data_7A2D # _entry.id 7A2D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7A2D pdb_00007a2d 10.2210/pdb7a2d/pdb WWPDB D_1292109280 ? ? BMRB 34552 ? 10.13018/BMR34552 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-30 2 'Structure model' 1 1 2021-01-20 3 'Structure model' 1 2 2021-01-27 4 'Structure model' 1 3 2021-02-10 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Source and taxonomy' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' entity 3 2 'Structure model' entity_name_com 4 2 'Structure model' entity_src_gen 5 2 'Structure model' struct_ref 6 2 'Structure model' struct_ref_seq 7 2 'Structure model' struct_ref_seq_dif 8 3 'Structure model' citation 9 3 'Structure model' citation_author 10 4 'Structure model' citation_author 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity.pdbx_description' 2 2 'Structure model' '_entity_src_gen.gene_src_strain' 3 2 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 4 2 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 5 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 6 2 'Structure model' '_struct_ref.db_code' 7 2 'Structure model' '_struct_ref.pdbx_db_accession' 8 2 'Structure model' '_struct_ref_seq.pdbx_db_accession' 9 2 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' 10 3 'Structure model' '_citation.title' 11 3 'Structure model' '_citation_author.name' 12 4 'Structure model' '_citation_author.identifier_ORCID' 13 5 'Structure model' '_database_2.pdbx_DOI' 14 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7A2D _pdbx_database_status.recvd_initial_deposition_date 2020-08-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 19760 unspecified BMRB ;Structure-function analyses of dual-BON domain protein DolP identifies phospholipid binding as a new mechanism for protein localisation to the cell division site ; 34552 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bryant, J.A.' 1 0000-0002-7912-2144 'Morris, F.C.' 2 0000-0002-9021-0452 'Knowles, T.J.' 3 ? 'Maderbocus, R.' 4 ? 'Heinz, E.' 5 0000-0003-4413-3756 'Boelter, G.' 6 ? 'Alodaini, D.' 7 ? 'Colyer, A.' 8 ? 'Wotherspoon, P.J.' 9 ? 'Staunton, K.A.' 10 ? 'Jeeves, M.' 11 ? 'Browning, D.F.' 12 ? 'Sevastsyanovich, Y.R.' 13 ? 'Wells, T.J.' 14 ? 'Rossiter, A.E.' 15 ? 'Bavro, V.N.' 16 ? 'Sridhar, P.' 17 ? 'Ward, D.G.' 18 ? 'Chong, Z.S.' 19 ? 'Goodall, E.C.A.' 20 0000-0003-4846-6566 'Icke, C.' 21 0000-0002-7815-8591 'Teo, A.' 22 ? 'Chng, S.S.' 23 0000-0001-5466-7183 'Roper, D.I.' 24 ? 'Lithgow, T.' 25 ? 'Cunningham, A.F.' 26 ? 'Banzhaf, M.' 27 ? 'Overduin, M.' 28 ? 'Henderson, I.R.' 29 0000-0002-9954-4977 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of dual BON-domain protein DolP identifies phospholipid binding as a new mechanism for protein localisation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.62614 _citation.pdbx_database_id_PubMed 33315009 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bryant, J.A.' 1 ? primary 'Morris, F.C.' 2 ? primary 'Knowles, T.J.' 3 ? primary 'Maderbocus, R.' 4 ? primary 'Heinz, E.' 5 ? primary 'Boelter, G.' 6 ? primary 'Alodaini, D.' 7 ? primary 'Colyer, A.' 8 ? primary 'Wotherspoon, P.J.' 9 ? primary 'Staunton, K.A.' 10 ? primary 'Jeeves, M.' 11 ? primary 'Browning, D.F.' 12 ? primary 'Sevastsyanovich, Y.R.' 13 ? primary 'Wells, T.J.' 14 ? primary 'Rossiter, A.E.' 15 ? primary 'Bavro, V.N.' 16 ? primary 'Sridhar, P.' 17 ? primary 'Ward, D.G.' 18 ? primary 'Chong, Z.S.' 19 ? primary 'Goodall, E.C.' 20 ? primary 'Icke, C.' 21 ? primary 'Teo, A.C.' 22 ? primary 'Chng, S.S.' 23 ? primary 'Roper, D.I.' 24 ? primary 'Lithgow, T.' 25 ? primary 'Cunningham, A.F.' 26 ? primary 'Banzhaf, M.' 27 ? primary 'Overduin, M.' 28 ? primary 'Henderson, I.R.' 29 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein YraP' _entity.formula_weight 19324.738 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation YES _entity.pdbx_fragment 'UNP RESIDUES 201-91' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name DolP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IAAAVVGTAAVGTKAATDPRSVGTQVDDGTLEVRVNSALSKDEQIKKEARINVTAYQGKVLLVGQSPNAELSARAKQIAM GVDGANEVYNEIRQGQPIGLGEASNDTWITTKVRSQLLTSDLVKSSNVKVTTENGEVFLMGLVTEREAKAAADIASRVSG VKRVTTAFTFIKGGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;IAAAVVGTAAVGTKAATDPRSVGTQVDDGTLEVRVNSALSKDEQIKKEARINVTAYQGKVLLVGQSPNAELSARAKQIAM GVDGANEVYNEIRQGQPIGLGEASNDTWITTKVRSQLLTSDLVKSSNVKVTTENGEVFLMGLVTEREAKAAADIASRVSG VKRVTTAFTFIKGGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ALA n 1 3 ALA n 1 4 ALA n 1 5 VAL n 1 6 VAL n 1 7 GLY n 1 8 THR n 1 9 ALA n 1 10 ALA n 1 11 VAL n 1 12 GLY n 1 13 THR n 1 14 LYS n 1 15 ALA n 1 16 ALA n 1 17 THR n 1 18 ASP n 1 19 PRO n 1 20 ARG n 1 21 SER n 1 22 VAL n 1 23 GLY n 1 24 THR n 1 25 GLN n 1 26 VAL n 1 27 ASP n 1 28 ASP n 1 29 GLY n 1 30 THR n 1 31 LEU n 1 32 GLU n 1 33 VAL n 1 34 ARG n 1 35 VAL n 1 36 ASN n 1 37 SER n 1 38 ALA n 1 39 LEU n 1 40 SER n 1 41 LYS n 1 42 ASP n 1 43 GLU n 1 44 GLN n 1 45 ILE n 1 46 LYS n 1 47 LYS n 1 48 GLU n 1 49 ALA n 1 50 ARG n 1 51 ILE n 1 52 ASN n 1 53 VAL n 1 54 THR n 1 55 ALA n 1 56 TYR n 1 57 GLN n 1 58 GLY n 1 59 LYS n 1 60 VAL n 1 61 LEU n 1 62 LEU n 1 63 VAL n 1 64 GLY n 1 65 GLN n 1 66 SER n 1 67 PRO n 1 68 ASN n 1 69 ALA n 1 70 GLU n 1 71 LEU n 1 72 SER n 1 73 ALA n 1 74 ARG n 1 75 ALA n 1 76 LYS n 1 77 GLN n 1 78 ILE n 1 79 ALA n 1 80 MET n 1 81 GLY n 1 82 VAL n 1 83 ASP n 1 84 GLY n 1 85 ALA n 1 86 ASN n 1 87 GLU n 1 88 VAL n 1 89 TYR n 1 90 ASN n 1 91 GLU n 1 92 ILE n 1 93 ARG n 1 94 GLN n 1 95 GLY n 1 96 GLN n 1 97 PRO n 1 98 ILE n 1 99 GLY n 1 100 LEU n 1 101 GLY n 1 102 GLU n 1 103 ALA n 1 104 SER n 1 105 ASN n 1 106 ASP n 1 107 THR n 1 108 TRP n 1 109 ILE n 1 110 THR n 1 111 THR n 1 112 LYS n 1 113 VAL n 1 114 ARG n 1 115 SER n 1 116 GLN n 1 117 LEU n 1 118 LEU n 1 119 THR n 1 120 SER n 1 121 ASP n 1 122 LEU n 1 123 VAL n 1 124 LYS n 1 125 SER n 1 126 SER n 1 127 ASN n 1 128 VAL n 1 129 LYS n 1 130 VAL n 1 131 THR n 1 132 THR n 1 133 GLU n 1 134 ASN n 1 135 GLY n 1 136 GLU n 1 137 VAL n 1 138 PHE n 1 139 LEU n 1 140 MET n 1 141 GLY n 1 142 LEU n 1 143 VAL n 1 144 THR n 1 145 GLU n 1 146 ARG n 1 147 GLU n 1 148 ALA n 1 149 LYS n 1 150 ALA n 1 151 ALA n 1 152 ALA n 1 153 ASP n 1 154 ILE n 1 155 ALA n 1 156 SER n 1 157 ARG n 1 158 VAL n 1 159 SER n 1 160 GLY n 1 161 VAL n 1 162 LYS n 1 163 ARG n 1 164 VAL n 1 165 THR n 1 166 THR n 1 167 ALA n 1 168 PHE n 1 169 THR n 1 170 PHE n 1 171 ILE n 1 172 LYS n 1 173 GLY n 1 174 GLY n 1 175 LEU n 1 176 GLU n 1 177 HIS n 1 178 HIS n 1 179 HIS n 1 180 HIS n 1 181 HIS n 1 182 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'yraP, b3150, JW3119, WCM_00535' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET26B _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 20 20 ILE ILE A . n A 1 2 ALA 2 21 21 ALA ALA A . n A 1 3 ALA 3 22 22 ALA ALA A . n A 1 4 ALA 4 23 23 ALA ALA A . n A 1 5 VAL 5 24 24 VAL VAL A . n A 1 6 VAL 6 25 25 VAL VAL A . n A 1 7 GLY 7 26 26 GLY GLY A . n A 1 8 THR 8 27 27 THR THR A . n A 1 9 ALA 9 28 28 ALA ALA A . n A 1 10 ALA 10 29 29 ALA ALA A . n A 1 11 VAL 11 30 30 VAL VAL A . n A 1 12 GLY 12 31 31 GLY GLY A . n A 1 13 THR 13 32 32 THR THR A . n A 1 14 LYS 14 33 33 LYS LYS A . n A 1 15 ALA 15 34 34 ALA ALA A . n A 1 16 ALA 16 35 35 ALA ALA A . n A 1 17 THR 17 36 36 THR THR A . n A 1 18 ASP 18 37 37 ASP ASP A . n A 1 19 PRO 19 38 38 PRO PRO A . n A 1 20 ARG 20 39 39 ARG ARG A . n A 1 21 SER 21 40 40 SER SER A . n A 1 22 VAL 22 41 41 VAL VAL A . n A 1 23 GLY 23 42 42 GLY GLY A . n A 1 24 THR 24 43 43 THR THR A . n A 1 25 GLN 25 44 44 GLN GLN A . n A 1 26 VAL 26 45 45 VAL VAL A . n A 1 27 ASP 27 46 46 ASP ASP A . n A 1 28 ASP 28 47 47 ASP ASP A . n A 1 29 GLY 29 48 48 GLY GLY A . n A 1 30 THR 30 49 49 THR THR A . n A 1 31 LEU 31 50 50 LEU LEU A . n A 1 32 GLU 32 51 51 GLU GLU A . n A 1 33 VAL 33 52 52 VAL VAL A . n A 1 34 ARG 34 53 53 ARG ARG A . n A 1 35 VAL 35 54 54 VAL VAL A . n A 1 36 ASN 36 55 55 ASN ASN A . n A 1 37 SER 37 56 56 SER SER A . n A 1 38 ALA 38 57 57 ALA ALA A . n A 1 39 LEU 39 58 58 LEU LEU A . n A 1 40 SER 40 59 59 SER SER A . n A 1 41 LYS 41 60 60 LYS LYS A . n A 1 42 ASP 42 61 61 ASP ASP A . n A 1 43 GLU 43 62 62 GLU GLU A . n A 1 44 GLN 44 63 63 GLN GLN A . n A 1 45 ILE 45 64 64 ILE ILE A . n A 1 46 LYS 46 65 65 LYS LYS A . n A 1 47 LYS 47 66 66 LYS LYS A . n A 1 48 GLU 48 67 67 GLU GLU A . n A 1 49 ALA 49 68 68 ALA ALA A . n A 1 50 ARG 50 69 69 ARG ARG A . n A 1 51 ILE 51 70 70 ILE ILE A . n A 1 52 ASN 52 71 71 ASN ASN A . n A 1 53 VAL 53 72 72 VAL VAL A . n A 1 54 THR 54 73 73 THR THR A . n A 1 55 ALA 55 74 74 ALA ALA A . n A 1 56 TYR 56 75 75 TYR TYR A . n A 1 57 GLN 57 76 76 GLN GLN A . n A 1 58 GLY 58 77 77 GLY GLY A . n A 1 59 LYS 59 78 78 LYS LYS A . n A 1 60 VAL 60 79 79 VAL VAL A . n A 1 61 LEU 61 80 80 LEU LEU A . n A 1 62 LEU 62 81 81 LEU LEU A . n A 1 63 VAL 63 82 82 VAL VAL A . n A 1 64 GLY 64 83 83 GLY GLY A . n A 1 65 GLN 65 84 84 GLN GLN A . n A 1 66 SER 66 85 85 SER SER A . n A 1 67 PRO 67 86 86 PRO PRO A . n A 1 68 ASN 68 87 87 ASN ASN A . n A 1 69 ALA 69 88 88 ALA ALA A . n A 1 70 GLU 70 89 89 GLU GLU A . n A 1 71 LEU 71 90 90 LEU LEU A . n A 1 72 SER 72 91 91 SER SER A . n A 1 73 ALA 73 92 92 ALA ALA A . n A 1 74 ARG 74 93 93 ARG ARG A . n A 1 75 ALA 75 94 94 ALA ALA A . n A 1 76 LYS 76 95 95 LYS LYS A . n A 1 77 GLN 77 96 96 GLN GLN A . n A 1 78 ILE 78 97 97 ILE ILE A . n A 1 79 ALA 79 98 98 ALA ALA A . n A 1 80 MET 80 99 99 MET MET A . n A 1 81 GLY 81 100 100 GLY GLY A . n A 1 82 VAL 82 101 101 VAL VAL A . n A 1 83 ASP 83 102 102 ASP ASP A . n A 1 84 GLY 84 103 103 GLY GLY A . n A 1 85 ALA 85 104 104 ALA ALA A . n A 1 86 ASN 86 105 105 ASN ASN A . n A 1 87 GLU 87 106 106 GLU GLU A . n A 1 88 VAL 88 107 107 VAL VAL A . n A 1 89 TYR 89 108 108 TYR TYR A . n A 1 90 ASN 90 109 109 ASN ASN A . n A 1 91 GLU 91 110 110 GLU GLU A . n A 1 92 ILE 92 111 111 ILE ILE A . n A 1 93 ARG 93 112 112 ARG ARG A . n A 1 94 GLN 94 113 113 GLN GLN A . n A 1 95 GLY 95 114 114 GLY GLY A . n A 1 96 GLN 96 115 115 GLN GLN A . n A 1 97 PRO 97 116 116 PRO PRO A . n A 1 98 ILE 98 117 117 ILE ILE A . n A 1 99 GLY 99 118 118 GLY GLY A . n A 1 100 LEU 100 119 119 LEU LEU A . n A 1 101 GLY 101 120 120 GLY GLY A . n A 1 102 GLU 102 121 121 GLU GLU A . n A 1 103 ALA 103 122 122 ALA ALA A . n A 1 104 SER 104 123 123 SER SER A . n A 1 105 ASN 105 124 124 ASN ASN A . n A 1 106 ASP 106 125 125 ASP ASP A . n A 1 107 THR 107 126 126 THR THR A . n A 1 108 TRP 108 127 127 TRP TRP A . n A 1 109 ILE 109 128 128 ILE ILE A . n A 1 110 THR 110 129 129 THR THR A . n A 1 111 THR 111 130 130 THR THR A . n A 1 112 LYS 112 131 131 LYS LYS A . n A 1 113 VAL 113 132 132 VAL VAL A . n A 1 114 ARG 114 133 133 ARG ARG A . n A 1 115 SER 115 134 134 SER SER A . n A 1 116 GLN 116 135 135 GLN GLN A . n A 1 117 LEU 117 136 136 LEU LEU A . n A 1 118 LEU 118 137 137 LEU LEU A . n A 1 119 THR 119 138 138 THR THR A . n A 1 120 SER 120 139 139 SER SER A . n A 1 121 ASP 121 140 140 ASP ASP A . n A 1 122 LEU 122 141 141 LEU LEU A . n A 1 123 VAL 123 142 142 VAL VAL A . n A 1 124 LYS 124 143 143 LYS LYS A . n A 1 125 SER 125 144 144 SER SER A . n A 1 126 SER 126 145 145 SER SER A . n A 1 127 ASN 127 146 146 ASN ASN A . n A 1 128 VAL 128 147 147 VAL VAL A . n A 1 129 LYS 129 148 148 LYS LYS A . n A 1 130 VAL 130 149 149 VAL VAL A . n A 1 131 THR 131 150 150 THR THR A . n A 1 132 THR 132 151 151 THR THR A . n A 1 133 GLU 133 152 152 GLU GLU A . n A 1 134 ASN 134 153 153 ASN ASN A . n A 1 135 GLY 135 154 154 GLY GLY A . n A 1 136 GLU 136 155 155 GLU GLU A . n A 1 137 VAL 137 156 156 VAL VAL A . n A 1 138 PHE 138 157 157 PHE PHE A . n A 1 139 LEU 139 158 158 LEU LEU A . n A 1 140 MET 140 159 159 MET MET A . n A 1 141 GLY 141 160 160 GLY GLY A . n A 1 142 LEU 142 161 161 LEU LEU A . n A 1 143 VAL 143 162 162 VAL VAL A . n A 1 144 THR 144 163 163 THR THR A . n A 1 145 GLU 145 164 164 GLU GLU A . n A 1 146 ARG 146 165 165 ARG ARG A . n A 1 147 GLU 147 166 166 GLU GLU A . n A 1 148 ALA 148 167 167 ALA ALA A . n A 1 149 LYS 149 168 168 LYS LYS A . n A 1 150 ALA 150 169 169 ALA ALA A . n A 1 151 ALA 151 170 170 ALA ALA A . n A 1 152 ALA 152 171 171 ALA ALA A . n A 1 153 ASP 153 172 172 ASP ASP A . n A 1 154 ILE 154 173 173 ILE ILE A . n A 1 155 ALA 155 174 174 ALA ALA A . n A 1 156 SER 156 175 175 SER SER A . n A 1 157 ARG 157 176 176 ARG ARG A . n A 1 158 VAL 158 177 177 VAL VAL A . n A 1 159 SER 159 178 178 SER SER A . n A 1 160 GLY 160 179 179 GLY GLY A . n A 1 161 VAL 161 180 180 VAL VAL A . n A 1 162 LYS 162 181 181 LYS LYS A . n A 1 163 ARG 163 182 182 ARG ARG A . n A 1 164 VAL 164 183 183 VAL VAL A . n A 1 165 THR 165 184 184 THR THR A . n A 1 166 THR 166 185 185 THR THR A . n A 1 167 ALA 167 186 186 ALA ALA A . n A 1 168 PHE 168 187 187 PHE PHE A . n A 1 169 THR 169 188 188 THR THR A . n A 1 170 PHE 170 189 189 PHE PHE A . n A 1 171 ILE 171 190 190 ILE ILE A . n A 1 172 LYS 172 191 191 LYS LYS A . n A 1 173 GLY 173 192 192 GLY GLY A . n A 1 174 GLY 174 193 193 GLY GLY A . n A 1 175 LEU 175 194 194 LEU LEU A . n A 1 176 GLU 176 195 195 GLU GLU A . n A 1 177 HIS 177 196 196 HIS HIS A . n A 1 178 HIS 178 197 197 HIS HIS A . n A 1 179 HIS 179 198 ? ? ? A . n A 1 180 HIS 180 199 ? ? ? A . n A 1 181 HIS 181 200 ? ? ? A . n A 1 182 HIS 182 201 ? ? ? A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7A2D _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7A2D _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7A2D _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 7A2D _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 7A2D _struct.title ;Structure-function analyses of dual-BON domain protein DolP identifies phospholipid binding as a new mechanism for protein localisation to the cell division site ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7A2D _struct_keywords.text 'OUTER MEMBRANE BIOGENESIS, GRAM NEGATIVE, LIPOPROTEIN, YRAP, LIPID BIOGENESIS, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YRAP_ECOLI _struct_ref.pdbx_db_accession P64596 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VAAAVVGTAAVGTKAATDPRSVGTQVDDGTLEVRVNSALSKDEQIKKEARINVTAYQGKVLLVGQSPNAELSARAKQIAM GVDGANEVYNEIRQGQPIGLGEASNDTWITTKVRSQLLTSDLVKSSNVKVTTENGEVFLMGLVTEREAKAAADIASRVSG VKRVTTAFTFIK ; _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7A2D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 172 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P64596 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 20 _struct_ref_seq.pdbx_auth_seq_align_end 191 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7A2D ILE A 1 ? UNP P64596 VAL 20 conflict 20 1 1 7A2D GLY A 173 ? UNP P64596 ? ? 'expression tag' 192 2 1 7A2D GLY A 174 ? UNP P64596 ? ? 'expression tag' 193 3 1 7A2D LEU A 175 ? UNP P64596 ? ? 'expression tag' 194 4 1 7A2D GLU A 176 ? UNP P64596 ? ? 'expression tag' 195 5 1 7A2D HIS A 177 ? UNP P64596 ? ? 'expression tag' 196 6 1 7A2D HIS A 178 ? UNP P64596 ? ? 'expression tag' 197 7 1 7A2D HIS A 179 ? UNP P64596 ? ? 'expression tag' 198 8 1 7A2D HIS A 180 ? UNP P64596 ? ? 'expression tag' 199 9 1 7A2D HIS A 181 ? UNP P64596 ? ? 'expression tag' 200 10 1 7A2D HIS A 182 ? UNP P64596 ? ? 'expression tag' 201 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12020 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 SAXS ? 2 1 'gel filtration' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 27 ? ASP A 42 ? ASP A 46 ASP A 61 1 ? 16 HELX_P HELX_P2 AA2 ASN A 68 ? GLY A 81 ? ASN A 87 GLY A 100 1 ? 14 HELX_P HELX_P3 AA3 GLY A 99 ? THR A 119 ? GLY A 118 THR A 138 1 ? 21 HELX_P HELX_P4 AA4 THR A 144 ? VAL A 158 ? THR A 163 VAL A 177 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 50 ? TYR A 56 ? ARG A 69 TYR A 75 AA1 2 LYS A 59 ? GLN A 65 ? LYS A 78 GLN A 84 AA1 3 VAL A 88 ? ILE A 92 ? VAL A 107 ILE A 111 AA2 1 LYS A 129 ? GLU A 133 ? LYS A 148 GLU A 152 AA2 2 GLU A 136 ? VAL A 143 ? GLU A 155 VAL A 162 AA2 3 ARG A 163 ? PHE A 170 ? ARG A 182 PHE A 189 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 54 ? N THR A 73 O LEU A 61 ? O LEU A 80 AA1 2 3 N LEU A 62 ? N LEU A 81 O TYR A 89 ? O TYR A 108 AA2 1 2 N THR A 131 ? N THR A 150 O PHE A 138 ? O PHE A 157 AA2 2 3 N VAL A 143 ? N VAL A 162 O THR A 169 ? O THR A 188 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG1 A THR 163 ? ? OE1 A GLU 166 ? ? 1.59 2 2 OE1 A GLU 62 ? ? HZ1 A LYS 65 ? ? 1.58 3 3 OE1 A GLU 110 ? ? HZ2 A LYS 148 ? ? 1.59 4 4 HA A THR 130 ? ? HE A ARG 133 ? ? 1.32 5 4 HG1 A THR 163 ? ? OE1 A GLU 166 ? ? 1.54 6 4 HZ1 A LYS 168 ? ? OD2 A ASP 172 ? ? 1.57 7 5 OE1 A GLU 62 ? ? HZ1 A LYS 65 ? ? 1.58 8 5 OE2 A GLU 155 ? ? HZ2 A LYS 181 ? ? 1.58 9 6 OE1 A GLU 155 ? ? HZ2 A LYS 181 ? ? 1.55 10 7 HB A VAL 142 ? ? HG2 A GLU 166 ? ? 1.20 11 7 OE1 A GLU 110 ? ? HZ1 A LYS 148 ? ? 1.59 12 8 OE1 A GLU 110 ? ? HG1 A THR 150 ? ? 1.58 13 9 OE1 A GLU 110 ? ? HZ1 A LYS 148 ? ? 1.57 14 11 HB3 A ALA 68 ? ? HB3 A SER 85 ? ? 1.34 15 11 HG1 A THR 163 ? ? OE1 A GLU 166 ? ? 1.54 16 11 OE2 A GLU 155 ? ? HZ1 A LYS 181 ? ? 1.58 17 11 OE2 A GLU 110 ? ? HZ2 A LYS 148 ? ? 1.59 18 12 HA A THR 130 ? ? HE A ARG 133 ? ? 1.30 19 13 HA A VAL 54 ? ? HB3 A ALA 98 ? ? 1.27 20 14 HB3 A ASP 46 ? ? HB A THR 49 ? ? 1.18 21 15 HD1 A TYR 75 ? ? HD22 A LEU 161 ? ? 1.31 22 15 HA A THR 130 ? ? HE A ARG 133 ? ? 1.34 23 16 OE1 A GLU 110 ? ? HZ1 A LYS 148 ? ? 1.54 24 17 OE1 A GLU 110 ? ? HZ1 A LYS 148 ? ? 1.56 25 17 HZ1 A LYS 60 ? ? OD1 A ASP 61 ? ? 1.59 26 18 O A ILE 190 ? ? H A GLY 192 ? ? 1.58 27 18 HG1 A THR 163 ? ? OE2 A GLU 166 ? ? 1.59 28 18 HZ2 A LYS 168 ? ? OD2 A ASP 172 ? ? 1.59 29 20 HZ2 A LYS 168 ? ? OD2 A ASP 172 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 23 ? ? -119.64 73.99 2 1 ASP A 102 ? ? 174.99 78.70 3 1 ASN A 153 ? ? 70.55 -21.52 4 1 LYS A 191 ? ? 24.76 61.70 5 1 LEU A 194 ? ? 48.15 87.08 6 2 ALA A 23 ? ? -101.68 74.94 7 2 VAL A 24 ? ? -95.86 49.84 8 2 ASP A 102 ? ? -177.24 55.12 9 2 ASN A 153 ? ? -53.08 82.21 10 2 LYS A 191 ? ? -39.47 90.03 11 3 ALA A 29 ? ? -107.44 -154.95 12 3 LYS A 33 ? ? -165.76 99.85 13 3 ASP A 102 ? ? 176.53 75.73 14 3 PRO A 116 ? ? -72.77 -159.24 15 3 ASN A 146 ? ? -156.91 -45.71 16 3 ASN A 153 ? ? -56.25 96.47 17 3 LYS A 191 ? ? 56.30 -22.45 18 4 LYS A 33 ? ? -119.36 -166.52 19 4 THR A 36 ? ? 71.34 101.01 20 4 ASP A 102 ? ? -176.45 61.59 21 4 SER A 145 ? ? -103.64 62.29 22 4 ASN A 146 ? ? -146.95 23.98 23 4 ASN A 153 ? ? 29.00 52.69 24 4 LYS A 191 ? ? -38.71 98.34 25 5 VAL A 24 ? ? -80.13 49.69 26 5 ALA A 35 ? ? -91.15 44.53 27 5 PRO A 38 ? ? -75.18 30.71 28 5 VAL A 41 ? ? 71.84 82.40 29 5 ASP A 102 ? ? -179.35 50.29 30 5 LYS A 191 ? ? 54.82 -80.61 31 5 LEU A 194 ? ? -135.33 -102.92 32 5 GLU A 195 ? ? 179.99 -34.34 33 6 ALA A 23 ? ? -127.30 -78.22 34 6 VAL A 25 ? ? -121.45 -165.75 35 6 ALA A 28 ? ? 76.97 146.54 36 6 VAL A 30 ? ? -96.39 42.33 37 6 ARG A 39 ? ? 37.86 67.60 38 6 GLN A 76 ? ? 73.83 -58.84 39 6 ASP A 102 ? ? 175.20 89.35 40 6 PRO A 116 ? ? -71.40 -136.46 41 6 ALA A 186 ? ? -114.01 72.45 42 6 LYS A 191 ? ? 16.53 76.12 43 7 VAL A 30 ? ? -129.20 -53.81 44 7 ASP A 102 ? ? -173.53 47.03 45 7 ARG A 112 ? ? -71.64 43.35 46 7 ASN A 146 ? ? -124.73 -69.60 47 7 LYS A 191 ? ? -10.05 84.93 48 8 VAL A 30 ? ? -129.53 -156.60 49 8 ALA A 34 ? ? 73.27 -60.27 50 8 THR A 36 ? ? 60.08 63.77 51 8 ARG A 39 ? ? 60.66 80.23 52 8 VAL A 41 ? ? -74.40 -96.93 53 8 ASP A 102 ? ? 170.92 81.49 54 8 ASN A 153 ? ? 59.04 11.77 55 8 LYS A 191 ? ? 32.64 52.87 56 9 ALA A 21 ? ? -146.09 44.43 57 9 ALA A 34 ? ? -148.17 -56.28 58 9 ALA A 35 ? ? -157.54 -54.39 59 9 GLN A 76 ? ? 70.50 -113.18 60 9 ASP A 102 ? ? 176.67 71.49 61 9 ASN A 153 ? ? -53.13 94.93 62 9 LYS A 191 ? ? 34.69 25.37 63 9 LEU A 194 ? ? 174.17 106.08 64 10 VAL A 30 ? ? -84.36 -100.73 65 10 THR A 36 ? ? 60.55 67.27 66 10 ASP A 102 ? ? -167.22 21.68 67 10 SER A 145 ? ? -91.40 50.47 68 10 ASN A 146 ? ? -131.61 -54.42 69 10 LYS A 191 ? ? 33.74 28.36 70 10 HIS A 196 ? ? -125.01 -137.16 71 11 ALA A 34 ? ? -125.84 -63.29 72 11 VAL A 41 ? ? 72.37 -47.79 73 11 GLN A 44 ? ? -152.71 -86.18 74 11 ASP A 46 ? ? -170.43 135.05 75 11 ASP A 102 ? ? 179.11 47.52 76 11 PRO A 116 ? ? -108.55 60.82 77 11 ASN A 146 ? ? -142.62 -60.79 78 11 ALA A 186 ? ? -110.88 77.85 79 11 LYS A 191 ? ? 55.27 -74.77 80 12 VAL A 24 ? ? -118.53 50.22 81 12 ALA A 35 ? ? -145.52 53.38 82 12 ASP A 102 ? ? -178.03 34.88 83 12 LYS A 191 ? ? 59.21 -76.62 84 13 ALA A 23 ? ? 74.90 -23.25 85 13 VAL A 24 ? ? 69.53 100.67 86 13 ALA A 34 ? ? -88.27 49.02 87 13 ARG A 39 ? ? -99.45 54.32 88 13 GLN A 44 ? ? -153.14 43.18 89 13 GLN A 76 ? ? 75.07 -5.11 90 13 ASP A 102 ? ? 174.39 78.77 91 13 SER A 145 ? ? -98.96 51.58 92 13 LYS A 191 ? ? -30.48 96.39 93 14 ALA A 22 ? ? -84.40 34.68 94 14 THR A 36 ? ? -93.27 32.58 95 14 VAL A 41 ? ? -112.72 -75.51 96 14 ASP A 102 ? ? -179.49 55.22 97 14 SER A 139 ? ? -68.24 99.71 98 14 ASN A 153 ? ? 72.74 -34.54 99 14 ALA A 186 ? ? -90.65 56.28 100 14 LYS A 191 ? ? -22.36 95.06 101 15 VAL A 25 ? ? 76.28 131.54 102 15 PRO A 38 ? ? -50.84 -70.10 103 15 VAL A 41 ? ? 70.94 -61.72 104 15 ASP A 46 ? ? -178.82 125.71 105 15 ASP A 102 ? ? -178.70 56.66 106 15 ASN A 146 ? ? -142.68 -42.01 107 15 LYS A 191 ? ? 62.30 -66.66 108 16 ALA A 21 ? ? -159.33 70.22 109 16 ALA A 22 ? ? -150.42 84.64 110 16 ALA A 35 ? ? -85.37 45.58 111 16 VAL A 41 ? ? -42.13 -81.14 112 16 GLN A 44 ? ? 71.58 46.43 113 16 GLU A 62 ? ? -126.88 -60.09 114 16 ASP A 102 ? ? 175.13 57.24 115 16 ARG A 112 ? ? -75.72 47.69 116 16 ASN A 153 ? ? 50.36 10.24 117 16 ALA A 186 ? ? -111.11 70.13 118 16 LYS A 191 ? ? -38.16 102.70 119 17 ALA A 22 ? ? -83.25 46.37 120 17 ALA A 29 ? ? -151.43 79.51 121 17 ARG A 39 ? ? 34.68 60.54 122 17 ASP A 102 ? ? 174.90 76.34 123 17 PRO A 116 ? ? -73.92 -164.15 124 17 ASN A 153 ? ? 56.40 -89.07 125 17 LYS A 191 ? ? 54.94 -14.93 126 18 PRO A 38 ? ? -56.46 -73.68 127 18 GLN A 76 ? ? 59.86 18.31 128 18 ASP A 102 ? ? 179.56 60.29 129 18 ARG A 112 ? ? -73.11 34.88 130 18 PRO A 116 ? ? -53.31 107.48 131 18 ASN A 153 ? ? -61.91 90.80 132 18 ALA A 186 ? ? -94.88 58.77 133 18 LYS A 191 ? ? 66.07 -38.84 134 19 ARG A 39 ? ? -87.05 40.06 135 19 ASP A 102 ? ? 171.52 79.64 136 19 PRO A 116 ? ? -81.21 -131.38 137 19 LYS A 191 ? ? 37.62 18.75 138 20 ALA A 23 ? ? -89.14 47.48 139 20 GLN A 76 ? ? 75.13 -28.59 140 20 ASP A 102 ? ? -164.52 9.37 141 20 ARG A 112 ? ? -74.73 28.81 142 20 LYS A 191 ? ? -37.62 103.81 # _pdbx_nmr_ensemble.entry_id 7A2D _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7A2D _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM [U-13C; U-15N] DolP, 50 mM NA sodium phosphate, 0.02 % w/v NA NaN3, 50 mM NA sodium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C-15N-sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '1.5 mM 13C-15N labelled DolP in 50 mM sodium phosphate (pH 6), 50 mM NaCl and 0.02% NaN3 in 90% H2O/10% D2O.' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 DolP 1.5 ? mM '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM NA 1 NaN3 0.02 ? '% w/v' NA 1 'sodium chloride' 50 ? mM NA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.details . _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 14 1 1 '3D HCCH-TOCSY' 1 isotropic 2 1 1 '3D HN(CO)CA' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D HNCO' 1 isotropic 7 1 1 '3D HN(CA)CO' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 1 '3D 1H-13C NOESY-HSQC ALIPHATIC' 1 isotropic 11 1 1 '3D 1H-13C NOESY-HSQC AROMATIC' 1 isotropic 12 1 1 '3D 1H-15N NOESY-HSQC' 1 isotropic 13 1 1 'H(C)CONH' 1 isotropic # _pdbx_nmr_details.entry_id 7A2D _pdbx_nmr_details.text ;THE STRUCTURE WAS CALCULATED USING TRADITIONAL NOE AND DEHEDRAL ANGLE RESTRAINTS ; # _pdbx_nmr_refine.entry_id 7A2D _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARIA 2.3 LINGE 11 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 13 'data analysis' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 12 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 refinement 'PROCHECK / PROCHECK-NMR' ? 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss and Thornton' 3 refinement CYANA 2.1 'LASKOWSKI AND MACARTHUR (PROCHECKNMR)' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 7 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 198 ? A HIS 179 2 1 Y 1 A HIS 199 ? A HIS 180 3 1 Y 1 A HIS 200 ? A HIS 181 4 1 Y 1 A HIS 201 ? A HIS 182 5 2 Y 1 A HIS 198 ? A HIS 179 6 2 Y 1 A HIS 199 ? A HIS 180 7 2 Y 1 A HIS 200 ? A HIS 181 8 2 Y 1 A HIS 201 ? A HIS 182 9 3 Y 1 A HIS 198 ? A HIS 179 10 3 Y 1 A HIS 199 ? A HIS 180 11 3 Y 1 A HIS 200 ? A HIS 181 12 3 Y 1 A HIS 201 ? A HIS 182 13 4 Y 1 A HIS 198 ? A HIS 179 14 4 Y 1 A HIS 199 ? A HIS 180 15 4 Y 1 A HIS 200 ? A HIS 181 16 4 Y 1 A HIS 201 ? A HIS 182 17 5 Y 1 A HIS 198 ? A HIS 179 18 5 Y 1 A HIS 199 ? A HIS 180 19 5 Y 1 A HIS 200 ? A HIS 181 20 5 Y 1 A HIS 201 ? A HIS 182 21 6 Y 1 A HIS 198 ? A HIS 179 22 6 Y 1 A HIS 199 ? A HIS 180 23 6 Y 1 A HIS 200 ? A HIS 181 24 6 Y 1 A HIS 201 ? A HIS 182 25 7 Y 1 A HIS 198 ? A HIS 179 26 7 Y 1 A HIS 199 ? A HIS 180 27 7 Y 1 A HIS 200 ? A HIS 181 28 7 Y 1 A HIS 201 ? A HIS 182 29 8 Y 1 A HIS 198 ? A HIS 179 30 8 Y 1 A HIS 199 ? A HIS 180 31 8 Y 1 A HIS 200 ? A HIS 181 32 8 Y 1 A HIS 201 ? A HIS 182 33 9 Y 1 A HIS 198 ? A HIS 179 34 9 Y 1 A HIS 199 ? A HIS 180 35 9 Y 1 A HIS 200 ? A HIS 181 36 9 Y 1 A HIS 201 ? A HIS 182 37 10 Y 1 A HIS 198 ? A HIS 179 38 10 Y 1 A HIS 199 ? A HIS 180 39 10 Y 1 A HIS 200 ? A HIS 181 40 10 Y 1 A HIS 201 ? A HIS 182 41 11 Y 1 A HIS 198 ? A HIS 179 42 11 Y 1 A HIS 199 ? A HIS 180 43 11 Y 1 A HIS 200 ? A HIS 181 44 11 Y 1 A HIS 201 ? A HIS 182 45 12 Y 1 A HIS 198 ? A HIS 179 46 12 Y 1 A HIS 199 ? A HIS 180 47 12 Y 1 A HIS 200 ? A HIS 181 48 12 Y 1 A HIS 201 ? A HIS 182 49 13 Y 1 A HIS 198 ? A HIS 179 50 13 Y 1 A HIS 199 ? A HIS 180 51 13 Y 1 A HIS 200 ? A HIS 181 52 13 Y 1 A HIS 201 ? A HIS 182 53 14 Y 1 A HIS 198 ? A HIS 179 54 14 Y 1 A HIS 199 ? A HIS 180 55 14 Y 1 A HIS 200 ? A HIS 181 56 14 Y 1 A HIS 201 ? A HIS 182 57 15 Y 1 A HIS 198 ? A HIS 179 58 15 Y 1 A HIS 199 ? A HIS 180 59 15 Y 1 A HIS 200 ? A HIS 181 60 15 Y 1 A HIS 201 ? A HIS 182 61 16 Y 1 A HIS 198 ? A HIS 179 62 16 Y 1 A HIS 199 ? A HIS 180 63 16 Y 1 A HIS 200 ? A HIS 181 64 16 Y 1 A HIS 201 ? A HIS 182 65 17 Y 1 A HIS 198 ? A HIS 179 66 17 Y 1 A HIS 199 ? A HIS 180 67 17 Y 1 A HIS 200 ? A HIS 181 68 17 Y 1 A HIS 201 ? A HIS 182 69 18 Y 1 A HIS 198 ? A HIS 179 70 18 Y 1 A HIS 199 ? A HIS 180 71 18 Y 1 A HIS 200 ? A HIS 181 72 18 Y 1 A HIS 201 ? A HIS 182 73 19 Y 1 A HIS 198 ? A HIS 179 74 19 Y 1 A HIS 199 ? A HIS 180 75 19 Y 1 A HIS 200 ? A HIS 181 76 19 Y 1 A HIS 201 ? A HIS 182 77 20 Y 1 A HIS 198 ? A HIS 179 78 20 Y 1 A HIS 199 ? A HIS 180 79 20 Y 1 A HIS 200 ? A HIS 181 80 20 Y 1 A HIS 201 ? A HIS 182 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/M00810X/1 1 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/L00335X/1 2 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/P009840/1 3 'Natural Sciences and Engineering Research Council (NSERC, Canada)' Canada RGPIN-2018-04994 4 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7A2D _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_