data_6Z41 # _entry.id 6Z41 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Z41 pdb_00006z41 10.2210/pdb6z41/pdb WWPDB D_1292108857 ? ? BMRB 34520 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'PDB entry for the same citation' 6Z40 unspecified BMRB 'NMR solution structure of the carbohydrate-binding module family 73 (CBM73) from Cellvibrio japonicus CjLPMO10A' 34520 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6Z41 _pdbx_database_status.recvd_initial_deposition_date 2020-05-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Madland, E.' 1 ? 'Aachmann, F.L.' 2 ? 'Courtade, G.' 3 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Biol.Chem. JBCHA3 0071 1083-351X ? ? 297 ? 101084 101084 'Structural and functional variation of chitin-binding domains of a lytic polysaccharide monooxygenase from Cellvibrio japonicus.' 2021 ? 10.1016/j.jbc.2021.101084 34411561 ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? ;NMR structures and functional roles of two related chitin-binding domains of a lytic polysaccharide monooxygenase from Cellvibrio japonicus ; 2021 ? 10.1101/2021.04.25.441307 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Madland, E.' 1 ? primary 'Forsberg, Z.' 2 ? primary 'Wang, Y.' 3 ? primary 'Lindorff-Larsen, K.' 4 ? primary 'Niebisch, A.' 5 ? primary 'Modregger, J.' 6 ? primary 'Eijsink, V.G.H.' 7 ? primary 'Aachmann, F.L.' 8 ? primary 'Courtade, G.' 9 ? 1 'Madland, E.' 10 ? 1 'Forsberg, Z.' 11 ? 1 'Wang, Y.' 12 ? 1 'Lindorff-Larsen, K.' 13 ? 1 'Niebisch, A.' 14 ? 1 'Modregger, J.' 15 ? 1 'Eijsink, V.G.H.' 16 ? 1 'Aachmann, F.L.' 17 ? 1 'Courtade, G.' 18 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Carbohydrate binding protein, putative, cpb33A' _entity.formula_weight 7404.142 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGNCISPVYVDGSSYANNALVQNNGSEYRCLVGGWCTVGGPYAPGTGWAWANAWELVRSCQAHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MGNCISPVYVDGSSYANNALVQNNGSEYRCLVGGWCTVGGPYAPGTGWAWANAWELVRSCQAHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 CYS n 1 5 ILE n 1 6 SER n 1 7 PRO n 1 8 VAL n 1 9 TYR n 1 10 VAL n 1 11 ASP n 1 12 GLY n 1 13 SER n 1 14 SER n 1 15 TYR n 1 16 ALA n 1 17 ASN n 1 18 ASN n 1 19 ALA n 1 20 LEU n 1 21 VAL n 1 22 GLN n 1 23 ASN n 1 24 ASN n 1 25 GLY n 1 26 SER n 1 27 GLU n 1 28 TYR n 1 29 ARG n 1 30 CYS n 1 31 LEU n 1 32 VAL n 1 33 GLY n 1 34 GLY n 1 35 TRP n 1 36 CYS n 1 37 THR n 1 38 VAL n 1 39 GLY n 1 40 GLY n 1 41 PRO n 1 42 TYR n 1 43 ALA n 1 44 PRO n 1 45 GLY n 1 46 THR n 1 47 GLY n 1 48 TRP n 1 49 ALA n 1 50 TRP n 1 51 ALA n 1 52 ASN n 1 53 ALA n 1 54 TRP n 1 55 GLU n 1 56 LEU n 1 57 VAL n 1 58 ARG n 1 59 SER n 1 60 CYS n 1 61 GLN n 1 62 ALA n 1 63 HIS n 1 64 HIS n 1 65 HIS n 1 66 HIS n 1 67 HIS n 1 68 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 68 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cbp33A, CJA_2191' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cellvibrio japonicus Ueda107' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 498211 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC-CH _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B3PJ79_CELJU _struct_ref.pdbx_db_accession B3PJ79 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GNCISPVYVDGSSYANNALVQNNGSEYRCLVGGWCTVGGPYAPGTGWAWANAWELVRSCQ _struct_ref.pdbx_align_begin 338 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Z41 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B3PJ79 _struct_ref_seq.db_align_beg 338 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 397 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Z41 MET A 1 ? UNP B3PJ79 ? ? 'initiating methionine' 1 1 1 6Z41 ALA A 62 ? UNP B3PJ79 ? ? 'expression tag' 62 2 1 6Z41 HIS A 63 ? UNP B3PJ79 ? ? 'expression tag' 63 3 1 6Z41 HIS A 64 ? UNP B3PJ79 ? ? 'expression tag' 64 4 1 6Z41 HIS A 65 ? UNP B3PJ79 ? ? 'expression tag' 65 5 1 6Z41 HIS A 66 ? UNP B3PJ79 ? ? 'expression tag' 66 6 1 6Z41 HIS A 67 ? UNP B3PJ79 ? ? 'expression tag' 67 7 1 6Z41 HIS A 68 ? UNP B3PJ79 ? ? 'expression tag' 68 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 2 '2D 1H-1H NOESY' 1 isotropic 3 1 3 '2D 1H-15N HSQC' 1 isotropic 4 1 4 '3D CBCA(CO)NH' 1 isotropic 5 1 3 '3D 1H-15N NOESY' 1 isotropic 6 1 4 '2D 1H-13C HSQC' 1 isotropic 7 1 1 '2D 1H-15N HSQC' 1 isotropic 8 1 2 '2D 1H-13C HSQC' 1 isotropic 9 1 4 '3D HNCA' 1 isotropic 10 1 4 '3D HCCH-TOCSY' 1 isotropic 11 1 4 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 55 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.1 mM CBM73, 25 mM sodium phosphate, 10 mM sodium chloride, 90% H2O/10% D2O' '90% H2O/10% D2O' na_sample solution ? 2 '0.1 mM CBM73, 25 mM sodium phosphate, 10 mM sodium chloride, 100% D2O' '100% D2O' na_d2o_sample solution ? 3 '0.1 mM [U-15N] CBM73, 25 mM sodium phosphate, 10 mM sodium chloride, 90% H2O/10% D2O' '90% H2O/10% D2O' 15n_sample solution ? 4 '0.1 mM [U-13C; U-15N] CBM73, 25 mM sodium phosphate, 10 mM sodium chloride, 90% H2O/10% D2O' '90% H2O/10% D2O' 13c_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6Z41 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'the structures are based on 656 NOE-derived distance constraints, 66 dihedral angle restraints and 2 disulphide bond restraints' _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 6Z41 _pdbx_nmr_ensemble.conformers_calculated_total_number 256 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6Z41 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin 3.5 'Bruker Biospin' 2 'chemical shift assignment' CARA 1.5.5 'Keller and Wuthrich' 3 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 4 refinement YASARA 14.6.23 ;Elmar Krieger, Keehyoung Joo, Jinwoo Lee,3 Jooyoung Lee, Srivatsan Raman, James Thompson, Mike Tyka, David Baker, and Kevin Karplus ; # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Z41 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6Z41 _struct.title 'NMR solution structure of the carbohydrate-binding module family 73 (CBM73) from Cellvibrio japonicus CjLPMO10A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Z41 _struct_keywords.text 'cbm, chitin, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 4 A CYS 60 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 30 A CYS 36 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 21 ? ASN A 23 ? VAL A 21 ASN A 23 AA1 2 SER A 26 ? CYS A 30 ? SER A 26 CYS A 30 AA1 3 TRP A 54 ? LEU A 56 ? TRP A 54 LEU A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 21 ? N VAL A 21 O TYR A 28 ? O TYR A 28 AA1 2 3 N ARG A 29 ? N ARG A 29 O GLU A 55 ? O GLU A 55 # _atom_sites.entry_id 6Z41 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 HIS 68 68 68 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5090 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-05 2 'Structure model' 1 1 2021-06-23 3 'Structure model' 1 2 2021-09-29 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_spectrometer 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_database_proc 6 4 'Structure model' citation 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_spectrometer.field_strength' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_citation.journal_id_ISSN' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CBM73 0.1 ? mM 'natural abundance' 1 'sodium phosphate' 25 ? mM 'natural abundance' 1 'sodium chloride' 10 ? mM 'natural abundance' 2 CBM73 0.1 ? mM 'natural abundance' 2 'sodium phosphate' 25 ? mM 'natural abundance' 2 'sodium chloride' 10 ? mM 'natural abundance' 3 CBM73 0.1 ? mM '[U-15N]' 3 'sodium phosphate' 25 ? mM 'natural abundance' 3 'sodium chloride' 10 ? mM 'natural abundance' 4 CBM73 0.1 ? mM '[U-13C; U-15N]' 4 'sodium phosphate' 25 ? mM 'natural abundance' 4 'sodium chloride' 10 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HG A SER 59 ? ? HE21 A GLN 61 ? ? 1.33 2 10 HG A SER 59 ? ? HE2 A HIS 63 ? ? 1.15 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.66 120.30 3.36 0.50 N 2 5 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.54 120.30 3.24 0.50 N 3 6 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.72 120.30 3.42 0.50 N 4 12 N A SER 6 ? ? CA A SER 6 ? ? CB A SER 6 ? ? 101.07 110.50 -9.43 1.50 N 5 12 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.55 120.30 3.25 0.50 N 6 15 N A SER 6 ? ? CA A SER 6 ? ? CB A SER 6 ? ? 101.29 110.50 -9.21 1.50 N 7 17 N A SER 6 ? ? CA A SER 6 ? ? CB A SER 6 ? ? 100.65 110.50 -9.85 1.50 N 8 19 CA A CYS 36 ? ? CB A CYS 36 ? ? SG A CYS 36 ? ? 122.56 114.20 8.36 1.10 N 9 20 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.69 120.30 3.39 0.50 N 10 20 NE A ARG 58 ? ? CZ A ARG 58 ? ? NH1 A ARG 58 ? ? 123.31 120.30 3.01 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 14 ? ? -177.49 141.57 2 1 PRO A 44 ? ? -82.33 36.08 3 1 VAL A 57 ? ? -107.71 -69.09 4 1 CYS A 60 ? ? -147.23 29.15 5 1 ALA A 62 ? ? 63.17 -46.44 6 1 HIS A 65 ? ? 66.53 151.71 7 2 PRO A 7 ? ? -55.47 172.48 8 2 VAL A 57 ? ? -107.50 -67.86 9 3 SER A 14 ? ? -178.92 144.97 10 3 THR A 46 ? ? -163.22 -34.30 11 3 ALA A 49 ? ? -134.28 -46.99 12 3 VAL A 57 ? ? -107.56 -73.50 13 3 CYS A 60 ? ? -157.47 49.99 14 4 SER A 14 ? ? -174.43 143.23 15 4 ALA A 19 ? ? -27.52 107.29 16 4 THR A 46 ? ? -171.04 -37.85 17 4 VAL A 57 ? ? -107.58 -71.21 18 4 ALA A 62 ? ? 63.31 168.20 19 5 THR A 46 ? ? -168.16 -34.95 20 5 VAL A 57 ? ? -107.51 -67.86 21 5 CYS A 60 ? ? -156.39 50.20 22 6 SER A 14 ? ? -177.80 149.18 23 6 ALA A 19 ? ? 57.60 78.30 24 6 PRO A 44 ? ? -80.53 42.70 25 6 ALA A 49 ? ? -144.07 -42.91 26 6 VAL A 57 ? ? -107.68 -73.44 27 6 CYS A 60 ? ? -151.96 41.41 28 6 HIS A 67 ? ? 51.79 90.27 29 7 SER A 14 ? ? -173.34 128.18 30 7 ALA A 19 ? ? -50.61 104.07 31 7 PRO A 44 ? ? -80.28 42.46 32 7 ALA A 49 ? ? -139.61 -45.75 33 7 VAL A 57 ? ? -107.64 -72.12 34 7 CYS A 60 ? ? -150.07 41.19 35 7 ALA A 62 ? ? 64.71 -37.75 36 7 HIS A 67 ? ? 55.92 -164.13 37 8 SER A 14 ? ? -174.61 130.40 38 8 THR A 46 ? ? -167.55 -39.37 39 8 VAL A 57 ? ? -107.54 -69.68 40 8 CYS A 60 ? ? -157.68 54.04 41 9 ASN A 3 ? ? 52.15 -130.57 42 9 PRO A 7 ? ? -57.43 172.39 43 9 SER A 14 ? ? -176.32 126.95 44 9 ALA A 49 ? ? -137.59 -43.82 45 9 VAL A 57 ? ? -107.71 -69.88 46 9 CYS A 60 ? ? -143.46 32.74 47 9 HIS A 64 ? ? 50.12 8.33 48 10 ALA A 16 ? ? -121.89 -170.00 49 10 ASN A 18 ? ? -99.77 -60.79 50 10 ALA A 19 ? ? 58.82 74.33 51 10 PRO A 44 ? ? -80.87 44.11 52 10 ALA A 49 ? ? -143.40 -48.43 53 10 VAL A 57 ? ? -114.92 -75.53 54 10 GLN A 61 ? ? -75.02 34.13 55 10 ALA A 62 ? ? 50.51 17.93 56 11 ASN A 3 ? ? 53.66 -151.31 57 11 SER A 14 ? ? -173.50 132.12 58 11 ALA A 19 ? ? -29.47 105.46 59 11 PRO A 44 ? ? -81.03 45.05 60 11 ALA A 49 ? ? -141.48 -46.80 61 11 VAL A 57 ? ? -107.61 -73.71 62 11 GLN A 61 ? ? -77.98 42.79 63 11 ALA A 62 ? ? 27.15 62.54 64 11 HIS A 63 ? ? 63.17 90.81 65 12 ASN A 3 ? ? 60.43 -158.69 66 12 SER A 14 ? ? -176.61 148.49 67 12 ALA A 19 ? ? 55.60 79.99 68 12 THR A 46 ? ? -163.82 -34.80 69 12 VAL A 57 ? ? -107.61 -70.95 70 12 CYS A 60 ? ? -152.63 33.16 71 12 ALA A 62 ? ? 56.63 149.81 72 12 HIS A 63 ? ? 60.58 148.65 73 12 HIS A 65 ? ? 61.96 174.05 74 12 HIS A 67 ? ? 49.56 97.21 75 13 SER A 14 ? ? -172.05 130.34 76 13 ALA A 19 ? ? 54.38 81.70 77 13 THR A 46 ? ? -154.74 -35.64 78 13 VAL A 57 ? ? -109.16 -75.01 79 13 CYS A 60 ? ? -159.01 47.52 80 14 SER A 14 ? ? -177.04 142.99 81 14 PRO A 44 ? ? -80.94 39.28 82 14 ALA A 49 ? ? -143.73 -47.41 83 14 VAL A 57 ? ? -109.62 -69.01 84 14 CYS A 60 ? ? -149.34 29.03 85 14 HIS A 63 ? ? 61.74 123.71 86 15 ALA A 49 ? ? -131.05 -44.34 87 15 VAL A 57 ? ? -107.52 -71.15 88 15 CYS A 60 ? ? -159.18 36.47 89 15 HIS A 65 ? ? -151.58 -41.95 90 15 HIS A 66 ? ? 69.23 171.65 91 16 ASN A 3 ? ? 64.46 -156.33 92 16 SER A 14 ? ? -174.05 148.57 93 16 ASN A 18 ? ? -97.08 -63.32 94 16 ALA A 19 ? ? 58.43 71.38 95 16 VAL A 57 ? ? -109.12 -76.66 96 16 CYS A 60 ? ? -157.14 48.18 97 16 HIS A 64 ? ? -127.07 -113.63 98 16 HIS A 65 ? ? -134.25 -55.41 99 16 HIS A 67 ? ? -140.28 29.20 100 17 SER A 14 ? ? -171.11 124.53 101 17 THR A 46 ? ? -167.98 -37.79 102 17 VAL A 57 ? ? -107.60 -69.17 103 17 CYS A 60 ? ? -147.10 28.92 104 17 HIS A 63 ? ? -76.21 39.11 105 17 HIS A 67 ? ? 60.45 -160.92 106 18 SER A 14 ? ? -178.13 149.51 107 18 ALA A 19 ? ? 56.03 70.52 108 18 ASN A 24 ? ? 59.70 18.83 109 18 ALA A 49 ? ? -144.18 -48.67 110 18 VAL A 57 ? ? -115.07 -76.07 111 18 CYS A 60 ? ? -160.83 49.44 112 18 GLN A 61 ? ? -72.53 22.57 113 18 HIS A 63 ? ? 57.45 17.01 114 19 ASN A 3 ? ? 50.96 -143.12 115 19 SER A 14 ? ? -177.97 140.41 116 19 ALA A 19 ? ? -21.43 94.31 117 19 THR A 46 ? ? 177.54 -33.14 118 19 ALA A 49 ? ? -141.47 -41.68 119 19 VAL A 57 ? ? -109.54 -69.55 120 19 CYS A 60 ? ? -142.13 38.77 121 19 ALA A 62 ? ? -176.01 -50.11 122 19 HIS A 65 ? ? -139.22 -46.63 123 19 HIS A 66 ? ? 56.19 82.21 124 20 SER A 14 ? ? -175.95 143.79 125 20 ALA A 19 ? ? -55.14 101.15 126 20 THR A 46 ? ? -158.72 -36.33 127 20 VAL A 57 ? ? -107.55 -68.82 128 20 CYS A 60 ? ? -148.30 44.13 129 20 ALA A 62 ? ? -151.44 -80.67 130 20 HIS A 65 ? ? -64.80 7.03 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Research Council of Norway' Norway 269408 1 'Research Council of Norway' Norway 226244 2 'Novo Nordisk Foundation' Denmark NNF18OC0032242 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #