92.6 ? 5 OD2 ? A ASP 48 ? A ASP 48 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 105 ? A CYS 105 ? 1_555 100.2 ? 6 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 105 ? A CYS 105 ? 1_555 118.4 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 64 ? ASN A 69 ? VAL A 64 ASN A 69 AA1 2 TYR A 41 ? CYS A 46 ? TYR A 41 CYS A 46 AA1 3 HIS A 96 ? TYR A 103 ? HIS A 96 TYR A 103 AA1 4 THR A 180 ? GLY A 187 ? THR A 180 GLY A 187 AA1 5 MET A 193 ? VAL A 200 ? MET A 193 VAL A 200 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 65 ? O PHE A 65 N TYR A 41 ? N TYR A 41 AA1 2 3 N ILE A 44 ? N ILE A 44 O VAL A 100 ? O VAL A 100 AA1 3 4 N VAL A 97 ? N VAL A 97 O HIS A 182 ? O HIS A 182 AA1 4 5 N VAL A 181 ? N VAL A 181 O VAL A 200 ? O VAL A 200 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 2 AC1 4 ASP A 48 ? ASP A 48 . ? 1_555 ? 3 AC1 4 HIS A 102 ? HIS A 102 . ? 1_555 ? 4 AC1 4 CYS A 105 ? CYS A 105 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CD A ARG 149 ? ? O A HOH 414 ? ? 2.16 2 1 O A HIS 113 ? ? N A ARG 115 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 10 ? ? 82.06 -50.58 2 1 ALA A 17 ? ? -61.01 0.47 3 1 ASP A 25 ? ? -103.30 79.24 4 1 PRO A 27 ? ? -45.74 81.28 5 1 GLN A 28 ? ? -55.40 87.85 6 1 TYR A 29 ? ? -141.94 -12.23 7 1 GLN A 37 ? ? 72.36 -174.63 8 1 ASP A 48 ? ? -53.98 53.99 9 1 SER A 49 ? ? -62.92 72.04 10 1 ASN A 72 ? ? 35.56 53.93 11 1 VAL A 89 ? ? -64.46 -71.53 12 1 LYS A 93 ? ? 32.10 61.72 13 1 ASN A 114 ? ? -18.54 60.99 14 1 VAL A 117 ? ? -144.42 -26.13 15 1 TRP A 141 ? ? -109.94 66.88 16 1 PRO A 142 ? ? -54.13 12.42 17 1 LEU A 143 ? ? -100.71 -149.76 18 1 ARG A 147 ? ? -48.58 -72.69 19 1 TYR A 148 ? ? -29.43 -66.33 20 1 ARG A 192 ? ? -33.05 137.37 21 1 ALA A 199 ? ? -165.64 93.47 22 1 SER A 201 ? ? -137.53 -31.60 23 1 GLU A 204 ? ? -94.97 46.95 24 1 ASP A 207 ? ? -49.21 -73.65 25 1 ARG A 211 ? ? -35.94 -73.71 26 1 ALA A 215 ? ? -69.42 48.61 27 1 ALA A 216 ? ? -135.94 -71.25 28 1 LEU A 217 ? ? 28.48 73.62 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 409 ? C HOH . 2 1 A HOH 410 ? C HOH . 3 1 A HOH 413 ? C HOH . # _pdbx_entry_details.entry_id 6YL7 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A ALA 219 ? A ALA 219 10 1 Y 1 A SER 220 ? A SER 220 11 1 Y 1 A GLY 221 ? A GLY 221 12 1 Y 1 A ALA 222 ? A ALA 222 13 1 Y 1 A HIS 223 ? A HIS 223 14 1 Y 1 A SER 224 ? A SER 224 15 1 Y 1 A ALA 225 ? A ALA 225 16 1 Y 1 A ASP 226 ? A ASP 226 17 1 Y 1 A ASN 227 ? A ASN 227 18 1 Y 1 A ASP 228 ? A ASP 228 19 1 Y 1 A VAL 229 ? A VAL 229 20 1 Y 1 A VAL 230 ? A VAL 230 21 1 Y 1 A ALA 231 ? A ALA 231 22 1 Y 1 A ALA 232 ? A ALA 232 23 1 Y 1 A ASP 233 ? A ASP 233 24 1 Y 1 A ALA 234 ? A ALA 234 25 1 Y 1 A ALA 235 ? A ALA 235 26 1 Y 1 A GLN 236 ? A GLN 236 27 1 Y 1 A LEU 237 ? A LEU 237 28 1 Y 1 A ALA 238 ? A ALA 238 29 1 Y 1 A GLY 239 ? A GLY 239 30 1 Y 1 A ALA 240 ? A ALA 240 31 1 Y 1 A VAL 241 ? A VAL 241 32 1 Y 1 A ASP 242 ? A ASP 242 33 1 Y 1 A LEU 243 ? A LEU 243 34 1 Y 1 A ILE 244 ? A ILE 244 35 1 Y 1 A ALA 245 ? A ALA 245 36 1 Y 1 A GLN 246 ? A GLN 246 37 1 Y 1 A THR 247 ? A THR 247 38 1 Y 1 A ILE 248 ? A ILE 248 39 1 Y 1 A LYS 249 ? A LYS 249 40 1 Y 1 A GLU 250 ? A GLU 250 41 1 Y 1 A THR 251 ? A THR 251 42 1 Y 1 A LYS 252 ? A LYS 252 43 1 Y 1 A HIS 253 ? A HIS 253 44 1 Y 1 A ASP 254 ? A ASP 254 45 1 Y 1 A GLY 255 ? A GLY 255 46 1 Y 1 A CYS 256 ? A CYS 256 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4RXY _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YL7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011269 _atom_sites.fract_transf_matrix[1][2] 0.006506 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013012 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008895 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_