data_7ABS # _entry.id 7ABS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ABS pdb_00007abs 10.2210/pdb7abs/pdb WWPDB D_1292111144 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-08-04 2 'Structure model' 1 1 2021-08-11 3 'Structure model' 1 2 2021-08-25 4 'Structure model' 1 3 2021-09-29 5 'Structure model' 1 4 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_struct_assembly 3 2 'Structure model' pdbx_struct_assembly_gen 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' citation 6 3 'Structure model' citation_author 7 4 'Structure model' citation 8 4 'Structure model' citation_author 9 4 'Structure model' pdbx_database_proc 10 4 'Structure model' pdbx_seq_map_depositor_info 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 3 'Structure model' '_citation.pdbx_database_id_DOI' 6 3 'Structure model' '_citation.pdbx_database_id_PubMed' 7 3 'Structure model' '_citation.title' 8 4 'Structure model' '_citation.journal_volume' 9 4 'Structure model' '_citation.page_first' 10 4 'Structure model' '_citation.page_last' 11 4 'Structure model' '_citation_author.identifier_ORCID' 12 4 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ABS _pdbx_database_status.recvd_initial_deposition_date 2020-09-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Newman, J.A.' 1 ? 'Yosaatmadja, Y.' 2 ? 'von Delft, F.' 3 ? 'Arrowsmith, C.H.' 4 ? 'Edwards, A.' 5 ? 'Bountra, C.' 6 ? 'Gileadi, O.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 49 _citation.language ? _citation.page_first 9310 _citation.page_last 9326 _citation.title 'Structural and mechanistic insights into the Artemis endonuclease and strategies for its inhibition.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkab693 _citation.pdbx_database_id_PubMed 34387696 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yosaatmadja, Y.' 1 ? primary 'Baddock, H.T.' 2 ? primary 'Newman, J.A.' 3 ? primary 'Bielinski, M.' 4 ? primary 'Gavard, A.E.' 5 ? primary 'Mukhopadhyay, S.M.M.' 6 ? primary 'Dannerfjord, A.A.' 7 ? primary 'Schofield, C.J.' 8 ? primary 'McHugh, P.J.' 9 ? primary 'Gileadi, O.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein artemis' 43294.680 1 3.1.-.- ? ? ? 2 polymer syn ;DNA (5'-D(P*GP*CP*GP*AP*TP*CP*AP*GP*CP*T)-3') ; 3045.005 1 ? ? ? ? 3 polymer syn ;DNA (5'-D(*CP*AP*GP*C)-3') ; 3936.574 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 5 water nat water 18.015 105 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DNA cross-link repair 1C protein,Protein A-SCID,SNM1 homolog C,hSNM1C,SNM1-like protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLLTSPKYRFWKKR IISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQS VYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPEI LHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVRTGESSYRACFSFHSS YSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCRSSQSTEPKKGENLYFQ ; ;SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLLTSPKYRFWKKR IISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQS VYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPEI LHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVRTGESSYRACFSFHSS YSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCRSSQSTEPKKGENLYFQ ; A ? 2 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DA)(DT)(DC)(DA)(DG)(DC)(DT)' GCGATCAGCT B ? 3 polydeoxyribonucleotide no no '(DC)(DA)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DC)(DG)(DC)' CACAGCTGATCGC E ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'ZINC ION' ZN 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 PHE n 1 4 GLU n 1 5 GLY n 1 6 GLN n 1 7 MET n 1 8 ALA n 1 9 GLU n 1 10 TYR n 1 11 PRO n 1 12 THR n 1 13 ILE n 1 14 SER n 1 15 ILE n 1 16 ASP n 1 17 ARG n 1 18 PHE n 1 19 ASP n 1 20 ARG n 1 21 GLU n 1 22 ASN n 1 23 LEU n 1 24 ARG n 1 25 ALA n 1 26 ARG n 1 27 ALA n 1 28 TYR n 1 29 PHE n 1 30 LEU n 1 31 SER n 1 32 HIS n 1 33 CYS n 1 34 HIS n 1 35 LYS n 1 36 ASP n 1 37 HIS n 1 38 MET n 1 39 LYS n 1 40 GLY n 1 41 LEU n 1 42 ARG n 1 43 ALA n 1 44 PRO n 1 45 THR n 1 46 LEU n 1 47 LYS n 1 48 ARG n 1 49 ARG n 1 50 LEU n 1 51 GLU n 1 52 CYS n 1 53 SER n 1 54 LEU n 1 55 LYS n 1 56 VAL n 1 57 TYR n 1 58 LEU n 1 59 TYR n 1 60 CYS n 1 61 SER n 1 62 PRO n 1 63 VAL n 1 64 THR n 1 65 LYS n 1 66 GLU n 1 67 LEU n 1 68 LEU n 1 69 LEU n 1 70 THR n 1 71 SER n 1 72 PRO n 1 73 LYS n 1 74 TYR n 1 75 ARG n 1 76 PHE n 1 77 TRP n 1 78 LYS n 1 79 LYS n 1 80 ARG n 1 81 ILE n 1 82 ILE n 1 83 SER n 1 84 ILE n 1 85 GLU n 1 86 ILE n 1 87 GLU n 1 88 THR n 1 89 PRO n 1 90 THR n 1 91 GLN n 1 92 ILE n 1 93 SER n 1 94 LEU n 1 95 VAL n 1 96 ASP n 1 97 GLU n 1 98 ALA n 1 99 SER n 1 100 GLY n 1 101 GLU n 1 102 LYS n 1 103 GLU n 1 104 GLU n 1 105 ILE n 1 106 VAL n 1 107 VAL n 1 108 THR n 1 109 LEU n 1 110 LEU n 1 111 PRO n 1 112 ALA n 1 113 GLY n 1 114 HIS n 1 115 CYS n 1 116 PRO n 1 117 GLY n 1 118 SER n 1 119 VAL n 1 120 MET n 1 121 PHE n 1 122 LEU n 1 123 PHE n 1 124 GLN n 1 125 GLY n 1 126 ASN n 1 127 ASN n 1 128 GLY n 1 129 THR n 1 130 VAL n 1 131 LEU n 1 132 TYR n 1 133 THR n 1 134 GLY n 1 135 ASP n 1 136 PHE n 1 137 ARG n 1 138 LEU n 1 139 ALA n 1 140 GLN n 1 141 GLY n 1 142 GLU n 1 143 ALA n 1 144 ALA n 1 145 ARG n 1 146 MET n 1 147 GLU n 1 148 LEU n 1 149 LEU n 1 150 HIS n 1 151 SER n 1 152 GLY n 1 153 GLY n 1 154 ARG n 1 155 VAL n 1 156 LYS n 1 157 ASP n 1 158 ILE n 1 159 GLN n 1 160 SER n 1 161 VAL n 1 162 TYR n 1 163 LEU n 1 164 ASP n 1 165 THR n 1 166 THR n 1 167 PHE n 1 168 CYS n 1 169 ASP n 1 170 PRO n 1 171 ARG n 1 172 PHE n 1 173 TYR n 1 174 GLN n 1 175 ILE n 1 176 PRO n 1 177 SER n 1 178 ARG n 1 179 GLU n 1 180 GLU n 1 181 CYS n 1 182 LEU n 1 183 SER n 1 184 GLY n 1 185 VAL n 1 186 LEU n 1 187 GLU n 1 188 LEU n 1 189 VAL n 1 190 ARG n 1 191 SER n 1 192 TRP n 1 193 ILE n 1 194 THR n 1 195 ARG n 1 196 SER n 1 197 PRO n 1 198 TYR n 1 199 HIS n 1 200 VAL n 1 201 VAL n 1 202 TRP n 1 203 LEU n 1 204 ASN n 1 205 CYS n 1 206 LYS n 1 207 ALA n 1 208 ALA n 1 209 TYR n 1 210 GLY n 1 211 TYR n 1 212 GLU n 1 213 TYR n 1 214 LEU n 1 215 PHE n 1 216 THR n 1 217 ASN n 1 218 LEU n 1 219 SER n 1 220 GLU n 1 221 GLU n 1 222 LEU n 1 223 GLY n 1 224 VAL n 1 225 GLN n 1 226 VAL n 1 227 HIS n 1 228 VAL n 1 229 ASN n 1 230 LYS n 1 231 LEU n 1 232 ASP n 1 233 MET n 1 234 PHE n 1 235 ARG n 1 236 ASN n 1 237 MET n 1 238 PRO n 1 239 GLU n 1 240 ILE n 1 241 LEU n 1 242 HIS n 1 243 HIS n 1 244 LEU n 1 245 THR n 1 246 THR n 1 247 ASP n 1 248 ARG n 1 249 ASN n 1 250 THR n 1 251 GLN n 1 252 ILE n 1 253 HIS n 1 254 ALA n 1 255 CYS n 1 256 ARG n 1 257 HIS n 1 258 PRO n 1 259 LYS n 1 260 ALA n 1 261 GLU n 1 262 GLU n 1 263 TYR n 1 264 PHE n 1 265 GLN n 1 266 TRP n 1 267 SER n 1 268 LYS n 1 269 LEU n 1 270 PRO n 1 271 CYS n 1 272 GLY n 1 273 ILE n 1 274 THR n 1 275 SER n 1 276 ARG n 1 277 ASN n 1 278 ARG n 1 279 ILE n 1 280 PRO n 1 281 LEU n 1 282 HIS n 1 283 ILE n 1 284 ILE n 1 285 SER n 1 286 ILE n 1 287 LYS n 1 288 PRO n 1 289 SER n 1 290 THR n 1 291 MET n 1 292 TRP n 1 293 PHE n 1 294 GLY n 1 295 GLU n 1 296 ARG n 1 297 SER n 1 298 ARG n 1 299 LYS n 1 300 THR n 1 301 ASN n 1 302 VAL n 1 303 ILE n 1 304 VAL n 1 305 ARG n 1 306 THR n 1 307 GLY n 1 308 GLU n 1 309 SER n 1 310 SER n 1 311 TYR n 1 312 ARG n 1 313 ALA n 1 314 CYS n 1 315 PHE n 1 316 SER n 1 317 PHE n 1 318 HIS n 1 319 SER n 1 320 SER n 1 321 TYR n 1 322 SER n 1 323 GLU n 1 324 ILE n 1 325 LYS n 1 326 ASP n 1 327 PHE n 1 328 LEU n 1 329 SER n 1 330 TYR n 1 331 LEU n 1 332 CYS n 1 333 PRO n 1 334 VAL n 1 335 ASN n 1 336 ALA n 1 337 TYR n 1 338 PRO n 1 339 ASN n 1 340 VAL n 1 341 ILE n 1 342 PRO n 1 343 VAL n 1 344 GLY n 1 345 THR n 1 346 THR n 1 347 MET n 1 348 ASP n 1 349 LYS n 1 350 VAL n 1 351 VAL n 1 352 GLU n 1 353 ILE n 1 354 LEU n 1 355 LYS n 1 356 PRO n 1 357 LEU n 1 358 CYS n 1 359 ARG n 1 360 SER n 1 361 SER n 1 362 GLN n 1 363 SER n 1 364 THR n 1 365 GLU n 1 366 PRO n 1 367 LYS n 1 368 LYS n 1 369 GLY n 1 370 GLU n 1 371 ASN n 1 372 LEU n 1 373 TYR n 1 374 PHE n 1 375 GLN n 2 1 DG n 2 2 DC n 2 3 DG n 2 4 DA n 2 5 DT n 2 6 DC n 2 7 DA n 2 8 DG n 2 9 DC n 2 10 DT n 3 1 DC n 3 2 DA n 3 3 DC n 3 4 DA n 3 5 DG n 3 6 DC n 3 7 DT n 3 8 DG n 3 9 DA n 3 10 DT n 3 11 DC n 3 12 DG n 3 13 DC n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 375 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DCLRE1C, ARTEMIS, ASCID, SCIDA, SNM1C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 2 1 sample 1 10 'Homo sapiens' ? 9606 ? 3 1 sample 1 13 'Homo sapiens' ? 9606 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 2 ? ? ? A . n A 1 2 SER 2 3 3 SER SER A . n A 1 3 PHE 3 4 4 PHE PHE A . n A 1 4 GLU 4 5 5 GLU GLU A . n A 1 5 GLY 5 6 6 GLY GLY A . n A 1 6 GLN 6 7 7 GLN GLN A . n A 1 7 MET 7 8 8 MET MET A . n A 1 8 ALA 8 9 9 ALA ALA A . n A 1 9 GLU 9 10 10 GLU GLU A . n A 1 10 TYR 10 11 11 TYR TYR A . n A 1 11 PRO 11 12 12 PRO PRO A . n A 1 12 THR 12 13 13 THR THR A . n A 1 13 ILE 13 14 14 ILE ILE A . n A 1 14 SER 14 15 15 SER SER A . n A 1 15 ILE 15 16 16 ILE ILE A . n A 1 16 ASP 16 17 17 ASP ASP A . n A 1 17 ARG 17 18 18 ARG ARG A . n A 1 18 PHE 18 19 19 PHE PHE A . n A 1 19 ASP 19 20 20 ASP ASP A . n A 1 20 ARG 20 21 21 ARG ARG A . n A 1 21 GLU 21 22 22 GLU GLU A . n A 1 22 ASN 22 23 23 ASN ASN A . n A 1 23 LEU 23 24 24 LEU LEU A . n A 1 24 ARG 24 25 25 ARG ARG A . n A 1 25 ALA 25 26 26 ALA ALA A . n A 1 26 ARG 26 27 27 ARG ARG A . n A 1 27 ALA 27 28 28 ALA ALA A . n A 1 28 TYR 28 29 29 TYR TYR A . n A 1 29 PHE 29 30 30 PHE PHE A . n A 1 30 LEU 30 31 31 LEU LEU A . n A 1 31 SER 31 32 32 SER SER A . n A 1 32 HIS 32 33 33 HIS HIS A . n A 1 33 CYS 33 34 34 CYS CYS A . n A 1 34 HIS 34 35 35 HIS HIS A . n A 1 35 LYS 35 36 36 LYS LYS A . n A 1 36 ASP 36 37 37 ASP ASP A . n A 1 37 HIS 37 38 38 HIS HIS A . n A 1 38 MET 38 39 39 MET MET A . n A 1 39 LYS 39 40 40 LYS LYS A . n A 1 40 GLY 40 41 41 GLY GLY A . n A 1 41 LEU 41 42 42 LEU LEU A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 ALA 43 44 44 ALA ALA A . n A 1 44 PRO 44 45 45 PRO PRO A . n A 1 45 THR 45 46 46 THR THR A . n A 1 46 LEU 46 47 47 LEU LEU A . n A 1 47 LYS 47 48 48 LYS LYS A . n A 1 48 ARG 48 49 49 ARG ARG A . n A 1 49 ARG 49 50 50 ARG ARG A . n A 1 50 LEU 50 51 51 LEU LEU A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 CYS 52 53 53 CYS CYS A . n A 1 53 SER 53 54 54 SER SER A . n A 1 54 LEU 54 55 55 LEU LEU A . n A 1 55 LYS 55 56 56 LYS LYS A . n A 1 56 VAL 56 57 57 VAL VAL A . n A 1 57 TYR 57 58 58 TYR TYR A . n A 1 58 LEU 58 59 59 LEU LEU A . n A 1 59 TYR 59 60 60 TYR TYR A . n A 1 60 CYS 60 61 61 CYS CYS A . n A 1 61 SER 61 62 62 SER SER A . n A 1 62 PRO 62 63 63 PRO PRO A . n A 1 63 VAL 63 64 64 VAL VAL A . n A 1 64 THR 64 65 65 THR THR A . n A 1 65 LYS 65 66 66 LYS LYS A . n A 1 66 GLU 66 67 67 GLU GLU A . n A 1 67 LEU 67 68 68 LEU LEU A . n A 1 68 LEU 68 69 69 LEU LEU A . n A 1 69 LEU 69 70 70 LEU LEU A . n A 1 70 THR 70 71 71 THR THR A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 PRO 72 73 73 PRO PRO A . n A 1 73 LYS 73 74 74 LYS LYS A . n A 1 74 TYR 74 75 75 TYR TYR A . n A 1 75 ARG 75 76 76 ARG ARG A . n A 1 76 PHE 76 77 77 PHE PHE A . n A 1 77 TRP 77 78 78 TRP TRP A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 LYS 79 80 80 LYS LYS A . n A 1 80 ARG 80 81 81 ARG ARG A . n A 1 81 ILE 81 82 82 ILE ILE A . n A 1 82 ILE 82 83 83 ILE ILE A . n A 1 83 SER 83 84 84 SER SER A . n A 1 84 ILE 84 85 85 ILE ILE A . n A 1 85 GLU 85 86 86 GLU GLU A . n A 1 86 ILE 86 87 87 ILE ILE A . n A 1 87 GLU 87 88 88 GLU GLU A . n A 1 88 THR 88 89 89 THR THR A . n A 1 89 PRO 89 90 90 PRO PRO A . n A 1 90 THR 90 91 91 THR THR A . n A 1 91 GLN 91 92 92 GLN GLN A . n A 1 92 ILE 92 93 93 ILE ILE A . n A 1 93 SER 93 94 94 SER SER A . n A 1 94 LEU 94 95 95 LEU LEU A . n A 1 95 VAL 95 96 96 VAL VAL A . n A 1 96 ASP 96 97 97 ASP ASP A . n A 1 97 GLU 97 98 98 GLU GLU A . n A 1 98 ALA 98 99 99 ALA ALA A . n A 1 99 SER 99 100 100 SER SER A . n A 1 100 GLY 100 101 101 GLY GLY A . n A 1 101 GLU 101 102 102 GLU GLU A . n A 1 102 LYS 102 103 103 LYS LYS A . n A 1 103 GLU 103 104 104 GLU GLU A . n A 1 104 GLU 104 105 105 GLU GLU A . n A 1 105 ILE 105 106 106 ILE ILE A . n A 1 106 VAL 106 107 107 VAL VAL A . n A 1 107 VAL 107 108 108 VAL VAL A . n A 1 108 THR 108 109 109 THR THR A . n A 1 109 LEU 109 110 110 LEU LEU A . n A 1 110 LEU 110 111 111 LEU LEU A . n A 1 111 PRO 111 112 112 PRO PRO A . n A 1 112 ALA 112 113 113 ALA ALA A . n A 1 113 GLY 113 114 114 GLY GLY A . n A 1 114 HIS 114 115 115 HIS HIS A . n A 1 115 CYS 115 116 116 CYS CYS A . n A 1 116 PRO 116 117 117 PRO PRO A . n A 1 117 GLY 117 118 118 GLY GLY A . n A 1 118 SER 118 119 119 SER SER A . n A 1 119 VAL 119 120 120 VAL VAL A . n A 1 120 MET 120 121 121 MET MET A . n A 1 121 PHE 121 122 122 PHE PHE A . n A 1 122 LEU 122 123 123 LEU LEU A . n A 1 123 PHE 123 124 124 PHE PHE A . n A 1 124 GLN 124 125 125 GLN GLN A . n A 1 125 GLY 125 126 126 GLY GLY A . n A 1 126 ASN 126 127 127 ASN ASN A . n A 1 127 ASN 127 128 128 ASN ASN A . n A 1 128 GLY 128 129 129 GLY GLY A . n A 1 129 THR 129 130 130 THR THR A . n A 1 130 VAL 130 131 131 VAL VAL A . n A 1 131 LEU 131 132 132 LEU LEU A . n A 1 132 TYR 132 133 133 TYR TYR A . n A 1 133 THR 133 134 134 THR THR A . n A 1 134 GLY 134 135 135 GLY GLY A . n A 1 135 ASP 135 136 136 ASP ASP A . n A 1 136 PHE 136 137 137 PHE PHE A . n A 1 137 ARG 137 138 138 ARG ARG A . n A 1 138 LEU 138 139 139 LEU LEU A . n A 1 139 ALA 139 140 140 ALA ALA A . n A 1 140 GLN 140 141 141 GLN GLN A . n A 1 141 GLY 141 142 142 GLY GLY A . n A 1 142 GLU 142 143 143 GLU GLU A . n A 1 143 ALA 143 144 144 ALA ALA A . n A 1 144 ALA 144 145 145 ALA ALA A . n A 1 145 ARG 145 146 146 ARG ARG A . n A 1 146 MET 146 147 147 MET MET A . n A 1 147 GLU 147 148 148 GLU GLU A . n A 1 148 LEU 148 149 149 LEU LEU A . n A 1 149 LEU 149 150 150 LEU LEU A . n A 1 150 HIS 150 151 151 HIS HIS A . n A 1 151 SER 151 152 152 SER SER A . n A 1 152 GLY 152 153 153 GLY GLY A . n A 1 153 GLY 153 154 154 GLY GLY A . n A 1 154 ARG 154 155 155 ARG ARG A . n A 1 155 VAL 155 156 156 VAL VAL A . n A 1 156 LYS 156 157 157 LYS LYS A . n A 1 157 ASP 157 158 158 ASP ASP A . n A 1 158 ILE 158 159 159 ILE ILE A . n A 1 159 GLN 159 160 160 GLN GLN A . n A 1 160 SER 160 161 161 SER SER A . n A 1 161 VAL 161 162 162 VAL VAL A . n A 1 162 TYR 162 163 163 TYR TYR A . n A 1 163 LEU 163 164 164 LEU LEU A . n A 1 164 ASP 164 165 165 ASP ASP A . n A 1 165 THR 165 166 166 THR THR A . n A 1 166 THR 166 167 167 THR THR A . n A 1 167 PHE 167 168 168 PHE PHE A . n A 1 168 CYS 168 169 169 CYS CYS A . n A 1 169 ASP 169 170 170 ASP ASP A . n A 1 170 PRO 170 171 171 PRO PRO A . n A 1 171 ARG 171 172 172 ARG ARG A . n A 1 172 PHE 172 173 173 PHE PHE A . n A 1 173 TYR 173 174 174 TYR TYR A . n A 1 174 GLN 174 175 175 GLN GLN A . n A 1 175 ILE 175 176 176 ILE ILE A . n A 1 176 PRO 176 177 177 PRO PRO A . n A 1 177 SER 177 178 178 SER SER A . n A 1 178 ARG 178 179 179 ARG ARG A . n A 1 179 GLU 179 180 180 GLU GLU A . n A 1 180 GLU 180 181 181 GLU GLU A . n A 1 181 CYS 181 182 182 CYS CYS A . n A 1 182 LEU 182 183 183 LEU LEU A . n A 1 183 SER 183 184 184 SER SER A . n A 1 184 GLY 184 185 185 GLY GLY A . n A 1 185 VAL 185 186 186 VAL VAL A . n A 1 186 LEU 186 187 187 LEU LEU A . n A 1 187 GLU 187 188 188 GLU GLU A . n A 1 188 LEU 188 189 189 LEU LEU A . n A 1 189 VAL 189 190 190 VAL VAL A . n A 1 190 ARG 190 191 191 ARG ARG A . n A 1 191 SER 191 192 192 SER SER A . n A 1 192 TRP 192 193 193 TRP TRP A . n A 1 193 ILE 193 194 194 ILE ILE A . n A 1 194 THR 194 195 195 THR THR A . n A 1 195 ARG 195 196 196 ARG ARG A . n A 1 196 SER 196 197 197 SER SER A . n A 1 197 PRO 197 198 198 PRO PRO A . n A 1 198 TYR 198 199 199 TYR TYR A . n A 1 199 HIS 199 200 200 HIS HIS A . n A 1 200 VAL 200 201 201 VAL VAL A . n A 1 201 VAL 201 202 202 VAL VAL A . n A 1 202 TRP 202 203 203 TRP TRP A . n A 1 203 LEU 203 204 204 LEU LEU A . n A 1 204 ASN 204 205 205 ASN ASN A . n A 1 205 CYS 205 206 206 CYS CYS A . n A 1 206 LYS 206 207 207 LYS LYS A . n A 1 207 ALA 207 208 208 ALA ALA A . n A 1 208 ALA 208 209 209 ALA ALA A . n A 1 209 TYR 209 210 210 TYR TYR A . n A 1 210 GLY 210 211 211 GLY GLY A . n A 1 211 TYR 211 212 212 TYR TYR A . n A 1 212 GLU 212 213 213 GLU GLU A . n A 1 213 TYR 213 214 214 TYR TYR A . n A 1 214 LEU 214 215 215 LEU LEU A . n A 1 215 PHE 215 216 216 PHE PHE A . n A 1 216 THR 216 217 217 THR THR A . n A 1 217 ASN 217 218 218 ASN ASN A . n A 1 218 LEU 218 219 219 LEU LEU A . n A 1 219 SER 219 220 220 SER SER A . n A 1 220 GLU 220 221 221 GLU GLU A . n A 1 221 GLU 221 222 222 GLU GLU A . n A 1 222 LEU 222 223 223 LEU LEU A . n A 1 223 GLY 223 224 224 GLY GLY A . n A 1 224 VAL 224 225 225 VAL VAL A . n A 1 225 GLN 225 226 226 GLN GLN A . n A 1 226 VAL 226 227 227 VAL VAL A . n A 1 227 HIS 227 228 228 HIS HIS A . n A 1 228 VAL 228 229 229 VAL VAL A . n A 1 229 ASN 229 230 230 ASN ASN A . n A 1 230 LYS 230 231 231 LYS LYS A . n A 1 231 LEU 231 232 232 LEU LEU A . n A 1 232 ASP 232 233 233 ASP ASP A . n A 1 233 MET 233 234 234 MET MET A . n A 1 234 PHE 234 235 235 PHE PHE A . n A 1 235 ARG 235 236 236 ARG ARG A . n A 1 236 ASN 236 237 237 ASN ASN A . n A 1 237 MET 237 238 238 MET MET A . n A 1 238 PRO 238 239 239 PRO PRO A . n A 1 239 GLU 239 240 240 GLU GLU A . n A 1 240 ILE 240 241 241 ILE ILE A . n A 1 241 LEU 241 242 242 LEU LEU A . n A 1 242 HIS 242 243 243 HIS HIS A . n A 1 243 HIS 243 244 244 HIS HIS A . n A 1 244 LEU 244 245 245 LEU LEU A . n A 1 245 THR 245 246 246 THR THR A . n A 1 246 THR 246 247 247 THR THR A . n A 1 247 ASP 247 248 248 ASP ASP A . n A 1 248 ARG 248 249 249 ARG ARG A . n A 1 249 ASN 249 250 250 ASN ASN A . n A 1 250 THR 250 251 251 THR THR A . n A 1 251 GLN 251 252 252 GLN GLN A . n A 1 252 ILE 252 253 253 ILE ILE A . n A 1 253 HIS 253 254 254 HIS HIS A . n A 1 254 ALA 254 255 255 ALA ALA A . n A 1 255 CYS 255 256 256 CYS CYS A . n A 1 256 ARG 256 257 257 ARG ARG A . n A 1 257 HIS 257 258 258 HIS HIS A . n A 1 258 PRO 258 259 259 PRO PRO A . n A 1 259 LYS 259 260 260 LYS LYS A . n A 1 260 ALA 260 261 261 ALA ALA A . n A 1 261 GLU 261 262 262 GLU GLU A . n A 1 262 GLU 262 263 263 GLU GLU A . n A 1 263 TYR 263 264 264 TYR TYR A . n A 1 264 PHE 264 265 265 PHE PHE A . n A 1 265 GLN 265 266 266 GLN GLN A . n A 1 266 TRP 266 267 267 TRP TRP A . n A 1 267 SER 267 268 268 SER SER A . n A 1 268 LYS 268 269 269 LYS LYS A . n A 1 269 LEU 269 270 270 LEU LEU A . n A 1 270 PRO 270 271 271 PRO PRO A . n A 1 271 CYS 271 272 272 CYS CYS A . n A 1 272 GLY 272 273 273 GLY GLY A . n A 1 273 ILE 273 274 274 ILE ILE A . n A 1 274 THR 274 275 275 THR THR A . n A 1 275 SER 275 276 276 SER SER A . n A 1 276 ARG 276 277 277 ARG ARG A . n A 1 277 ASN 277 278 278 ASN ASN A . n A 1 278 ARG 278 279 279 ARG ARG A . n A 1 279 ILE 279 280 280 ILE ILE A . n A 1 280 PRO 280 281 281 PRO PRO A . n A 1 281 LEU 281 282 282 LEU LEU A . n A 1 282 HIS 282 283 283 HIS HIS A . n A 1 283 ILE 283 284 284 ILE ILE A . n A 1 284 ILE 284 285 285 ILE ILE A . n A 1 285 SER 285 286 286 SER SER A . n A 1 286 ILE 286 287 287 ILE ILE A . n A 1 287 LYS 287 288 288 LYS LYS A . n A 1 288 PRO 288 289 289 PRO PRO A . n A 1 289 SER 289 290 290 SER SER A . n A 1 290 THR 290 291 291 THR THR A . n A 1 291 MET 291 292 292 MET MET A . n A 1 292 TRP 292 293 293 TRP TRP A . n A 1 293 PHE 293 294 294 PHE PHE A . n A 1 294 GLY 294 295 295 GLY GLY A . n A 1 295 GLU 295 296 296 GLU GLU A . n A 1 296 ARG 296 297 297 ARG ARG A . n A 1 297 SER 297 298 298 SER SER A . n A 1 298 ARG 298 299 299 ARG ARG A . n A 1 299 LYS 299 300 300 LYS LYS A . n A 1 300 THR 300 301 301 THR THR A . n A 1 301 ASN 301 302 302 ASN ASN A . n A 1 302 VAL 302 303 303 VAL VAL A . n A 1 303 ILE 303 304 304 ILE ILE A . n A 1 304 VAL 304 305 305 VAL VAL A . n A 1 305 ARG 305 306 306 ARG ARG A . n A 1 306 THR 306 307 307 THR THR A . n A 1 307 GLY 307 308 308 GLY GLY A . n A 1 308 GLU 308 309 309 GLU GLU A . n A 1 309 SER 309 310 310 SER SER A . n A 1 310 SER 310 311 311 SER SER A . n A 1 311 TYR 311 312 312 TYR TYR A . n A 1 312 ARG 312 313 313 ARG ARG A . n A 1 313 ALA 313 314 314 ALA ALA A . n A 1 314 CYS 314 315 315 CYS CYS A . n A 1 315 PHE 315 316 316 PHE PHE A . n A 1 316 SER 316 317 317 SER SER A . n A 1 317 PHE 317 318 318 PHE PHE A . n A 1 318 HIS 318 319 319 HIS HIS A . n A 1 319 SER 319 320 320 SER SER A . n A 1 320 SER 320 321 321 SER SER A . n A 1 321 TYR 321 322 322 TYR TYR A . n A 1 322 SER 322 323 323 SER SER A . n A 1 323 GLU 323 324 324 GLU GLU A . n A 1 324 ILE 324 325 325 ILE ILE A . n A 1 325 LYS 325 326 326 LYS LYS A . n A 1 326 ASP 326 327 327 ASP ASP A . n A 1 327 PHE 327 328 328 PHE PHE A . n A 1 328 LEU 328 329 329 LEU LEU A . n A 1 329 SER 329 330 330 SER SER A . n A 1 330 TYR 330 331 331 TYR TYR A . n A 1 331 LEU 331 332 332 LEU LEU A . n A 1 332 CYS 332 333 333 CYS CYS A . n A 1 333 PRO 333 334 334 PRO PRO A . n A 1 334 VAL 334 335 335 VAL VAL A . n A 1 335 ASN 335 336 336 ASN ASN A . n A 1 336 ALA 336 337 337 ALA ALA A . n A 1 337 TYR 337 338 338 TYR TYR A . n A 1 338 PRO 338 339 339 PRO PRO A . n A 1 339 ASN 339 340 340 ASN ASN A . n A 1 340 VAL 340 341 341 VAL VAL A . n A 1 341 ILE 341 342 342 ILE ILE A . n A 1 342 PRO 342 343 343 PRO PRO A . n A 1 343 VAL 343 344 344 VAL VAL A . n A 1 344 GLY 344 345 345 GLY GLY A . n A 1 345 THR 345 346 346 THR THR A . n A 1 346 THR 346 347 347 THR THR A . n A 1 347 MET 347 348 348 MET MET A . n A 1 348 ASP 348 349 349 ASP ASP A . n A 1 349 LYS 349 350 350 LYS LYS A . n A 1 350 VAL 350 351 351 VAL VAL A . n A 1 351 VAL 351 352 352 VAL VAL A . n A 1 352 GLU 352 353 353 GLU GLU A . n A 1 353 ILE 353 354 354 ILE ILE A . n A 1 354 LEU 354 355 355 LEU LEU A . n A 1 355 LYS 355 356 356 LYS LYS A . n A 1 356 PRO 356 357 357 PRO PRO A . n A 1 357 LEU 357 358 358 LEU LEU A . n A 1 358 CYS 358 359 359 CYS CYS A . n A 1 359 ARG 359 360 360 ARG ARG A . n A 1 360 SER 360 361 361 SER SER A . n A 1 361 SER 361 362 ? ? ? A . n A 1 362 GLN 362 363 ? ? ? A . n A 1 363 SER 363 364 ? ? ? A . n A 1 364 THR 364 365 ? ? ? A . n A 1 365 GLU 365 366 ? ? ? A . n A 1 366 PRO 366 367 ? ? ? A . n A 1 367 LYS 367 368 ? ? ? A . n A 1 368 LYS 368 369 ? ? ? A . n A 1 369 GLY 369 370 ? ? ? A . n A 1 370 GLU 370 371 ? ? ? A . n A 1 371 ASN 371 372 ? ? ? A . n A 1 372 LEU 372 373 ? ? ? A . n A 1 373 TYR 373 374 ? ? ? A . n A 1 374 PHE 374 375 ? ? ? A . n A 1 375 GLN 375 376 ? ? ? A . n B 2 1 DG 1 -2 -2 DG DG B . n B 2 2 DC 2 -1 -1 DC DC B . n B 2 3 DG 3 0 0 DG DG B . n B 2 4 DA 4 1 1 DA DA B . n B 2 5 DT 5 2 2 DT DT B . n B 2 6 DC 6 3 3 DC DC B . n B 2 7 DA 7 4 4 DA DA B . n B 2 8 DG 8 5 5 DG DG B . n B 2 9 DC 9 6 6 DC DC B . n B 2 10 DT 10 7 7 DT DT B . n C 3 1 DC 1 -2 ? ? ? E . n C 3 2 DA 2 -1 ? ? ? E . n C 3 3 DC 3 0 0 DC DC E . n C 3 4 DA 4 1 1 DA DA E . n C 3 5 DG 5 2 2 DG DG E . n C 3 6 DC 6 3 3 DC DC E . n C 3 7 DT 7 4 ? ? ? E . n C 3 8 DG 8 5 ? ? ? E . n C 3 9 DA 9 6 ? ? ? E . n C 3 10 DT 10 7 ? ? ? E . n C 3 11 DC 11 8 ? ? ? E . n C 3 12 DG 12 9 ? ? ? E . n C 3 13 DC 13 10 ? ? ? E . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 ZN 1 401 401 ZN ZN A . E 4 ZN 1 402 402 ZN ZN A . F 4 ZN 1 101 1 ZN ZN E . G 5 HOH 1 501 11 HOH HOH A . G 5 HOH 2 502 79 HOH HOH A . G 5 HOH 3 503 73 HOH HOH A . G 5 HOH 4 504 51 HOH HOH A . G 5 HOH 5 505 88 HOH HOH A . G 5 HOH 6 506 45 HOH HOH A . G 5 HOH 7 507 104 HOH HOH A . G 5 HOH 8 508 59 HOH HOH A . G 5 HOH 9 509 83 HOH HOH A . G 5 HOH 10 510 63 HOH HOH A . G 5 HOH 11 511 37 HOH HOH A . G 5 HOH 12 512 25 HOH HOH A . G 5 HOH 13 513 65 HOH HOH A . G 5 HOH 14 514 22 HOH HOH A . G 5 HOH 15 515 52 HOH HOH A . G 5 HOH 16 516 18 HOH HOH A . G 5 HOH 17 517 4 HOH HOH A . G 5 HOH 18 518 98 HOH HOH A . G 5 HOH 19 519 43 HOH HOH A . G 5 HOH 20 520 91 HOH HOH A . G 5 HOH 21 521 35 HOH HOH A . G 5 HOH 22 522 71 HOH HOH A . G 5 HOH 23 523 69 HOH HOH A . G 5 HOH 24 524 53 HOH HOH A . G 5 HOH 25 525 14 HOH HOH A . G 5 HOH 26 526 67 HOH HOH A . G 5 HOH 27 527 66 HOH HOH A . G 5 HOH 28 528 48 HOH HOH A . G 5 HOH 29 529 7 HOH HOH A . G 5 HOH 30 530 27 HOH HOH A . G 5 HOH 31 531 105 HOH HOH A . G 5 HOH 32 532 8 HOH HOH A . G 5 HOH 33 533 64 HOH HOH A . G 5 HOH 34 534 2 HOH HOH A . G 5 HOH 35 535 34 HOH HOH A . G 5 HOH 36 536 81 HOH HOH A . G 5 HOH 37 537 75 HOH HOH A . G 5 HOH 38 538 44 HOH HOH A . G 5 HOH 39 539 78 HOH HOH A . G 5 HOH 40 540 61 HOH HOH A . G 5 HOH 41 541 46 HOH HOH A . G 5 HOH 42 542 62 HOH HOH A . G 5 HOH 43 543 17 HOH HOH A . G 5 HOH 44 544 21 HOH HOH A . G 5 HOH 45 545 24 HOH HOH A . G 5 HOH 46 546 6 HOH HOH A . G 5 HOH 47 547 54 HOH HOH A . G 5 HOH 48 548 87 HOH HOH A . G 5 HOH 49 549 26 HOH HOH A . G 5 HOH 50 550 60 HOH HOH A . G 5 HOH 51 551 13 HOH HOH A . G 5 HOH 52 552 28 HOH HOH A . G 5 HOH 53 553 55 HOH HOH A . G 5 HOH 54 554 38 HOH HOH A . G 5 HOH 55 555 56 HOH HOH A . G 5 HOH 56 556 96 HOH HOH A . G 5 HOH 57 557 84 HOH HOH A . G 5 HOH 58 558 47 HOH HOH A . G 5 HOH 59 559 36 HOH HOH A . G 5 HOH 60 560 10 HOH HOH A . G 5 HOH 61 561 3 HOH HOH A . G 5 HOH 62 562 89 HOH HOH A . G 5 HOH 63 563 50 HOH HOH A . G 5 HOH 64 564 72 HOH HOH A . G 5 HOH 65 565 85 HOH HOH A . G 5 HOH 66 566 12 HOH HOH A . G 5 HOH 67 567 77 HOH HOH A . G 5 HOH 68 568 103 HOH HOH A . G 5 HOH 69 569 40 HOH HOH A . G 5 HOH 70 570 49 HOH HOH A . G 5 HOH 71 571 93 HOH HOH A . G 5 HOH 72 572 32 HOH HOH A . G 5 HOH 73 573 29 HOH HOH A . G 5 HOH 74 574 20 HOH HOH A . G 5 HOH 75 575 95 HOH HOH A . G 5 HOH 76 576 1 HOH HOH A . G 5 HOH 77 577 19 HOH HOH A . G 5 HOH 78 578 97 HOH HOH A . G 5 HOH 79 579 76 HOH HOH A . G 5 HOH 80 580 99 HOH HOH A . G 5 HOH 81 581 9 HOH HOH A . G 5 HOH 82 582 68 HOH HOH A . G 5 HOH 83 583 41 HOH HOH A . G 5 HOH 84 584 80 HOH HOH A . G 5 HOH 85 585 30 HOH HOH A . G 5 HOH 86 586 39 HOH HOH A . G 5 HOH 87 587 5 HOH HOH A . G 5 HOH 88 588 15 HOH HOH A . G 5 HOH 89 589 86 HOH HOH A . G 5 HOH 90 590 57 HOH HOH A . G 5 HOH 91 591 100 HOH HOH A . G 5 HOH 92 592 42 HOH HOH A . G 5 HOH 93 593 16 HOH HOH A . G 5 HOH 94 594 102 HOH HOH A . G 5 HOH 95 595 92 HOH HOH A . G 5 HOH 96 596 31 HOH HOH A . G 5 HOH 97 597 33 HOH HOH A . G 5 HOH 98 598 101 HOH HOH A . G 5 HOH 99 599 82 HOH HOH A . G 5 HOH 100 600 94 HOH HOH A . G 5 HOH 101 601 74 HOH HOH A . G 5 HOH 102 602 58 HOH HOH A . G 5 HOH 103 603 90 HOH HOH A . H 5 HOH 1 201 70 HOH HOH E . H 5 HOH 2 202 23 HOH HOH E . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 E DC 0 ? P ? C DC 3 P 2 1 Y 1 E DC 0 ? OP1 ? C DC 3 OP1 3 1 Y 1 E DC 0 ? OP2 ? C DC 3 OP2 4 1 Y 1 E DC 0 ? "O5'" ? C DC 3 "O5'" 5 1 Y 1 E DC 0 ? "C5'" ? C DC 3 "C5'" 6 1 Y 1 E DC 0 ? "C4'" ? C DC 3 "C4'" 7 1 Y 1 E DC 0 ? "O4'" ? C DC 3 "O4'" 8 1 Y 1 E DC 0 ? "C3'" ? C DC 3 "C3'" 9 1 Y 1 E DC 0 ? "C2'" ? C DC 3 "C2'" 10 1 Y 1 E DC 0 ? "C1'" ? C DC 3 "C1'" 11 1 Y 1 E DC 0 ? N1 ? C DC 3 N1 12 1 Y 1 E DC 0 ? C2 ? C DC 3 C2 13 1 Y 1 E DC 0 ? O2 ? C DC 3 O2 14 1 Y 1 E DC 0 ? N3 ? C DC 3 N3 15 1 Y 1 E DC 0 ? C4 ? C DC 3 C4 16 1 Y 1 E DC 0 ? N4 ? C DC 3 N4 17 1 Y 1 E DC 0 ? C5 ? C DC 3 C5 18 1 Y 1 E DC 0 ? C6 ? C DC 3 C6 19 1 Y 1 E DC 3 ? "C5'" ? C DC 6 "C5'" 20 1 Y 1 E DC 3 ? "C4'" ? C DC 6 "C4'" 21 1 Y 1 E DC 3 ? "O4'" ? C DC 6 "O4'" 22 1 Y 1 E DC 3 ? "C3'" ? C DC 6 "C3'" 23 1 Y 1 E DC 3 ? "O3'" ? C DC 6 "O3'" 24 1 Y 1 E DC 3 ? "C2'" ? C DC 6 "C2'" 25 1 Y 1 E DC 3 ? "C1'" ? C DC 6 "C1'" 26 1 Y 1 E DC 3 ? N1 ? C DC 6 N1 27 1 Y 1 E DC 3 ? C2 ? C DC 6 C2 28 1 Y 1 E DC 3 ? O2 ? C DC 6 O2 29 1 Y 1 E DC 3 ? N3 ? C DC 6 N3 30 1 Y 1 E DC 3 ? C4 ? C DC 6 C4 31 1 Y 1 E DC 3 ? N4 ? C DC 6 N4 32 1 Y 1 E DC 3 ? C5 ? C DC 6 C5 33 1 Y 1 E DC 3 ? C6 ? C DC 6 C6 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7ABS _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.690 _cell.length_a_esd ? _cell.length_b 111.010 _cell.length_b_esd ? _cell.length_c 55.160 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7ABS _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ABS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50 mM MES pH 6.5, 0.1 M LiCl, 0.01 M MgCl2, 12% PEG 4000 (w/v)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7ABS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.97 _reflns.d_resolution_low 35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 32168 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.97 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2189 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.828 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 5.95 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -2.90 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -3.05 _refine.B_iso_max ? _refine.B_iso_mean 53.197 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.908 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7ABS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.97 _refine.ls_d_res_low 34.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30565 _refine.ls_number_reflns_R_free 1560 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.53 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21802 _refine.ls_R_factor_R_free 0.27588 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21520 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6WO0 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.187 _refine.pdbx_overall_ESU_R_Free 0.181 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.358 _refine.overall_SU_ML 0.187 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.97 _refine_hist.d_res_low 34.54 _refine_hist.number_atoms_solvent 105 _refine_hist.number_atoms_total 3272 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2911 _refine_hist.pdbx_number_atoms_nucleic_acid 253 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 3280 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2911 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.586 1.603 4496 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.291 1.637 6758 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.837 5.000 362 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.261 20.429 163 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.010 15.000 526 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.782 15.000 26 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.073 0.200 423 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 3461 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 741 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.777 5.268 1439 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.757 5.264 1438 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.273 7.888 1798 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.278 7.891 1799 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.775 5.983 1841 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.778 5.984 1837 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.156 8.755 2694 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 10.267 59.852 3637 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 10.265 59.844 3638 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.970 _refine_ls_shell.d_res_low 2.021 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 118 _refine_ls_shell.number_reflns_R_work 2189 _refine_ls_shell.percent_reflns_obs 99.57 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.371 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.407 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7ABS _struct.title 'Structure of human DCLRE1C/Artemis in complex with DNA - re-evaluation of 6WO0' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ABS _struct_keywords.text 'Artemis, NHEJ, Nuclease, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? H N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP DCR1C_HUMAN Q96SD1 Q96SD1-4 1 ;SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLLTSPKYRFWKKR IISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQS VYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPEI LHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVRTGESSYRACFSFHSS YSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCRSSQSTEPK ; 2 2 PDB 7ABS 7ABS ? 2 ? 1 3 PDB 7ABS 7ABS ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7ABS A 1 ? 367 ? Q96SD1 2 ? 368 ? 2 368 2 2 7ABS B 1 ? 10 ? 7ABS -2 ? 7 ? -2 7 3 3 7ABS E 1 ? 13 ? 7ABS -2 ? 10 ? -2 10 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7ABS LYS A 368 ? UNP Q96SD1 ? ? 'expression tag' 369 1 1 7ABS GLY A 369 ? UNP Q96SD1 ? ? 'expression tag' 370 2 1 7ABS GLU A 370 ? UNP Q96SD1 ? ? 'expression tag' 371 3 1 7ABS ASN A 371 ? UNP Q96SD1 ? ? 'expression tag' 372 4 1 7ABS LEU A 372 ? UNP Q96SD1 ? ? 'expression tag' 373 5 1 7ABS TYR A 373 ? UNP Q96SD1 ? ? 'expression tag' 374 6 1 7ABS PHE A 374 ? UNP Q96SD1 ? ? 'expression tag' 375 7 1 7ABS GLN A 375 ? UNP Q96SD1 ? ? 'expression tag' 376 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 19 ? ALA A 25 ? ASP A 20 ALA A 26 5 ? 7 HELX_P HELX_P2 AA2 HIS A 34 ? MET A 38 ? HIS A 35 MET A 39 5 ? 5 HELX_P HELX_P3 AA3 ALA A 43 ? SER A 53 ? ALA A 44 SER A 54 1 ? 11 HELX_P HELX_P4 AA4 SER A 61 ? LEU A 69 ? SER A 62 LEU A 70 1 ? 9 HELX_P HELX_P5 AA5 SER A 71 ? LYS A 78 ? SER A 72 LYS A 79 5 ? 8 HELX_P HELX_P6 AA6 GLU A 142 ? LEU A 148 ? GLU A 143 LEU A 149 5 ? 7 HELX_P HELX_P7 AA7 ASP A 169 ? TYR A 173 ? ASP A 170 TYR A 174 5 ? 5 HELX_P HELX_P8 AA8 SER A 177 ? THR A 194 ? SER A 178 THR A 195 1 ? 18 HELX_P HELX_P9 AA9 TYR A 211 ? GLY A 223 ? TYR A 212 GLY A 224 1 ? 13 HELX_P HELX_P10 AB1 LEU A 231 ? ARG A 235 ? LEU A 232 ARG A 236 5 ? 5 HELX_P HELX_P11 AB2 MET A 237 ? HIS A 242 ? MET A 238 HIS A 243 1 ? 6 HELX_P HELX_P12 AB3 LYS A 259 ? TRP A 266 ? LYS A 260 TRP A 267 1 ? 8 HELX_P HELX_P13 AB4 SER A 320 ? CYS A 332 ? SER A 321 CYS A 333 1 ? 13 HELX_P HELX_P14 AB5 THR A 346 ? LYS A 355 ? THR A 347 LYS A 356 1 ? 10 HELX_P HELX_P15 AB6 PRO A 356 ? CYS A 358 ? PRO A 357 CYS A 359 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 32 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 33 A ZN 402 1_555 ? ? ? ? ? ? ? 2.109 ? ? metalc2 metalc ? ? A HIS 34 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 35 A ZN 402 1_555 ? ? ? ? ? ? ? 2.264 ? ? metalc3 metalc ? ? A HIS 114 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 115 A ZN 402 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc4 metalc ? ? A ASP 135 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 136 A ZN 402 1_555 ? ? ? ? ? ? ? 2.203 ? ? metalc5 metalc ? ? A HIS 227 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 228 A ZN 401 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc6 metalc ? ? A HIS 253 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 254 A ZN 401 1_555 ? ? ? ? ? ? ? 2.028 ? ? metalc7 metalc ? ? A CYS 255 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 256 A ZN 401 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc8 metalc ? ? A CYS 271 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 272 A ZN 401 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc9 metalc ? ? E ZN . ZN ? ? ? 1_555 C DA 4 OP1 ? ? A ZN 402 E DA 1 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc10 metalc ? ? E ZN . ZN ? ? ? 1_555 H HOH . O ? ? A ZN 402 E HOH 202 1_555 ? ? ? ? ? ? ? 2.393 ? ? metalc11 metalc ? ? G HOH . O ? ? ? 1_555 F ZN . ZN ? ? A HOH 540 E ZN 101 1_555 ? ? ? ? ? ? ? 2.280 ? ? metalc12 metalc ? ? C DA 4 OP2 ? ? ? 1_555 F ZN . ZN ? ? E DA 1 E ZN 101 1_555 ? ? ? ? ? ? ? 2.204 ? ? hydrog1 hydrog ? ? B DC 2 N3 ? ? ? 1_555 B DC 2 N4 ? ? B DC -1 B DC -1 2_655 ? ? ? ? ? ? TYPE_14_PAIR ? ? ? hydrog2 hydrog ? ? B DC 2 N4 ? ? ? 1_555 B DC 2 N3 ? ? B DC -1 B DC -1 2_655 ? ? ? ? ? ? TYPE_14_PAIR ? ? ? hydrog3 hydrog ? ? B DG 8 N2 ? ? ? 1_555 B DG 8 N3 ? ? B DG 5 B DG 5 2_655 ? ? ? ? ? ? TYPE_4_PAIR ? ? ? hydrog4 hydrog ? ? B DG 8 N3 ? ? ? 1_555 B DG 8 N2 ? ? B DG 5 B DG 5 2_655 ? ? ? ? ? ? TYPE_4_PAIR ? ? ? hydrog5 hydrog ? ? B DC 9 N3 ? ? ? 1_555 C DG 5 N1 ? ? B DC 6 E DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? B DC 9 N4 ? ? ? 1_555 C DG 5 O6 ? ? B DC 6 E DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? B DC 9 O2 ? ? ? 1_555 C DG 5 N2 ? ? B DC 6 E DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? B DT 10 O2 ? ? ? 1_555 C DA 4 N6 ? ? B DT 7 E DA 1 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? hydrog ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 32 ? A HIS 33 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 ND1 ? A HIS 34 ? A HIS 35 ? 1_555 92.6 ? 2 NE2 ? A HIS 32 ? A HIS 33 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 114 ? A HIS 115 ? 1_555 93.1 ? 3 ND1 ? A HIS 34 ? A HIS 35 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 114 ? A HIS 115 ? 1_555 91.2 ? 4 NE2 ? A HIS 32 ? A HIS 33 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 OD2 ? A ASP 135 ? A ASP 136 ? 1_555 95.0 ? 5 ND1 ? A HIS 34 ? A HIS 35 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 OD2 ? A ASP 135 ? A ASP 136 ? 1_555 170.1 ? 6 NE2 ? A HIS 114 ? A HIS 115 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 OD2 ? A ASP 135 ? A ASP 136 ? 1_555 94.7 ? 7 NE2 ? A HIS 32 ? A HIS 33 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 OP1 ? C DA 4 ? E DA 1 ? 1_555 176.1 ? 8 ND1 ? A HIS 34 ? A HIS 35 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 OP1 ? C DA 4 ? E DA 1 ? 1_555 91.3 ? 9 NE2 ? A HIS 114 ? A HIS 115 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 OP1 ? C DA 4 ? E DA 1 ? 1_555 87.2 ? 10 OD2 ? A ASP 135 ? A ASP 136 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 OP1 ? C DA 4 ? E DA 1 ? 1_555 81.1 ? 11 NE2 ? A HIS 32 ? A HIS 33 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 O ? H HOH . ? E HOH 202 ? 1_555 99.1 ? 12 ND1 ? A HIS 34 ? A HIS 35 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 O ? H HOH . ? E HOH 202 ? 1_555 94.7 ? 13 NE2 ? A HIS 114 ? A HIS 115 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 O ? H HOH . ? E HOH 202 ? 1_555 166.2 ? 14 OD2 ? A ASP 135 ? A ASP 136 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 O ? H HOH . ? E HOH 202 ? 1_555 77.9 ? 15 OP1 ? C DA 4 ? E DA 1 ? 1_555 ZN ? E ZN . ? A ZN 402 ? 1_555 O ? H HOH . ? E HOH 202 ? 1_555 80.2 ? 16 ND1 ? A HIS 227 ? A HIS 228 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 253 ? A HIS 254 ? 1_555 97.0 ? 17 ND1 ? A HIS 227 ? A HIS 228 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 SG ? A CYS 255 ? A CYS 256 ? 1_555 114.6 ? 18 ND1 ? A HIS 253 ? A HIS 254 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 SG ? A CYS 255 ? A CYS 256 ? 1_555 114.6 ? 19 ND1 ? A HIS 227 ? A HIS 228 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 SG ? A CYS 271 ? A CYS 272 ? 1_555 110.4 ? 20 ND1 ? A HIS 253 ? A HIS 254 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 SG ? A CYS 271 ? A CYS 272 ? 1_555 110.1 ? 21 SG ? A CYS 255 ? A CYS 256 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 SG ? A CYS 271 ? A CYS 272 ? 1_555 109.6 ? 22 O ? G HOH . ? A HOH 540 ? 1_555 ZN ? F ZN . ? E ZN 101 ? 1_555 OP2 ? C DA 4 ? E DA 1 ? 1_555 175.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 2 ? AA4 ? 7 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel AA4 4 5 ? parallel AA4 5 6 ? parallel AA4 6 7 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 13 ? ILE A 15 ? ILE A 14 ILE A 16 AA1 2 ALA A 27 ? PHE A 29 ? ALA A 28 PHE A 30 AA1 3 LEU A 58 ? CYS A 60 ? LEU A 59 CYS A 61 AA1 4 ILE A 81 ? SER A 83 ? ILE A 82 SER A 84 AA2 1 THR A 90 ? VAL A 95 ? THR A 91 VAL A 96 AA2 2 LYS A 102 ? PRO A 111 ? LYS A 103 PRO A 112 AA2 3 VAL A 119 ? GLY A 125 ? VAL A 120 GLY A 126 AA2 4 GLY A 128 ? TYR A 132 ? GLY A 129 TYR A 133 AA2 5 SER A 160 ? LEU A 163 ? SER A 161 LEU A 164 AA2 6 ASN A 335 ? PRO A 338 ? ASN A 336 PRO A 339 AA3 1 HIS A 150 ? SER A 151 ? HIS A 151 SER A 152 AA3 2 ARG A 154 ? VAL A 155 ? ARG A 155 VAL A 156 AA4 1 LEU A 244 ? THR A 245 ? LEU A 245 THR A 246 AA4 2 VAL A 226 ? HIS A 227 ? VAL A 227 HIS A 228 AA4 3 ILE A 252 ? HIS A 253 ? ILE A 253 HIS A 254 AA4 4 HIS A 199 ? LEU A 203 ? HIS A 200 LEU A 204 AA4 5 HIS A 282 ? PRO A 288 ? HIS A 283 PRO A 289 AA4 6 SER A 310 ? ALA A 313 ? SER A 311 ALA A 314 AA4 7 ILE A 303 ? GLY A 307 ? ILE A 304 GLY A 308 AA5 1 SER A 275 ? ARG A 276 ? SER A 276 ARG A 277 AA5 2 ILE A 279 ? PRO A 280 ? ILE A 280 PRO A 281 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 14 ? N SER A 15 O ALA A 27 ? O ALA A 28 AA1 2 3 N TYR A 28 ? N TYR A 29 O TYR A 59 ? O TYR A 60 AA1 3 4 N LEU A 58 ? N LEU A 59 O ILE A 82 ? O ILE A 83 AA2 1 2 N LEU A 94 ? N LEU A 95 O GLU A 103 ? O GLU A 104 AA2 2 3 N VAL A 106 ? N VAL A 107 O GLN A 124 ? O GLN A 125 AA2 3 4 N PHE A 123 ? N PHE A 124 O VAL A 130 ? O VAL A 131 AA2 4 5 N LEU A 131 ? N LEU A 132 O TYR A 162 ? O TYR A 163 AA2 5 6 N VAL A 161 ? N VAL A 162 O TYR A 337 ? O TYR A 338 AA3 1 2 N SER A 151 ? N SER A 152 O ARG A 154 ? O ARG A 155 AA4 1 2 O THR A 245 ? O THR A 246 N VAL A 226 ? N VAL A 227 AA4 2 3 N HIS A 227 ? N HIS A 228 O ILE A 252 ? O ILE A 253 AA4 3 4 O HIS A 253 ? O HIS A 254 N LEU A 203 ? N LEU A 204 AA4 4 5 N VAL A 200 ? N VAL A 201 O HIS A 282 ? O HIS A 283 AA4 5 6 N SER A 285 ? N SER A 286 O TYR A 311 ? O TYR A 312 AA4 6 7 O SER A 310 ? O SER A 311 N THR A 306 ? N THR A 307 AA5 1 2 N ARG A 276 ? N ARG A 277 O ILE A 279 ? O ILE A 280 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 309 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 501 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 21 ? ? 49.91 -127.11 2 1 PHE A 173 ? ? -90.31 45.71 3 1 ARG A 297 ? ? -47.91 108.01 # _pdbx_entry_details.entry_id 7ABS _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 2 ? A SER 1 2 1 Y 1 A SER 362 ? A SER 361 3 1 Y 1 A GLN 363 ? A GLN 362 4 1 Y 1 A SER 364 ? A SER 363 5 1 Y 1 A THR 365 ? A THR 364 6 1 Y 1 A GLU 366 ? A GLU 365 7 1 Y 1 A PRO 367 ? A PRO 366 8 1 Y 1 A LYS 368 ? A LYS 367 9 1 Y 1 A LYS 369 ? A LYS 368 10 1 Y 1 A GLY 370 ? A GLY 369 11 1 Y 1 A GLU 371 ? A GLU 370 12 1 Y 1 A ASN 372 ? A ASN 371 13 1 Y 1 A LEU 373 ? A LEU 372 14 1 Y 1 A TYR 374 ? A TYR 373 15 1 Y 1 A PHE 375 ? A PHE 374 16 1 Y 1 A GLN 376 ? A GLN 375 17 1 Y 1 E DC -2 ? C DC 1 18 1 Y 1 E DA -1 ? C DA 2 19 1 Y 1 E DT 4 ? C DT 7 20 1 Y 1 E DG 5 ? C DG 8 21 1 Y 1 E DA 6 ? C DA 9 22 1 Y 1 E DT 7 ? C DT 10 23 1 Y 1 E DC 8 ? C DC 11 24 1 Y 1 E DG 9 ? C DG 12 25 1 Y 1 E DC 10 ? C DC 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DA OP3 O N N 88 DA P P N N 89 DA OP1 O N N 90 DA OP2 O N N 91 DA "O5'" O N N 92 DA "C5'" C N N 93 DA "C4'" C N R 94 DA "O4'" O N N 95 DA "C3'" C N S 96 DA "O3'" O N N 97 DA "C2'" C N N 98 DA "C1'" C N R 99 DA N9 N Y N 100 DA C8 C Y N 101 DA N7 N Y N 102 DA C5 C Y N 103 DA C6 C Y N 104 DA N6 N N N 105 DA N1 N Y N 106 DA C2 C Y N 107 DA N3 N Y N 108 DA C4 C Y N 109 DA HOP3 H N N 110 DA HOP2 H N N 111 DA "H5'" H N N 112 DA "H5''" H N N 113 DA "H4'" H N N 114 DA "H3'" H N N 115 DA "HO3'" H N N 116 DA "H2'" H N N 117 DA "H2''" H N N 118 DA "H1'" H N N 119 DA H8 H N N 120 DA H61 H N N 121 DA H62 H N N 122 DA H2 H N N 123 DC OP3 O N N 124 DC P P N N 125 DC OP1 O N N 126 DC OP2 O N N 127 DC "O5'" O N N 128 DC "C5'" C N N 129 DC "C4'" C N R 130 DC "O4'" O N N 131 DC "C3'" C N S 132 DC "O3'" O N N 133 DC "C2'" C N N 134 DC "C1'" C N R 135 DC N1 N N N 136 DC C2 C N N 137 DC O2 O N N 138 DC N3 N N N 139 DC C4 C N N 140 DC N4 N N N 141 DC C5 C N N 142 DC C6 C N N 143 DC HOP3 H N N 144 DC HOP2 H N N 145 DC "H5'" H N N 146 DC "H5''" H N N 147 DC "H4'" H N N 148 DC "H3'" H N N 149 DC "HO3'" H N N 150 DC "H2'" H N N 151 DC "H2''" H N N 152 DC "H1'" H N N 153 DC H41 H N N 154 DC H42 H N N 155 DC H5 H N N 156 DC H6 H N N 157 DG OP3 O N N 158 DG P P N N 159 DG OP1 O N N 160 DG OP2 O N N 161 DG "O5'" O N N 162 DG "C5'" C N N 163 DG "C4'" C N R 164 DG "O4'" O N N 165 DG "C3'" C N S 166 DG "O3'" O N N 167 DG "C2'" C N N 168 DG "C1'" C N R 169 DG N9 N Y N 170 DG C8 C Y N 171 DG N7 N Y N 172 DG C5 C Y N 173 DG C6 C N N 174 DG O6 O N N 175 DG N1 N N N 176 DG C2 C N N 177 DG N2 N N N 178 DG N3 N N N 179 DG C4 C Y N 180 DG HOP3 H N N 181 DG HOP2 H N N 182 DG "H5'" H N N 183 DG "H5''" H N N 184 DG "H4'" H N N 185 DG "H3'" H N N 186 DG "HO3'" H N N 187 DG "H2'" H N N 188 DG "H2''" H N N 189 DG "H1'" H N N 190 DG H8 H N N 191 DG H1 H N N 192 DG H21 H N N 193 DG H22 H N N 194 DT OP3 O N N 195 DT P P N N 196 DT OP1 O N N 197 DT OP2 O N N 198 DT "O5'" O N N 199 DT "C5'" C N N 200 DT "C4'" C N R 201 DT "O4'" O N N 202 DT "C3'" C N S 203 DT "O3'" O N N 204 DT "C2'" C N N 205 DT "C1'" C N R 206 DT N1 N N N 207 DT C2 C N N 208 DT O2 O N N 209 DT N3 N N N 210 DT C4 C N N 211 DT O4 O N N 212 DT C5 C N N 213 DT C7 C N N 214 DT C6 C N N 215 DT HOP3 H N N 216 DT HOP2 H N N 217 DT "H5'" H N N 218 DT "H5''" H N N 219 DT "H4'" H N N 220 DT "H3'" H N N 221 DT "HO3'" H N N 222 DT "H2'" H N N 223 DT "H2''" H N N 224 DT "H1'" H N N 225 DT H3 H N N 226 DT H71 H N N 227 DT H72 H N N 228 DT H73 H N N 229 DT H6 H N N 230 GLN N N N N 231 GLN CA C N S 232 GLN C C N N 233 GLN O O N N 234 GLN CB C N N 235 GLN CG C N N 236 GLN CD C N N 237 GLN OE1 O N N 238 GLN NE2 N N N 239 GLN OXT O N N 240 GLN H H N N 241 GLN H2 H N N 242 GLN HA H N N 243 GLN HB2 H N N 244 GLN HB3 H N N 245 GLN HG2 H N N 246 GLN HG3 H N N 247 GLN HE21 H N N 248 GLN HE22 H N N 249 GLN HXT H N N 250 GLU N N N N 251 GLU CA C N S 252 GLU C C N N 253 GLU O O N N 254 GLU CB C N N 255 GLU CG C N N 256 GLU CD C N N 257 GLU OE1 O N N 258 GLU OE2 O N N 259 GLU OXT O N N 260 GLU H H N N 261 GLU H2 H N N 262 GLU HA H N N 263 GLU HB2 H N N 264 GLU HB3 H N N 265 GLU HG2 H N N 266 GLU HG3 H N N 267 GLU HE2 H N N 268 GLU HXT H N N 269 GLY N N N N 270 GLY CA C N N 271 GLY C C N N 272 GLY O O N N 273 GLY OXT O N N 274 GLY H H N N 275 GLY H2 H N N 276 GLY HA2 H N N 277 GLY HA3 H N N 278 GLY HXT H N N 279 HIS N N N N 280 HIS CA C N S 281 HIS C C N N 282 HIS O O N N 283 HIS CB C N N 284 HIS CG C Y N 285 HIS ND1 N Y N 286 HIS CD2 C Y N 287 HIS CE1 C Y N 288 HIS NE2 N Y N 289 HIS OXT O N N 290 HIS H H N N 291 HIS H2 H N N 292 HIS HA H N N 293 HIS HB2 H N N 294 HIS HB3 H N N 295 HIS HD1 H N N 296 HIS HD2 H N N 297 HIS HE1 H N N 298 HIS HE2 H N N 299 HIS HXT H N N 300 HOH O O N N 301 HOH H1 H N N 302 HOH H2 H N N 303 ILE N N N N 304 ILE CA C N S 305 ILE C C N N 306 ILE O O N N 307 ILE CB C N S 308 ILE CG1 C N N 309 ILE CG2 C N N 310 ILE CD1 C N N 311 ILE OXT O N N 312 ILE H H N N 313 ILE H2 H N N 314 ILE HA H N N 315 ILE HB H N N 316 ILE HG12 H N N 317 ILE HG13 H N N 318 ILE HG21 H N N 319 ILE HG22 H N N 320 ILE HG23 H N N 321 ILE HD11 H N N 322 ILE HD12 H N N 323 ILE HD13 H N N 324 ILE HXT H N N 325 LEU N N N N 326 LEU CA C N S 327 LEU C C N N 328 LEU O O N N 329 LEU CB C N N 330 LEU CG C N N 331 LEU CD1 C N N 332 LEU CD2 C N N 333 LEU OXT O N N 334 LEU H H N N 335 LEU H2 H N N 336 LEU HA H N N 337 LEU HB2 H N N 338 LEU HB3 H N N 339 LEU HG H N N 340 LEU HD11 H N N 341 LEU HD12 H N N 342 LEU HD13 H N N 343 LEU HD21 H N N 344 LEU HD22 H N N 345 LEU HD23 H N N 346 LEU HXT H N N 347 LYS N N N N 348 LYS CA C N S 349 LYS C C N N 350 LYS O O N N 351 LYS CB C N N 352 LYS CG C N N 353 LYS CD C N N 354 LYS CE C N N 355 LYS NZ N N N 356 LYS OXT O N N 357 LYS H H N N 358 LYS H2 H N N 359 LYS HA H N N 360 LYS HB2 H N N 361 LYS HB3 H N N 362 LYS HG2 H N N 363 LYS HG3 H N N 364 LYS HD2 H N N 365 LYS HD3 H N N 366 LYS HE2 H N N 367 LYS HE3 H N N 368 LYS HZ1 H N N 369 LYS HZ2 H N N 370 LYS HZ3 H N N 371 LYS HXT H N N 372 MET N N N N 373 MET CA C N S 374 MET C C N N 375 MET O O N N 376 MET CB C N N 377 MET CG C N N 378 MET SD S N N 379 MET CE C N N 380 MET OXT O N N 381 MET H H N N 382 MET H2 H N N 383 MET HA H N N 384 MET HB2 H N N 385 MET HB3 H N N 386 MET HG2 H N N 387 MET HG3 H N N 388 MET HE1 H N N 389 MET HE2 H N N 390 MET HE3 H N N 391 MET HXT H N N 392 PHE N N N N 393 PHE CA C N S 394 PHE C C N N 395 PHE O O N N 396 PHE CB C N N 397 PHE CG C Y N 398 PHE CD1 C Y N 399 PHE CD2 C Y N 400 PHE CE1 C Y N 401 PHE CE2 C Y N 402 PHE CZ C Y N 403 PHE OXT O N N 404 PHE H H N N 405 PHE H2 H N N 406 PHE HA H N N 407 PHE HB2 H N N 408 PHE HB3 H N N 409 PHE HD1 H N N 410 PHE HD2 H N N 411 PHE HE1 H N N 412 PHE HE2 H N N 413 PHE HZ H N N 414 PHE HXT H N N 415 PRO N N N N 416 PRO CA C N S 417 PRO C C N N 418 PRO O O N N 419 PRO CB C N N 420 PRO CG C N N 421 PRO CD C N N 422 PRO OXT O N N 423 PRO H H N N 424 PRO HA H N N 425 PRO HB2 H N N 426 PRO HB3 H N N 427 PRO HG2 H N N 428 PRO HG3 H N N 429 PRO HD2 H N N 430 PRO HD3 H N N 431 PRO HXT H N N 432 SER N N N N 433 SER CA C N S 434 SER C C N N 435 SER O O N N 436 SER CB C N N 437 SER OG O N N 438 SER OXT O N N 439 SER H H N N 440 SER H2 H N N 441 SER HA H N N 442 SER HB2 H N N 443 SER HB3 H N N 444 SER HG H N N 445 SER HXT H N N 446 THR N N N N 447 THR CA C N S 448 THR C C N N 449 THR O O N N 450 THR CB C N R 451 THR OG1 O N N 452 THR CG2 C N N 453 THR OXT O N N 454 THR H H N N 455 THR H2 H N N 456 THR HA H N N 457 THR HB H N N 458 THR HG1 H N N 459 THR HG21 H N N 460 THR HG22 H N N 461 THR HG23 H N N 462 THR HXT H N N 463 TRP N N N N 464 TRP CA C N S 465 TRP C C N N 466 TRP O O N N 467 TRP CB C N N 468 TRP CG C Y N 469 TRP CD1 C Y N 470 TRP CD2 C Y N 471 TRP NE1 N Y N 472 TRP CE2 C Y N 473 TRP CE3 C Y N 474 TRP CZ2 C Y N 475 TRP CZ3 C Y N 476 TRP CH2 C Y N 477 TRP OXT O N N 478 TRP H H N N 479 TRP H2 H N N 480 TRP HA H N N 481 TRP HB2 H N N 482 TRP HB3 H N N 483 TRP HD1 H N N 484 TRP HE1 H N N 485 TRP HE3 H N N 486 TRP HZ2 H N N 487 TRP HZ3 H N N 488 TRP HH2 H N N 489 TRP HXT H N N 490 TYR N N N N 491 TYR CA C N S 492 TYR C C N N 493 TYR O O N N 494 TYR CB C N N 495 TYR CG C Y N 496 TYR CD1 C Y N 497 TYR CD2 C Y N 498 TYR CE1 C Y N 499 TYR CE2 C Y N 500 TYR CZ C Y N 501 TYR OH O N N 502 TYR OXT O N N 503 TYR H H N N 504 TYR H2 H N N 505 TYR HA H N N 506 TYR HB2 H N N 507 TYR HB3 H N N 508 TYR HD1 H N N 509 TYR HD2 H N N 510 TYR HE1 H N N 511 TYR HE2 H N N 512 TYR HH H N N 513 TYR HXT H N N 514 VAL N N N N 515 VAL CA C N S 516 VAL C C N N 517 VAL O O N N 518 VAL CB C N N 519 VAL CG1 C N N 520 VAL CG2 C N N 521 VAL OXT O N N 522 VAL H H N N 523 VAL H2 H N N 524 VAL HA H N N 525 VAL HB H N N 526 VAL HG11 H N N 527 VAL HG12 H N N 528 VAL HG13 H N N 529 VAL HG21 H N N 530 VAL HG22 H N N 531 VAL HG23 H N N 532 VAL HXT H N N 533 ZN ZN ZN N N 534 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DA OP3 P sing N N 83 DA OP3 HOP3 sing N N 84 DA P OP1 doub N N 85 DA P OP2 sing N N 86 DA P "O5'" sing N N 87 DA OP2 HOP2 sing N N 88 DA "O5'" "C5'" sing N N 89 DA "C5'" "C4'" sing N N 90 DA "C5'" "H5'" sing N N 91 DA "C5'" "H5''" sing N N 92 DA "C4'" "O4'" sing N N 93 DA "C4'" "C3'" sing N N 94 DA "C4'" "H4'" sing N N 95 DA "O4'" "C1'" sing N N 96 DA "C3'" "O3'" sing N N 97 DA "C3'" "C2'" sing N N 98 DA "C3'" "H3'" sing N N 99 DA "O3'" "HO3'" sing N N 100 DA "C2'" "C1'" sing N N 101 DA "C2'" "H2'" sing N N 102 DA "C2'" "H2''" sing N N 103 DA "C1'" N9 sing N N 104 DA "C1'" "H1'" sing N N 105 DA N9 C8 sing Y N 106 DA N9 C4 sing Y N 107 DA C8 N7 doub Y N 108 DA C8 H8 sing N N 109 DA N7 C5 sing Y N 110 DA C5 C6 sing Y N 111 DA C5 C4 doub Y N 112 DA C6 N6 sing N N 113 DA C6 N1 doub Y N 114 DA N6 H61 sing N N 115 DA N6 H62 sing N N 116 DA N1 C2 sing Y N 117 DA C2 N3 doub Y N 118 DA C2 H2 sing N N 119 DA N3 C4 sing Y N 120 DC OP3 P sing N N 121 DC OP3 HOP3 sing N N 122 DC P OP1 doub N N 123 DC P OP2 sing N N 124 DC P "O5'" sing N N 125 DC OP2 HOP2 sing N N 126 DC "O5'" "C5'" sing N N 127 DC "C5'" "C4'" sing N N 128 DC "C5'" "H5'" sing N N 129 DC "C5'" "H5''" sing N N 130 DC "C4'" "O4'" sing N N 131 DC "C4'" "C3'" sing N N 132 DC "C4'" "H4'" sing N N 133 DC "O4'" "C1'" sing N N 134 DC "C3'" "O3'" sing N N 135 DC "C3'" "C2'" sing N N 136 DC "C3'" "H3'" sing N N 137 DC "O3'" "HO3'" sing N N 138 DC "C2'" "C1'" sing N N 139 DC "C2'" "H2'" sing N N 140 DC "C2'" "H2''" sing N N 141 DC "C1'" N1 sing N N 142 DC "C1'" "H1'" sing N N 143 DC N1 C2 sing N N 144 DC N1 C6 sing N N 145 DC C2 O2 doub N N 146 DC C2 N3 sing N N 147 DC N3 C4 doub N N 148 DC C4 N4 sing N N 149 DC C4 C5 sing N N 150 DC N4 H41 sing N N 151 DC N4 H42 sing N N 152 DC C5 C6 doub N N 153 DC C5 H5 sing N N 154 DC C6 H6 sing N N 155 DG OP3 P sing N N 156 DG OP3 HOP3 sing N N 157 DG P OP1 doub N N 158 DG P OP2 sing N N 159 DG P "O5'" sing N N 160 DG OP2 HOP2 sing N N 161 DG "O5'" "C5'" sing N N 162 DG "C5'" "C4'" sing N N 163 DG "C5'" "H5'" sing N N 164 DG "C5'" "H5''" sing N N 165 DG "C4'" "O4'" sing N N 166 DG "C4'" "C3'" sing N N 167 DG "C4'" "H4'" sing N N 168 DG "O4'" "C1'" sing N N 169 DG "C3'" "O3'" sing N N 170 DG "C3'" "C2'" sing N N 171 DG "C3'" "H3'" sing N N 172 DG "O3'" "HO3'" sing N N 173 DG "C2'" "C1'" sing N N 174 DG "C2'" "H2'" sing N N 175 DG "C2'" "H2''" sing N N 176 DG "C1'" N9 sing N N 177 DG "C1'" "H1'" sing N N 178 DG N9 C8 sing Y N 179 DG N9 C4 sing Y N 180 DG C8 N7 doub Y N 181 DG C8 H8 sing N N 182 DG N7 C5 sing Y N 183 DG C5 C6 sing N N 184 DG C5 C4 doub Y N 185 DG C6 O6 doub N N 186 DG C6 N1 sing N N 187 DG N1 C2 sing N N 188 DG N1 H1 sing N N 189 DG C2 N2 sing N N 190 DG C2 N3 doub N N 191 DG N2 H21 sing N N 192 DG N2 H22 sing N N 193 DG N3 C4 sing N N 194 DT OP3 P sing N N 195 DT OP3 HOP3 sing N N 196 DT P OP1 doub N N 197 DT P OP2 sing N N 198 DT P "O5'" sing N N 199 DT OP2 HOP2 sing N N 200 DT "O5'" "C5'" sing N N 201 DT "C5'" "C4'" sing N N 202 DT "C5'" "H5'" sing N N 203 DT "C5'" "H5''" sing N N 204 DT "C4'" "O4'" sing N N 205 DT "C4'" "C3'" sing N N 206 DT "C4'" "H4'" sing N N 207 DT "O4'" "C1'" sing N N 208 DT "C3'" "O3'" sing N N 209 DT "C3'" "C2'" sing N N 210 DT "C3'" "H3'" sing N N 211 DT "O3'" "HO3'" sing N N 212 DT "C2'" "C1'" sing N N 213 DT "C2'" "H2'" sing N N 214 DT "C2'" "H2''" sing N N 215 DT "C1'" N1 sing N N 216 DT "C1'" "H1'" sing N N 217 DT N1 C2 sing N N 218 DT N1 C6 sing N N 219 DT C2 O2 doub N N 220 DT C2 N3 sing N N 221 DT N3 C4 sing N N 222 DT N3 H3 sing N N 223 DT C4 O4 doub N N 224 DT C4 C5 sing N N 225 DT C5 C7 sing N N 226 DT C5 C6 doub N N 227 DT C7 H71 sing N N 228 DT C7 H72 sing N N 229 DT C7 H73 sing N N 230 DT C6 H6 sing N N 231 GLN N CA sing N N 232 GLN N H sing N N 233 GLN N H2 sing N N 234 GLN CA C sing N N 235 GLN CA CB sing N N 236 GLN CA HA sing N N 237 GLN C O doub N N 238 GLN C OXT sing N N 239 GLN CB CG sing N N 240 GLN CB HB2 sing N N 241 GLN CB HB3 sing N N 242 GLN CG CD sing N N 243 GLN CG HG2 sing N N 244 GLN CG HG3 sing N N 245 GLN CD OE1 doub N N 246 GLN CD NE2 sing N N 247 GLN NE2 HE21 sing N N 248 GLN NE2 HE22 sing N N 249 GLN OXT HXT sing N N 250 GLU N CA sing N N 251 GLU N H sing N N 252 GLU N H2 sing N N 253 GLU CA C sing N N 254 GLU CA CB sing N N 255 GLU CA HA sing N N 256 GLU C O doub N N 257 GLU C OXT sing N N 258 GLU CB CG sing N N 259 GLU CB HB2 sing N N 260 GLU CB HB3 sing N N 261 GLU CG CD sing N N 262 GLU CG HG2 sing N N 263 GLU CG HG3 sing N N 264 GLU CD OE1 doub N N 265 GLU CD OE2 sing N N 266 GLU OE2 HE2 sing N N 267 GLU OXT HXT sing N N 268 GLY N CA sing N N 269 GLY N H sing N N 270 GLY N H2 sing N N 271 GLY CA C sing N N 272 GLY CA HA2 sing N N 273 GLY CA HA3 sing N N 274 GLY C O doub N N 275 GLY C OXT sing N N 276 GLY OXT HXT sing N N 277 HIS N CA sing N N 278 HIS N H sing N N 279 HIS N H2 sing N N 280 HIS CA C sing N N 281 HIS CA CB sing N N 282 HIS CA HA sing N N 283 HIS C O doub N N 284 HIS C OXT sing N N 285 HIS CB CG sing N N 286 HIS CB HB2 sing N N 287 HIS CB HB3 sing N N 288 HIS CG ND1 sing Y N 289 HIS CG CD2 doub Y N 290 HIS ND1 CE1 doub Y N 291 HIS ND1 HD1 sing N N 292 HIS CD2 NE2 sing Y N 293 HIS CD2 HD2 sing N N 294 HIS CE1 NE2 sing Y N 295 HIS CE1 HE1 sing N N 296 HIS NE2 HE2 sing N N 297 HIS OXT HXT sing N N 298 HOH O H1 sing N N 299 HOH O H2 sing N N 300 ILE N CA sing N N 301 ILE N H sing N N 302 ILE N H2 sing N N 303 ILE CA C sing N N 304 ILE CA CB sing N N 305 ILE CA HA sing N N 306 ILE C O doub N N 307 ILE C OXT sing N N 308 ILE CB CG1 sing N N 309 ILE CB CG2 sing N N 310 ILE CB HB sing N N 311 ILE CG1 CD1 sing N N 312 ILE CG1 HG12 sing N N 313 ILE CG1 HG13 sing N N 314 ILE CG2 HG21 sing N N 315 ILE CG2 HG22 sing N N 316 ILE CG2 HG23 sing N N 317 ILE CD1 HD11 sing N N 318 ILE CD1 HD12 sing N N 319 ILE CD1 HD13 sing N N 320 ILE OXT HXT sing N N 321 LEU N CA sing N N 322 LEU N H sing N N 323 LEU N H2 sing N N 324 LEU CA C sing N N 325 LEU CA CB sing N N 326 LEU CA HA sing N N 327 LEU C O doub N N 328 LEU C OXT sing N N 329 LEU CB CG sing N N 330 LEU CB HB2 sing N N 331 LEU CB HB3 sing N N 332 LEU CG CD1 sing N N 333 LEU CG CD2 sing N N 334 LEU CG HG sing N N 335 LEU CD1 HD11 sing N N 336 LEU CD1 HD12 sing N N 337 LEU CD1 HD13 sing N N 338 LEU CD2 HD21 sing N N 339 LEU CD2 HD22 sing N N 340 LEU CD2 HD23 sing N N 341 LEU OXT HXT sing N N 342 LYS N CA sing N N 343 LYS N H sing N N 344 LYS N H2 sing N N 345 LYS CA C sing N N 346 LYS CA CB sing N N 347 LYS CA HA sing N N 348 LYS C O doub N N 349 LYS C OXT sing N N 350 LYS CB CG sing N N 351 LYS CB HB2 sing N N 352 LYS CB HB3 sing N N 353 LYS CG CD sing N N 354 LYS CG HG2 sing N N 355 LYS CG HG3 sing N N 356 LYS CD CE sing N N 357 LYS CD HD2 sing N N 358 LYS CD HD3 sing N N 359 LYS CE NZ sing N N 360 LYS CE HE2 sing N N 361 LYS CE HE3 sing N N 362 LYS NZ HZ1 sing N N 363 LYS NZ HZ2 sing N N 364 LYS NZ HZ3 sing N N 365 LYS OXT HXT sing N N 366 MET N CA sing N N 367 MET N H sing N N 368 MET N H2 sing N N 369 MET CA C sing N N 370 MET CA CB sing N N 371 MET CA HA sing N N 372 MET C O doub N N 373 MET C OXT sing N N 374 MET CB CG sing N N 375 MET CB HB2 sing N N 376 MET CB HB3 sing N N 377 MET CG SD sing N N 378 MET CG HG2 sing N N 379 MET CG HG3 sing N N 380 MET SD CE sing N N 381 MET CE HE1 sing N N 382 MET CE HE2 sing N N 383 MET CE HE3 sing N N 384 MET OXT HXT sing N N 385 PHE N CA sing N N 386 PHE N H sing N N 387 PHE N H2 sing N N 388 PHE CA C sing N N 389 PHE CA CB sing N N 390 PHE CA HA sing N N 391 PHE C O doub N N 392 PHE C OXT sing N N 393 PHE CB CG sing N N 394 PHE CB HB2 sing N N 395 PHE CB HB3 sing N N 396 PHE CG CD1 doub Y N 397 PHE CG CD2 sing Y N 398 PHE CD1 CE1 sing Y N 399 PHE CD1 HD1 sing N N 400 PHE CD2 CE2 doub Y N 401 PHE CD2 HD2 sing N N 402 PHE CE1 CZ doub Y N 403 PHE CE1 HE1 sing N N 404 PHE CE2 CZ sing Y N 405 PHE CE2 HE2 sing N N 406 PHE CZ HZ sing N N 407 PHE OXT HXT sing N N 408 PRO N CA sing N N 409 PRO N CD sing N N 410 PRO N H sing N N 411 PRO CA C sing N N 412 PRO CA CB sing N N 413 PRO CA HA sing N N 414 PRO C O doub N N 415 PRO C OXT sing N N 416 PRO CB CG sing N N 417 PRO CB HB2 sing N N 418 PRO CB HB3 sing N N 419 PRO CG CD sing N N 420 PRO CG HG2 sing N N 421 PRO CG HG3 sing N N 422 PRO CD HD2 sing N N 423 PRO CD HD3 sing N N 424 PRO OXT HXT sing N N 425 SER N CA sing N N 426 SER N H sing N N 427 SER N H2 sing N N 428 SER CA C sing N N 429 SER CA CB sing N N 430 SER CA HA sing N N 431 SER C O doub N N 432 SER C OXT sing N N 433 SER CB OG sing N N 434 SER CB HB2 sing N N 435 SER CB HB3 sing N N 436 SER OG HG sing N N 437 SER OXT HXT sing N N 438 THR N CA sing N N 439 THR N H sing N N 440 THR N H2 sing N N 441 THR CA C sing N N 442 THR CA CB sing N N 443 THR CA HA sing N N 444 THR C O doub N N 445 THR C OXT sing N N 446 THR CB OG1 sing N N 447 THR CB CG2 sing N N 448 THR CB HB sing N N 449 THR OG1 HG1 sing N N 450 THR CG2 HG21 sing N N 451 THR CG2 HG22 sing N N 452 THR CG2 HG23 sing N N 453 THR OXT HXT sing N N 454 TRP N CA sing N N 455 TRP N H sing N N 456 TRP N H2 sing N N 457 TRP CA C sing N N 458 TRP CA CB sing N N 459 TRP CA HA sing N N 460 TRP C O doub N N 461 TRP C OXT sing N N 462 TRP CB CG sing N N 463 TRP CB HB2 sing N N 464 TRP CB HB3 sing N N 465 TRP CG CD1 doub Y N 466 TRP CG CD2 sing Y N 467 TRP CD1 NE1 sing Y N 468 TRP CD1 HD1 sing N N 469 TRP CD2 CE2 doub Y N 470 TRP CD2 CE3 sing Y N 471 TRP NE1 CE2 sing Y N 472 TRP NE1 HE1 sing N N 473 TRP CE2 CZ2 sing Y N 474 TRP CE3 CZ3 doub Y N 475 TRP CE3 HE3 sing N N 476 TRP CZ2 CH2 doub Y N 477 TRP CZ2 HZ2 sing N N 478 TRP CZ3 CH2 sing Y N 479 TRP CZ3 HZ3 sing N N 480 TRP CH2 HH2 sing N N 481 TRP OXT HXT sing N N 482 TYR N CA sing N N 483 TYR N H sing N N 484 TYR N H2 sing N N 485 TYR CA C sing N N 486 TYR CA CB sing N N 487 TYR CA HA sing N N 488 TYR C O doub N N 489 TYR C OXT sing N N 490 TYR CB CG sing N N 491 TYR CB HB2 sing N N 492 TYR CB HB3 sing N N 493 TYR CG CD1 doub Y N 494 TYR CG CD2 sing Y N 495 TYR CD1 CE1 sing Y N 496 TYR CD1 HD1 sing N N 497 TYR CD2 CE2 doub Y N 498 TYR CD2 HD2 sing N N 499 TYR CE1 CZ doub Y N 500 TYR CE1 HE1 sing N N 501 TYR CE2 CZ sing Y N 502 TYR CE2 HE2 sing N N 503 TYR CZ OH sing N N 504 TYR OH HH sing N N 505 TYR OXT HXT sing N N 506 VAL N CA sing N N 507 VAL N H sing N N 508 VAL N H2 sing N N 509 VAL CA C sing N N 510 VAL CA CB sing N N 511 VAL CA HA sing N N 512 VAL C O doub N N 513 VAL C OXT sing N N 514 VAL CB CG1 sing N N 515 VAL CB CG2 sing N N 516 VAL CB HB sing N N 517 VAL CG1 HG11 sing N N 518 VAL CG1 HG12 sing N N 519 VAL CG1 HG13 sing N N 520 VAL CG2 HG21 sing N N 521 VAL CG2 HG22 sing N N 522 VAL CG2 HG23 sing N N 523 VAL OXT HXT sing N N 524 # _ndb_struct_conf_na.entry_id 7ABS _ndb_struct_conf_na.feature 'double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 B DC 9 1_555 C DG 5 1_555 0.459 -0.287 0.335 -3.254 10.274 -3.737 1 B_DC6:DG2_E B 6 ? E 2 ? 19 1 1 B DT 10 1_555 C DA 4 1_555 2.480 -0.550 1.457 -9.382 22.144 10.759 2 B_DT7:DA1_E B 7 ? E 1 ? ? ? 1 B DC 2 1_555 B DC 2 2_655 -1.115 1.732 0.000 -9.641 -23.037 -180.000 3 B_DC-1:DC-1_B B -1 ? B -1 ? 14 1 1 B DG 8 1_555 B DG 8 2_655 -0.437 5.847 0.000 4.866 23.881 180.000 4 B_DG5:DG5_B B 5 ? B 5 ? 4 12 # _ndb_struct_na_base_pair_step.model_number 1 _ndb_struct_na_base_pair_step.i_label_asym_id_1 B _ndb_struct_na_base_pair_step.i_label_comp_id_1 DC _ndb_struct_na_base_pair_step.i_label_seq_id_1 9 _ndb_struct_na_base_pair_step.i_symmetry_1 1_555 _ndb_struct_na_base_pair_step.j_label_asym_id_1 C _ndb_struct_na_base_pair_step.j_label_comp_id_1 DG _ndb_struct_na_base_pair_step.j_label_seq_id_1 5 _ndb_struct_na_base_pair_step.j_symmetry_1 1_555 _ndb_struct_na_base_pair_step.i_label_asym_id_2 B _ndb_struct_na_base_pair_step.i_label_comp_id_2 DT _ndb_struct_na_base_pair_step.i_label_seq_id_2 10 _ndb_struct_na_base_pair_step.i_symmetry_2 1_555 _ndb_struct_na_base_pair_step.j_label_asym_id_2 C _ndb_struct_na_base_pair_step.j_label_comp_id_2 DA _ndb_struct_na_base_pair_step.j_label_seq_id_2 4 _ndb_struct_na_base_pair_step.j_symmetry_2 1_555 _ndb_struct_na_base_pair_step.shift 0.592 _ndb_struct_na_base_pair_step.slide -0.731 _ndb_struct_na_base_pair_step.rise 3.716 _ndb_struct_na_base_pair_step.tilt -10.979 _ndb_struct_na_base_pair_step.roll 3.053 _ndb_struct_na_base_pair_step.twist 29.941 _ndb_struct_na_base_pair_step.x_displacement -1.932 _ndb_struct_na_base_pair_step.y_displacement -3.251 _ndb_struct_na_base_pair_step.helical_rise 3.217 _ndb_struct_na_base_pair_step.inclination 5.658 _ndb_struct_na_base_pair_step.tip 20.346 _ndb_struct_na_base_pair_step.helical_twist 31.990 _ndb_struct_na_base_pair_step.step_number 1 _ndb_struct_na_base_pair_step.step_name BB_DC6DT7:DA1DG2_EE _ndb_struct_na_base_pair_step.i_auth_asym_id_1 B _ndb_struct_na_base_pair_step.i_auth_seq_id_1 6 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 ? _ndb_struct_na_base_pair_step.j_auth_asym_id_1 E _ndb_struct_na_base_pair_step.j_auth_seq_id_1 2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 ? _ndb_struct_na_base_pair_step.i_auth_asym_id_2 B _ndb_struct_na_base_pair_step.i_auth_seq_id_2 7 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 ? _ndb_struct_na_base_pair_step.j_auth_asym_id_2 E _ndb_struct_na_base_pair_step.j_auth_seq_id_2 1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6WO0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7ABS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013757 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009008 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018129 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S ZN # loop_