data_7AIK # _entry.id 7AIK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AIK pdb_00007aik 10.2210/pdb7aik/pdb WWPDB D_1292111381 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-03 2 'Structure model' 1 1 2022-04-20 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' diffrn_source 4 2 'Structure model' refine 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 14 2 'Structure model' '_refine.pdbx_diffrn_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AIK _pdbx_database_status.recvd_initial_deposition_date 2020-09-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email stenmark@dbb.su.se _pdbx_contact_author.name_first Pal _pdbx_contact_author.name_last Stenmark _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4777-3417 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rehling, D.' 1 ? 'Scaletti, E.R.' 2 ? 'Stenmark, P.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 92 _citation.page_last 106 _citation.title 'Structural and Biochemical Investigation of Class I Ribonucleotide Reductase from the Hyperthermophile Aquifex aeolicus.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.1c00503 _citation.pdbx_database_id_PubMed 34941255 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rehling, D.' 1 ? primary 'Scaletti, E.R.' 2 ? primary 'Rozman Grinberg, I.' 3 ? primary 'Lundin, D.' 4 ? primary 'Sahlin, M.' 5 ? primary 'Hofer, A.' 6 ? primary 'Sjoberg, B.M.' 7 ? primary 'Stenmark, P.' 8 0000-0003-4777-3417 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribonucleoside-diphosphate reductase subunit beta,Ribonucleoside-diphosphate reductase subunit beta' 38619.000 1 1.17.4.1,1.17.4.1 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 2 ? ? ? ? 3 water nat water 18.015 111 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ribonucleotide reductase small subunit,Ribonucleotide reductase small subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NELVRKLIFNPQGDREASKRKIIKGNPTNIFELNEIKYSWAFDLYKLMGFTNFWIPEEIQMLEDRKQYETVLSDYEKRAY ELVLSFLIALDSFQVDMLKEFGRMITAPEVEMAITAQEFQESVHAYSYQFILESVVDPVKADEIYNYWREDERLLERNKV IAELYNEFIRKPNEENFIKATIGNYILESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELCHVTLFRNIINTLRKEN PELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQNQILGINDVLIERYIKYLGNLRITQIGFDPIYPEVTENPLKWIDEFRK I ; _entity_poly.pdbx_seq_one_letter_code_can ;NELVRKLIFNPQGDREASKRKIIKGNPTNIFELNEIKYSWAFDLYKLMGFTNFWIPEEIQMLEDRKQYETVLSDYEKRAY ELVLSFLIALDSFQVDMLKEFGRMITAPEVEMAITAQEFQESVHAYSYQFILESVVDPVKADEIYNYWREDERLLERNKV IAELYNEFIRKPNEENFIKATIGNYILESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELCHVTLFRNIINTLRKEN PELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQNQILGINDVLIERYIKYLGNLRITQIGFDPIYPEVTENPLKWIDEFRK I ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 GLU n 1 3 LEU n 1 4 VAL n 1 5 ARG n 1 6 LYS n 1 7 LEU n 1 8 ILE n 1 9 PHE n 1 10 ASN n 1 11 PRO n 1 12 GLN n 1 13 GLY n 1 14 ASP n 1 15 ARG n 1 16 GLU n 1 17 ALA n 1 18 SER n 1 19 LYS n 1 20 ARG n 1 21 LYS n 1 22 ILE n 1 23 ILE n 1 24 LYS n 1 25 GLY n 1 26 ASN n 1 27 PRO n 1 28 THR n 1 29 ASN n 1 30 ILE n 1 31 PHE n 1 32 GLU n 1 33 LEU n 1 34 ASN n 1 35 GLU n 1 36 ILE n 1 37 LYS n 1 38 TYR n 1 39 SER n 1 40 TRP n 1 41 ALA n 1 42 PHE n 1 43 ASP n 1 44 LEU n 1 45 TYR n 1 46 LYS n 1 47 LEU n 1 48 MET n 1 49 GLY n 1 50 PHE n 1 51 THR n 1 52 ASN n 1 53 PHE n 1 54 TRP n 1 55 ILE n 1 56 PRO n 1 57 GLU n 1 58 GLU n 1 59 ILE n 1 60 GLN n 1 61 MET n 1 62 LEU n 1 63 GLU n 1 64 ASP n 1 65 ARG n 1 66 LYS n 1 67 GLN n 1 68 TYR n 1 69 GLU n 1 70 THR n 1 71 VAL n 1 72 LEU n 1 73 SER n 1 74 ASP n 1 75 TYR n 1 76 GLU n 1 77 LYS n 1 78 ARG n 1 79 ALA n 1 80 TYR n 1 81 GLU n 1 82 LEU n 1 83 VAL n 1 84 LEU n 1 85 SER n 1 86 PHE n 1 87 LEU n 1 88 ILE n 1 89 ALA n 1 90 LEU n 1 91 ASP n 1 92 SER n 1 93 PHE n 1 94 GLN n 1 95 VAL n 1 96 ASP n 1 97 MET n 1 98 LEU n 1 99 LYS n 1 100 GLU n 1 101 PHE n 1 102 GLY n 1 103 ARG n 1 104 MET n 1 105 ILE n 1 106 THR n 1 107 ALA n 1 108 PRO n 1 109 GLU n 1 110 VAL n 1 111 GLU n 1 112 MET n 1 113 ALA n 1 114 ILE n 1 115 THR n 1 116 ALA n 1 117 GLN n 1 118 GLU n 1 119 PHE n 1 120 GLN n 1 121 GLU n 1 122 SER n 1 123 VAL n 1 124 HIS n 1 125 ALA n 1 126 TYR n 1 127 SER n 1 128 TYR n 1 129 GLN n 1 130 PHE n 1 131 ILE n 1 132 LEU n 1 133 GLU n 1 134 SER n 1 135 VAL n 1 136 VAL n 1 137 ASP n 1 138 PRO n 1 139 VAL n 1 140 LYS n 1 141 ALA n 1 142 ASP n 1 143 GLU n 1 144 ILE n 1 145 TYR n 1 146 ASN n 1 147 TYR n 1 148 TRP n 1 149 ARG n 1 150 GLU n 1 151 ASP n 1 152 GLU n 1 153 ARG n 1 154 LEU n 1 155 LEU n 1 156 GLU n 1 157 ARG n 1 158 ASN n 1 159 LYS n 1 160 VAL n 1 161 ILE n 1 162 ALA n 1 163 GLU n 1 164 LEU n 1 165 TYR n 1 166 ASN n 1 167 GLU n 1 168 PHE n 1 169 ILE n 1 170 ARG n 1 171 LYS n 1 172 PRO n 1 173 ASN n 1 174 GLU n 1 175 GLU n 1 176 ASN n 1 177 PHE n 1 178 ILE n 1 179 LYS n 1 180 ALA n 1 181 THR n 1 182 ILE n 1 183 GLY n 1 184 ASN n 1 185 TYR n 1 186 ILE n 1 187 LEU n 1 188 GLU n 1 189 SER n 1 190 LEU n 1 191 TYR n 1 192 PHE n 1 193 TYR n 1 194 SER n 1 195 GLY n 1 196 PHE n 1 197 ALA n 1 198 PHE n 1 199 PHE n 1 200 TYR n 1 201 THR n 1 202 LEU n 1 203 GLY n 1 204 ARG n 1 205 GLN n 1 206 GLY n 1 207 LYS n 1 208 MET n 1 209 ARG n 1 210 ASN n 1 211 THR n 1 212 VAL n 1 213 GLN n 1 214 GLN n 1 215 ILE n 1 216 LYS n 1 217 TYR n 1 218 ILE n 1 219 ASN n 1 220 ARG n 1 221 ASP n 1 222 GLU n 1 223 LEU n 1 224 CYS n 1 225 HIS n 1 226 VAL n 1 227 THR n 1 228 LEU n 1 229 PHE n 1 230 ARG n 1 231 ASN n 1 232 ILE n 1 233 ILE n 1 234 ASN n 1 235 THR n 1 236 LEU n 1 237 ARG n 1 238 LYS n 1 239 GLU n 1 240 ASN n 1 241 PRO n 1 242 GLU n 1 243 LEU n 1 244 PHE n 1 245 THR n 1 246 PRO n 1 247 GLU n 1 248 ILE n 1 249 GLU n 1 250 LYS n 1 251 TRP n 1 252 ILE n 1 253 VAL n 1 254 GLU n 1 255 TYR n 1 256 PHE n 1 257 LYS n 1 258 TYR n 1 259 ALA n 1 260 VAL n 1 261 ASN n 1 262 GLU n 1 263 GLU n 1 264 ILE n 1 265 LYS n 1 266 TRP n 1 267 GLY n 1 268 GLN n 1 269 TYR n 1 270 VAL n 1 271 THR n 1 272 GLN n 1 273 ASN n 1 274 GLN n 1 275 ILE n 1 276 LEU n 1 277 GLY n 1 278 ILE n 1 279 ASN n 1 280 ASP n 1 281 VAL n 1 282 LEU n 1 283 ILE n 1 284 GLU n 1 285 ARG n 1 286 TYR n 1 287 ILE n 1 288 LYS n 1 289 TYR n 1 290 LEU n 1 291 GLY n 1 292 ASN n 1 293 LEU n 1 294 ARG n 1 295 ILE n 1 296 THR n 1 297 GLN n 1 298 ILE n 1 299 GLY n 1 300 PHE n 1 301 ASP n 1 302 PRO n 1 303 ILE n 1 304 TYR n 1 305 PRO n 1 306 GLU n 1 307 VAL n 1 308 THR n 1 309 GLU n 1 310 ASN n 1 311 PRO n 1 312 LEU n 1 313 LYS n 1 314 TRP n 1 315 ILE n 1 316 ASP n 1 317 GLU n 1 318 PHE n 1 319 ARG n 1 320 LYS n 1 321 ILE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 224 ? ? 'nrdB, aq_1505' ? ? ? ? ? ? 'Aquifex aeolicus VF5' 224324 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 225 321 ? ? 'nrdB, aq_1505' ? ? ? ? ? ? 'Aquifex aeolicus VF5' 224324 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 7 7 ASN ASN A . n A 1 2 GLU 2 8 8 GLU GLU A . n A 1 3 LEU 3 9 9 LEU LEU A . n A 1 4 VAL 4 10 10 VAL VAL A . n A 1 5 ARG 5 11 11 ARG ARG A . n A 1 6 LYS 6 12 12 LYS LYS A . n A 1 7 LEU 7 13 13 LEU LEU A . n A 1 8 ILE 8 14 14 ILE ILE A . n A 1 9 PHE 9 15 15 PHE PHE A . n A 1 10 ASN 10 16 16 ASN ASN A . n A 1 11 PRO 11 17 17 PRO PRO A . n A 1 12 GLN 12 18 18 GLN GLN A . n A 1 13 GLY 13 19 19 GLY GLY A . n A 1 14 ASP 14 20 20 ASP ASP A . n A 1 15 ARG 15 21 21 ARG ARG A . n A 1 16 GLU 16 22 22 GLU GLU A . n A 1 17 ALA 17 23 23 ALA ALA A . n A 1 18 SER 18 24 24 SER SER A . n A 1 19 LYS 19 25 25 LYS LYS A . n A 1 20 ARG 20 26 26 ARG ARG A . n A 1 21 LYS 21 27 27 LYS LYS A . n A 1 22 ILE 22 28 28 ILE ILE A . n A 1 23 ILE 23 29 29 ILE ILE A . n A 1 24 LYS 24 30 30 LYS LYS A . n A 1 25 GLY 25 31 31 GLY GLY A . n A 1 26 ASN 26 32 32 ASN ASN A . n A 1 27 PRO 27 33 33 PRO PRO A . n A 1 28 THR 28 34 34 THR THR A . n A 1 29 ASN 29 35 35 ASN ASN A . n A 1 30 ILE 30 36 36 ILE ILE A . n A 1 31 PHE 31 37 37 PHE PHE A . n A 1 32 GLU 32 38 38 GLU GLU A . n A 1 33 LEU 33 39 39 LEU LEU A . n A 1 34 ASN 34 40 40 ASN ASN A . n A 1 35 GLU 35 41 41 GLU GLU A . n A 1 36 ILE 36 42 42 ILE ILE A . n A 1 37 LYS 37 43 43 LYS LYS A . n A 1 38 TYR 38 44 44 TYR TYR A . n A 1 39 SER 39 45 45 SER SER A . n A 1 40 TRP 40 46 46 TRP TRP A . n A 1 41 ALA 41 47 47 ALA ALA A . n A 1 42 PHE 42 48 48 PHE PHE A . n A 1 43 ASP 43 49 49 ASP ASP A . n A 1 44 LEU 44 50 50 LEU LEU A . n A 1 45 TYR 45 51 51 TYR TYR A . n A 1 46 LYS 46 52 52 LYS LYS A . n A 1 47 LEU 47 53 53 LEU LEU A . n A 1 48 MET 48 54 54 MET MET A . n A 1 49 GLY 49 55 55 GLY GLY A . n A 1 50 PHE 50 56 56 PHE PHE A . n A 1 51 THR 51 57 57 THR THR A . n A 1 52 ASN 52 58 58 ASN ASN A . n A 1 53 PHE 53 59 59 PHE PHE A . n A 1 54 TRP 54 60 60 TRP TRP A . n A 1 55 ILE 55 61 61 ILE ILE A . n A 1 56 PRO 56 62 62 PRO PRO A . n A 1 57 GLU 57 63 63 GLU GLU A . n A 1 58 GLU 58 64 64 GLU GLU A . n A 1 59 ILE 59 65 65 ILE ILE A . n A 1 60 GLN 60 66 66 GLN GLN A . n A 1 61 MET 61 67 67 MET MET A . n A 1 62 LEU 62 68 68 LEU LEU A . n A 1 63 GLU 63 69 69 GLU GLU A . n A 1 64 ASP 64 70 70 ASP ASP A . n A 1 65 ARG 65 71 71 ARG ARG A . n A 1 66 LYS 66 72 72 LYS LYS A . n A 1 67 GLN 67 73 73 GLN GLN A . n A 1 68 TYR 68 74 74 TYR TYR A . n A 1 69 GLU 69 75 75 GLU GLU A . n A 1 70 THR 70 76 76 THR THR A . n A 1 71 VAL 71 77 77 VAL VAL A . n A 1 72 LEU 72 78 78 LEU LEU A . n A 1 73 SER 73 79 79 SER SER A . n A 1 74 ASP 74 80 80 ASP ASP A . n A 1 75 TYR 75 81 81 TYR TYR A . n A 1 76 GLU 76 82 82 GLU GLU A . n A 1 77 LYS 77 83 83 LYS LYS A . n A 1 78 ARG 78 84 84 ARG ARG A . n A 1 79 ALA 79 85 85 ALA ALA A . n A 1 80 TYR 80 86 86 TYR TYR A . n A 1 81 GLU 81 87 87 GLU GLU A . n A 1 82 LEU 82 88 88 LEU LEU A . n A 1 83 VAL 83 89 89 VAL VAL A . n A 1 84 LEU 84 90 90 LEU LEU A . n A 1 85 SER 85 91 91 SER SER A . n A 1 86 PHE 86 92 92 PHE PHE A . n A 1 87 LEU 87 93 93 LEU LEU A . n A 1 88 ILE 88 94 94 ILE ILE A . n A 1 89 ALA 89 95 95 ALA ALA A . n A 1 90 LEU 90 96 96 LEU LEU A . n A 1 91 ASP 91 97 97 ASP ASP A . n A 1 92 SER 92 98 98 SER SER A . n A 1 93 PHE 93 99 99 PHE PHE A . n A 1 94 GLN 94 100 100 GLN GLN A . n A 1 95 VAL 95 101 101 VAL VAL A . n A 1 96 ASP 96 102 102 ASP ASP A . n A 1 97 MET 97 103 103 MET MET A . n A 1 98 LEU 98 104 104 LEU LEU A . n A 1 99 LYS 99 105 105 LYS LYS A . n A 1 100 GLU 100 106 106 GLU GLU A . n A 1 101 PHE 101 107 107 PHE PHE A . n A 1 102 GLY 102 108 108 GLY GLY A . n A 1 103 ARG 103 109 109 ARG ARG A . n A 1 104 MET 104 110 110 MET MET A . n A 1 105 ILE 105 111 111 ILE ILE A . n A 1 106 THR 106 112 112 THR THR A . n A 1 107 ALA 107 113 113 ALA ALA A . n A 1 108 PRO 108 114 114 PRO PRO A . n A 1 109 GLU 109 115 115 GLU GLU A . n A 1 110 VAL 110 116 116 VAL VAL A . n A 1 111 GLU 111 117 117 GLU GLU A . n A 1 112 MET 112 118 118 MET MET A . n A 1 113 ALA 113 119 119 ALA ALA A . n A 1 114 ILE 114 120 120 ILE ILE A . n A 1 115 THR 115 121 121 THR THR A . n A 1 116 ALA 116 122 122 ALA ALA A . n A 1 117 GLN 117 123 123 GLN GLN A . n A 1 118 GLU 118 124 124 GLU GLU A . n A 1 119 PHE 119 125 125 PHE PHE A . n A 1 120 GLN 120 126 126 GLN GLN A . n A 1 121 GLU 121 127 127 GLU GLU A . n A 1 122 SER 122 128 128 SER SER A . n A 1 123 VAL 123 129 129 VAL VAL A . n A 1 124 HIS 124 130 130 HIS HIS A . n A 1 125 ALA 125 131 131 ALA ALA A . n A 1 126 TYR 126 132 132 TYR TYR A . n A 1 127 SER 127 133 133 SER SER A . n A 1 128 TYR 128 134 134 TYR TYR A . n A 1 129 GLN 129 135 135 GLN GLN A . n A 1 130 PHE 130 136 136 PHE PHE A . n A 1 131 ILE 131 137 137 ILE ILE A . n A 1 132 LEU 132 138 138 LEU LEU A . n A 1 133 GLU 133 139 139 GLU GLU A . n A 1 134 SER 134 140 140 SER SER A . n A 1 135 VAL 135 141 141 VAL VAL A . n A 1 136 VAL 136 142 142 VAL VAL A . n A 1 137 ASP 137 143 143 ASP ASP A . n A 1 138 PRO 138 144 144 PRO PRO A . n A 1 139 VAL 139 145 145 VAL VAL A . n A 1 140 LYS 140 146 146 LYS LYS A . n A 1 141 ALA 141 147 147 ALA ALA A . n A 1 142 ASP 142 148 148 ASP ASP A . n A 1 143 GLU 143 149 149 GLU GLU A . n A 1 144 ILE 144 150 150 ILE ILE A . n A 1 145 TYR 145 151 151 TYR TYR A . n A 1 146 ASN 146 152 152 ASN ASN A . n A 1 147 TYR 147 153 153 TYR TYR A . n A 1 148 TRP 148 154 154 TRP TRP A . n A 1 149 ARG 149 155 155 ARG ARG A . n A 1 150 GLU 150 156 156 GLU GLU A . n A 1 151 ASP 151 157 157 ASP ASP A . n A 1 152 GLU 152 158 158 GLU GLU A . n A 1 153 ARG 153 159 159 ARG ARG A . n A 1 154 LEU 154 160 160 LEU LEU A . n A 1 155 LEU 155 161 161 LEU LEU A . n A 1 156 GLU 156 162 162 GLU GLU A . n A 1 157 ARG 157 163 163 ARG ARG A . n A 1 158 ASN 158 164 164 ASN ASN A . n A 1 159 LYS 159 165 165 LYS LYS A . n A 1 160 VAL 160 166 166 VAL VAL A . n A 1 161 ILE 161 167 167 ILE ILE A . n A 1 162 ALA 162 168 168 ALA ALA A . n A 1 163 GLU 163 169 169 GLU GLU A . n A 1 164 LEU 164 170 170 LEU LEU A . n A 1 165 TYR 165 171 171 TYR TYR A . n A 1 166 ASN 166 172 172 ASN ASN A . n A 1 167 GLU 167 173 173 GLU GLU A . n A 1 168 PHE 168 174 174 PHE PHE A . n A 1 169 ILE 169 175 175 ILE ILE A . n A 1 170 ARG 170 176 176 ARG ARG A . n A 1 171 LYS 171 177 177 LYS LYS A . n A 1 172 PRO 172 178 178 PRO PRO A . n A 1 173 ASN 173 179 179 ASN ASN A . n A 1 174 GLU 174 180 180 GLU GLU A . n A 1 175 GLU 175 181 181 GLU GLU A . n A 1 176 ASN 176 182 182 ASN ASN A . n A 1 177 PHE 177 183 183 PHE PHE A . n A 1 178 ILE 178 184 184 ILE ILE A . n A 1 179 LYS 179 185 185 LYS LYS A . n A 1 180 ALA 180 186 186 ALA ALA A . n A 1 181 THR 181 187 187 THR THR A . n A 1 182 ILE 182 188 188 ILE ILE A . n A 1 183 GLY 183 189 189 GLY GLY A . n A 1 184 ASN 184 190 190 ASN ASN A . n A 1 185 TYR 185 191 191 TYR TYR A . n A 1 186 ILE 186 192 192 ILE ILE A . n A 1 187 LEU 187 193 193 LEU LEU A . n A 1 188 GLU 188 194 194 GLU GLU A . n A 1 189 SER 189 195 195 SER SER A . n A 1 190 LEU 190 196 196 LEU LEU A . n A 1 191 TYR 191 197 197 TYR TYR A . n A 1 192 PHE 192 198 198 PHE PHE A . n A 1 193 TYR 193 199 199 TYR TYR A . n A 1 194 SER 194 200 200 SER SER A . n A 1 195 GLY 195 201 201 GLY GLY A . n A 1 196 PHE 196 202 202 PHE PHE A . n A 1 197 ALA 197 203 203 ALA ALA A . n A 1 198 PHE 198 204 204 PHE PHE A . n A 1 199 PHE 199 205 205 PHE PHE A . n A 1 200 TYR 200 206 206 TYR TYR A . n A 1 201 THR 201 207 207 THR THR A . n A 1 202 LEU 202 208 208 LEU LEU A . n A 1 203 GLY 203 209 209 GLY GLY A . n A 1 204 ARG 204 210 210 ARG ARG A . n A 1 205 GLN 205 211 211 GLN GLN A . n A 1 206 GLY 206 212 212 GLY GLY A . n A 1 207 LYS 207 213 213 LYS LYS A . n A 1 208 MET 208 214 214 MET MET A . n A 1 209 ARG 209 215 215 ARG ARG A . n A 1 210 ASN 210 216 216 ASN ASN A . n A 1 211 THR 211 217 217 THR THR A . n A 1 212 VAL 212 218 218 VAL VAL A . n A 1 213 GLN 213 219 219 GLN GLN A . n A 1 214 GLN 214 220 220 GLN GLN A . n A 1 215 ILE 215 221 221 ILE ILE A . n A 1 216 LYS 216 222 222 LYS LYS A . n A 1 217 TYR 217 223 223 TYR TYR A . n A 1 218 ILE 218 224 224 ILE ILE A . n A 1 219 ASN 219 225 225 ASN ASN A . n A 1 220 ARG 220 226 226 ARG ARG A . n A 1 221 ASP 221 227 227 ASP ASP A . n A 1 222 GLU 222 228 228 GLU GLU A . n A 1 223 LEU 223 229 229 LEU LEU A . n A 1 224 CYS 224 230 230 CYS CYS A . n A 1 225 HIS 225 231 231 HIS HIS A . n A 1 226 VAL 226 232 232 VAL VAL A . n A 1 227 THR 227 233 233 THR THR A . n A 1 228 LEU 228 234 234 LEU LEU A . n A 1 229 PHE 229 235 235 PHE PHE A . n A 1 230 ARG 230 236 236 ARG ARG A . n A 1 231 ASN 231 237 237 ASN ASN A . n A 1 232 ILE 232 238 238 ILE ILE A . n A 1 233 ILE 233 239 239 ILE ILE A . n A 1 234 ASN 234 240 240 ASN ASN A . n A 1 235 THR 235 241 241 THR THR A . n A 1 236 LEU 236 242 242 LEU LEU A . n A 1 237 ARG 237 243 243 ARG ARG A . n A 1 238 LYS 238 244 244 LYS LYS A . n A 1 239 GLU 239 245 245 GLU GLU A . n A 1 240 ASN 240 246 246 ASN ASN A . n A 1 241 PRO 241 247 247 PRO PRO A . n A 1 242 GLU 242 248 248 GLU GLU A . n A 1 243 LEU 243 249 249 LEU LEU A . n A 1 244 PHE 244 250 250 PHE PHE A . n A 1 245 THR 245 251 251 THR THR A . n A 1 246 PRO 246 252 252 PRO PRO A . n A 1 247 GLU 247 253 253 GLU GLU A . n A 1 248 ILE 248 254 254 ILE ILE A . n A 1 249 GLU 249 255 255 GLU GLU A . n A 1 250 LYS 250 256 256 LYS LYS A . n A 1 251 TRP 251 257 257 TRP TRP A . n A 1 252 ILE 252 258 258 ILE ILE A . n A 1 253 VAL 253 259 259 VAL VAL A . n A 1 254 GLU 254 260 260 GLU GLU A . n A 1 255 TYR 255 261 261 TYR TYR A . n A 1 256 PHE 256 262 262 PHE PHE A . n A 1 257 LYS 257 263 263 LYS LYS A . n A 1 258 TYR 258 264 264 TYR TYR A . n A 1 259 ALA 259 265 265 ALA ALA A . n A 1 260 VAL 260 266 266 VAL VAL A . n A 1 261 ASN 261 267 267 ASN ASN A . n A 1 262 GLU 262 268 268 GLU GLU A . n A 1 263 GLU 263 269 269 GLU GLU A . n A 1 264 ILE 264 270 270 ILE ILE A . n A 1 265 LYS 265 271 271 LYS LYS A . n A 1 266 TRP 266 272 272 TRP TRP A . n A 1 267 GLY 267 273 273 GLY GLY A . n A 1 268 GLN 268 274 274 GLN GLN A . n A 1 269 TYR 269 275 275 TYR TYR A . n A 1 270 VAL 270 276 276 VAL VAL A . n A 1 271 THR 271 277 277 THR THR A . n A 1 272 GLN 272 278 278 GLN GLN A . n A 1 273 ASN 273 279 279 ASN ASN A . n A 1 274 GLN 274 280 280 GLN GLN A . n A 1 275 ILE 275 281 281 ILE ILE A . n A 1 276 LEU 276 282 282 LEU LEU A . n A 1 277 GLY 277 283 283 GLY GLY A . n A 1 278 ILE 278 284 284 ILE ILE A . n A 1 279 ASN 279 285 285 ASN ASN A . n A 1 280 ASP 280 286 286 ASP ASP A . n A 1 281 VAL 281 287 287 VAL VAL A . n A 1 282 LEU 282 288 288 LEU LEU A . n A 1 283 ILE 283 289 289 ILE ILE A . n A 1 284 GLU 284 290 290 GLU GLU A . n A 1 285 ARG 285 291 291 ARG ARG A . n A 1 286 TYR 286 292 292 TYR TYR A . n A 1 287 ILE 287 293 293 ILE ILE A . n A 1 288 LYS 288 294 294 LYS LYS A . n A 1 289 TYR 289 295 295 TYR TYR A . n A 1 290 LEU 290 296 296 LEU LEU A . n A 1 291 GLY 291 297 297 GLY GLY A . n A 1 292 ASN 292 298 298 ASN ASN A . n A 1 293 LEU 293 299 299 LEU LEU A . n A 1 294 ARG 294 300 300 ARG ARG A . n A 1 295 ILE 295 301 301 ILE ILE A . n A 1 296 THR 296 302 302 THR THR A . n A 1 297 GLN 297 303 303 GLN GLN A . n A 1 298 ILE 298 304 304 ILE ILE A . n A 1 299 GLY 299 305 305 GLY GLY A . n A 1 300 PHE 300 306 306 PHE PHE A . n A 1 301 ASP 301 307 307 ASP ASP A . n A 1 302 PRO 302 308 308 PRO PRO A . n A 1 303 ILE 303 309 309 ILE ILE A . n A 1 304 TYR 304 310 310 TYR TYR A . n A 1 305 PRO 305 311 311 PRO PRO A . n A 1 306 GLU 306 312 312 GLU GLU A . n A 1 307 VAL 307 313 313 VAL VAL A . n A 1 308 THR 308 314 314 THR THR A . n A 1 309 GLU 309 315 315 GLU GLU A . n A 1 310 ASN 310 316 316 ASN ASN A . n A 1 311 PRO 311 317 317 PRO PRO A . n A 1 312 LEU 312 318 318 LEU LEU A . n A 1 313 LYS 313 319 319 LYS LYS A . n A 1 314 TRP 314 320 320 TRP TRP A . n A 1 315 ILE 315 321 321 ILE ILE A . n A 1 316 ASP 316 322 322 ASP ASP A . n A 1 317 GLU 317 323 323 GLU GLU A . n A 1 318 PHE 318 324 324 PHE PHE A . n A 1 319 ARG 319 325 325 ARG ARG A . n A 1 320 LYS 320 326 326 LYS LYS A . n A 1 321 ILE 321 327 327 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 401 401 FE2 FE2 A . C 2 FE2 1 402 501 FE2 FE2 A . D 3 HOH 1 501 63 HOH HOH A . D 3 HOH 2 502 84 HOH HOH A . D 3 HOH 3 503 82 HOH HOH A . D 3 HOH 4 504 83 HOH HOH A . D 3 HOH 5 505 31 HOH HOH A . D 3 HOH 6 506 90 HOH HOH A . D 3 HOH 7 507 49 HOH HOH A . D 3 HOH 8 508 57 HOH HOH A . D 3 HOH 9 509 7 HOH HOH A . D 3 HOH 10 510 56 HOH HOH A . D 3 HOH 11 511 79 HOH HOH A . D 3 HOH 12 512 6 HOH HOH A . D 3 HOH 13 513 88 HOH HOH A . D 3 HOH 14 514 39 HOH HOH A . D 3 HOH 15 515 101 HOH HOH A . D 3 HOH 16 516 74 HOH HOH A . D 3 HOH 17 517 108 HOH HOH A . D 3 HOH 18 518 12 HOH HOH A . D 3 HOH 19 519 14 HOH HOH A . D 3 HOH 20 520 27 HOH HOH A . D 3 HOH 21 521 17 HOH HOH A . D 3 HOH 22 522 53 HOH HOH A . D 3 HOH 23 523 8 HOH HOH A . D 3 HOH 24 524 1 HOH HOH A . D 3 HOH 25 525 106 HOH HOH A . D 3 HOH 26 526 15 HOH HOH A . D 3 HOH 27 527 3 HOH HOH A . D 3 HOH 28 528 34 HOH HOH A . D 3 HOH 29 529 51 HOH HOH A . D 3 HOH 30 530 5 HOH HOH A . D 3 HOH 31 531 40 HOH HOH A . D 3 HOH 32 532 92 HOH HOH A . D 3 HOH 33 533 47 HOH HOH A . D 3 HOH 34 534 36 HOH HOH A . D 3 HOH 35 535 9 HOH HOH A . D 3 HOH 36 536 11 HOH HOH A . D 3 HOH 37 537 97 HOH HOH A . D 3 HOH 38 538 70 HOH HOH A . D 3 HOH 39 539 20 HOH HOH A . D 3 HOH 40 540 103 HOH HOH A . D 3 HOH 41 541 26 HOH HOH A . D 3 HOH 42 542 50 HOH HOH A . D 3 HOH 43 543 38 HOH HOH A . D 3 HOH 44 544 58 HOH HOH A . D 3 HOH 45 545 60 HOH HOH A . D 3 HOH 46 546 35 HOH HOH A . D 3 HOH 47 547 19 HOH HOH A . D 3 HOH 48 548 4 HOH HOH A . D 3 HOH 49 549 2 HOH HOH A . D 3 HOH 50 550 33 HOH HOH A . D 3 HOH 51 551 95 HOH HOH A . D 3 HOH 52 552 22 HOH HOH A . D 3 HOH 53 553 109 HOH HOH A . D 3 HOH 54 554 105 HOH HOH A . D 3 HOH 55 555 23 HOH HOH A . D 3 HOH 56 556 75 HOH HOH A . D 3 HOH 57 557 77 HOH HOH A . D 3 HOH 58 558 87 HOH HOH A . D 3 HOH 59 559 55 HOH HOH A . D 3 HOH 60 560 54 HOH HOH A . D 3 HOH 61 561 37 HOH HOH A . D 3 HOH 62 562 28 HOH HOH A . D 3 HOH 63 563 93 HOH HOH A . D 3 HOH 64 564 43 HOH HOH A . D 3 HOH 65 565 85 HOH HOH A . D 3 HOH 66 566 48 HOH HOH A . D 3 HOH 67 567 25 HOH HOH A . D 3 HOH 68 568 110 HOH HOH A . D 3 HOH 69 569 21 HOH HOH A . D 3 HOH 70 570 78 HOH HOH A . D 3 HOH 71 571 41 HOH HOH A . D 3 HOH 72 572 86 HOH HOH A . D 3 HOH 73 573 13 HOH HOH A . D 3 HOH 74 574 94 HOH HOH A . D 3 HOH 75 575 98 HOH HOH A . D 3 HOH 76 576 42 HOH HOH A . D 3 HOH 77 577 29 HOH HOH A . D 3 HOH 78 578 46 HOH HOH A . D 3 HOH 79 579 18 HOH HOH A . D 3 HOH 80 580 80 HOH HOH A . D 3 HOH 81 581 10 HOH HOH A . D 3 HOH 82 582 67 HOH HOH A . D 3 HOH 83 583 112 HOH HOH A . D 3 HOH 84 584 73 HOH HOH A . D 3 HOH 85 585 102 HOH HOH A . D 3 HOH 86 586 59 HOH HOH A . D 3 HOH 87 587 104 HOH HOH A . D 3 HOH 88 588 32 HOH HOH A . D 3 HOH 89 589 69 HOH HOH A . D 3 HOH 90 590 24 HOH HOH A . D 3 HOH 91 591 89 HOH HOH A . D 3 HOH 92 592 62 HOH HOH A . D 3 HOH 93 593 81 HOH HOH A . D 3 HOH 94 594 45 HOH HOH A . D 3 HOH 95 595 61 HOH HOH A . D 3 HOH 96 596 111 HOH HOH A . D 3 HOH 97 597 44 HOH HOH A . D 3 HOH 98 598 52 HOH HOH A . D 3 HOH 99 599 68 HOH HOH A . D 3 HOH 100 600 96 HOH HOH A . D 3 HOH 101 601 66 HOH HOH A . D 3 HOH 102 602 99 HOH HOH A . D 3 HOH 103 603 71 HOH HOH A . D 3 HOH 104 604 64 HOH HOH A . D 3 HOH 105 605 91 HOH HOH A . D 3 HOH 106 606 65 HOH HOH A . D 3 HOH 107 607 72 HOH HOH A . D 3 HOH 108 608 30 HOH HOH A . D 3 HOH 109 609 76 HOH HOH A . D 3 HOH 110 610 107 HOH HOH A . D 3 HOH 111 611 16 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7AIK _cell.details ? _cell.formula_units_Z ? _cell.length_a 69.420 _cell.length_a_esd ? _cell.length_b 69.420 _cell.length_b_esd ? _cell.length_c 177.973 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AIK _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AIK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M citrate pH 4.0, 1.0 M lithium chloride, 20 % PEG6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-04-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7AIK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 65 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26676 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.14 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1295 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.94 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.55 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 1.55 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -3.11 _refine.B_iso_max ? _refine.B_iso_mean 61.630 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.945 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AIK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 47.37 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24986 _refine.ls_number_reflns_R_free 1309 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21948 _refine.ls_R_factor_R_free 0.26650 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21680 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5ci4 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.213 _refine.pdbx_overall_ESU_R_Free 0.193 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.438 _refine.overall_SU_ML 0.205 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 47.37 _refine_hist.number_atoms_solvent 111 _refine_hist.number_atoms_total 2844 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2731 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 2824 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2672 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.537 1.648 3824 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.273 1.577 6141 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.901 5.000 326 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.015 22.989 174 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.220 15.000 515 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.147 15.000 18 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.078 0.200 359 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 3194 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 706 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.544 6.210 1298 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.545 6.208 1297 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.590 9.295 1626 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.588 9.297 1627 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.740 6.660 1525 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.738 6.661 1526 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.251 9.799 2199 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 10.319 72.432 3435 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 10.310 72.370 3418 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 81 _refine_ls_shell.number_reflns_R_work 1817 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.420 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.368 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7AIK _struct.title 'Ribonucleotide Reductase R2 protein from Aquifex aeolicus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AIK _struct_keywords.text 'allosteric regulation, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP RIR2_AQUAE O67475 ? 1 ;NELVRKLIFNPQGDREASKRKIIKGNPTNIFELNEIKYSWAFDLYKLMGFTNFWIPEEIQMLEDRKQYETVLSDYEKRAY ELVLSFLIALDSFQVDMLKEFGRMITAPEVEMAITAQEFQESVHAYSYQFILESVVDPVKADEIYNYWREDERLLERNKV IAELYNEFIRKPNEENFIKATIGNYILESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELC ; 7 2 UNP RIR2_AQUAE O67475 ? 1 ;HVTLFRNIINTLRKENPELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQNQILGINDVLIERYIKYLGNLRITQIGFDPIY PEVTENPLKWIDEFRKI ; 577 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7AIK A 1 ? 224 ? O67475 7 ? 230 ? 7 230 2 2 7AIK A 225 ? 321 ? O67475 577 ? 673 ? 231 327 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6050 ? 1 MORE -65 ? 1 'SSA (A^2)' 23410 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 88.8990000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 16 ? ARG A 20 ? GLU A 22 ARG A 26 5 ? 5 HELX_P HELX_P2 AA2 TYR A 38 ? PHE A 50 ? TYR A 44 PHE A 56 1 ? 13 HELX_P HELX_P3 AA3 ILE A 55 ? ILE A 59 ? ILE A 61 ILE A 65 5 ? 5 HELX_P HELX_P4 AA4 GLU A 63 ? VAL A 71 ? GLU A 69 VAL A 77 1 ? 9 HELX_P HELX_P5 AA5 SER A 73 ? ILE A 105 ? SER A 79 ILE A 111 1 ? 33 HELX_P HELX_P6 AA6 ALA A 107 ? VAL A 136 ? ALA A 113 VAL A 142 1 ? 30 HELX_P HELX_P7 AA7 ASP A 137 ? ASN A 146 ? ASP A 143 ASN A 152 1 ? 10 HELX_P HELX_P8 AA8 TYR A 147 ? GLU A 150 ? TYR A 153 GLU A 156 5 ? 4 HELX_P HELX_P9 AA9 ASP A 151 ? LYS A 171 ? ASP A 157 LYS A 177 1 ? 21 HELX_P HELX_P10 AB1 ASN A 173 ? TYR A 191 ? ASN A 179 TYR A 197 1 ? 19 HELX_P HELX_P11 AB2 PHE A 192 ? GLN A 205 ? PHE A 198 GLN A 211 1 ? 14 HELX_P HELX_P12 AB3 MET A 208 ? ASN A 240 ? MET A 214 ASN A 246 1 ? 33 HELX_P HELX_P13 AB4 PRO A 241 ? PHE A 244 ? PRO A 247 PHE A 250 5 ? 4 HELX_P HELX_P14 AB5 THR A 245 ? GLN A 272 ? THR A 251 GLN A 278 1 ? 28 HELX_P HELX_P15 AB6 ASN A 279 ? ILE A 298 ? ASN A 285 ILE A 304 1 ? 20 HELX_P HELX_P16 AB7 TRP A 314 ? ARG A 319 ? TRP A 320 ARG A 325 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 C FE2 . FE ? ? A ASP 97 A FE2 402 1_555 ? ? ? ? ? ? ? 1.997 ? ? metalc2 metalc ? ? A ASP 91 OD2 ? ? ? 1_555 C FE2 . FE ? ? A ASP 97 A FE2 402 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc3 metalc ? ? A GLU 121 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 127 A FE2 401 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc4 metalc ? ? A HIS 124 ND1 ? ? ? 1_555 C FE2 . FE ? ? A HIS 130 A FE2 402 1_555 ? ? ? ? ? ? ? 1.946 ? ? metalc5 metalc ? ? A GLU 188 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 194 A FE2 401 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc6 metalc ? ? A GLU 222 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 228 A FE2 401 1_555 ? ? ? ? ? ? ? 2.164 ? ? metalc7 metalc ? ? A GLU 222 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 228 A FE2 401 1_555 ? ? ? ? ? ? ? 2.369 ? ? metalc8 metalc ? ? A GLU 222 OE2 ? ? ? 1_555 C FE2 . FE ? ? A GLU 228 A FE2 402 1_555 ? ? ? ? ? ? ? 2.759 ? ? metalc9 metalc ? ? A HIS 225 ND1 ? ? ? 1_555 B FE2 . FE ? ? A HIS 231 A FE2 401 1_555 ? ? ? ? ? ? ? 2.423 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 91 ? A ASP 97 ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OD2 ? A ASP 91 ? A ASP 97 ? 1_555 65.9 ? 2 OD1 ? A ASP 91 ? A ASP 97 ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 ND1 ? A HIS 124 ? A HIS 130 ? 1_555 141.3 ? 3 OD2 ? A ASP 91 ? A ASP 97 ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 ND1 ? A HIS 124 ? A HIS 130 ? 1_555 119.7 ? 4 OD1 ? A ASP 91 ? A ASP 97 ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 105.6 ? 5 OD2 ? A ASP 91 ? A ASP 97 ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 146.4 ? 6 ND1 ? A HIS 124 ? A HIS 130 ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 87.9 ? 7 OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 188 ? A GLU 194 ? 1_555 80.7 ? 8 OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 169.3 ? 9 OE2 ? A GLU 188 ? A GLU 194 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 102.7 ? 10 OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 116.5 ? 11 OE2 ? A GLU 188 ? A GLU 194 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 162.0 ? 12 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 59.4 ? 13 OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 76.7 ? 14 OE2 ? A GLU 188 ? A GLU 194 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 86.7 ? 15 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 93.2 ? 16 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 92.0 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 529 ? ? O A HOH 598 ? ? 2.08 2 1 OD2 A ASP 20 ? ? O A HOH 501 ? ? 2.10 3 1 OD1 A ASN 216 ? ? O A HOH 502 ? ? 2.11 4 1 OE1 A GLU 106 ? ? O A HOH 503 ? ? 2.16 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 570 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 599 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_455 _pdbx_validate_symm_contact.dist 1.94 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 194 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 194 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.356 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.104 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 9 ? ? -55.32 103.86 2 1 MET A 67 ? ? -118.99 53.95 3 1 THR A 76 ? ? -138.54 -38.71 4 1 PRO A 178 ? ? -77.41 49.62 5 1 LEU A 196 ? ? -122.93 -51.92 6 1 PHE A 250 ? ? -90.07 51.42 7 1 THR A 251 ? ? -41.30 159.81 8 1 ASN A 279 ? ? 54.64 12.51 9 1 THR A 314 ? ? -143.30 -32.27 10 1 LYS A 326 ? ? -48.10 150.10 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PHE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 198 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 TYR _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 199 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -147.47 # _pdbx_entry_details.entry_id 7AIK _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Swedish Research Council' _pdbx_audit_support.country Sweden _pdbx_audit_support.grant_number 2018-03406 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5CI4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7AIK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014405 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014405 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005619 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_