data_7AMX # _entry.id 7AMX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AMX pdb_00007amx 10.2210/pdb7amx/pdb WWPDB D_1292111664 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-20 2 'Structure model' 1 1 2021-11-17 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' atom_type 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_atom_type.pdbx_N_electrons' 12 3 'Structure model' '_atom_type.pdbx_scat_Z' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AMX _pdbx_database_status.recvd_initial_deposition_date 2020-10-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 7AHW unspecified PDB . 7ALY unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fiorillo, A.' 1 0000-0002-8966-8554 'Ilari, A.' 2 0000-0002-7754-399X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 77 _citation.language ? _citation.page_first 1401 _citation.page_last 1410 _citation.title 'Structure and metal-binding properties of PA4063, a novel player in periplasmic zinc trafficking by Pseudomonas aeruginosa.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798321009608 _citation.pdbx_database_id_PubMed 34726168 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fiorillo, A.' 1 ? primary 'Battistoni, A.' 2 ? primary 'Ammendola, S.' 3 0000-0003-1436-0608 primary 'Secli, V.' 4 ? primary 'Rinaldo, S.' 5 ? primary 'Cutruzzola, F.' 6 ? primary 'Demitri, N.' 7 0000-0003-0288-3233 primary 'Ilari, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DUF2796 domain-containing protein' 19451.762 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HDDHDHDHAHGSLGKHEHGVAQLNVALDGKTLELELDSPAMNLVGFEHAASTDADKAAVAKARAQLEKPLELFALPVTAG CSVASQELRSPLFGDKAPAHAHKEKAGHEHEHEHEHEHGHADIHAHYQLSCEKPELLKLLTLAEFFKRFPATQKIQVQLI GPDGQKGADLAPASAELKL ; _entity_poly.pdbx_seq_one_letter_code_can ;HDDHDHDHAHGSLGKHEHGVAQLNVALDGKTLELELDSPAMNLVGFEHAASTDADKAAVAKARAQLEKPLELFALPVTAG CSVASQELRSPLFGDKAPAHAHKEKAGHEHEHEHEHEHGHADIHAHYQLSCEKPELLKLLTLAEFFKRFPATQKIQVQLI GPDGQKGADLAPASAELKL ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 ASP n 1 3 ASP n 1 4 HIS n 1 5 ASP n 1 6 HIS n 1 7 ASP n 1 8 HIS n 1 9 ALA n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 LEU n 1 14 GLY n 1 15 LYS n 1 16 HIS n 1 17 GLU n 1 18 HIS n 1 19 GLY n 1 20 VAL n 1 21 ALA n 1 22 GLN n 1 23 LEU n 1 24 ASN n 1 25 VAL n 1 26 ALA n 1 27 LEU n 1 28 ASP n 1 29 GLY n 1 30 LYS n 1 31 THR n 1 32 LEU n 1 33 GLU n 1 34 LEU n 1 35 GLU n 1 36 LEU n 1 37 ASP n 1 38 SER n 1 39 PRO n 1 40 ALA n 1 41 MET n 1 42 ASN n 1 43 LEU n 1 44 VAL n 1 45 GLY n 1 46 PHE n 1 47 GLU n 1 48 HIS n 1 49 ALA n 1 50 ALA n 1 51 SER n 1 52 THR n 1 53 ASP n 1 54 ALA n 1 55 ASP n 1 56 LYS n 1 57 ALA n 1 58 ALA n 1 59 VAL n 1 60 ALA n 1 61 LYS n 1 62 ALA n 1 63 ARG n 1 64 ALA n 1 65 GLN n 1 66 LEU n 1 67 GLU n 1 68 LYS n 1 69 PRO n 1 70 LEU n 1 71 GLU n 1 72 LEU n 1 73 PHE n 1 74 ALA n 1 75 LEU n 1 76 PRO n 1 77 VAL n 1 78 THR n 1 79 ALA n 1 80 GLY n 1 81 CYS n 1 82 SER n 1 83 VAL n 1 84 ALA n 1 85 SER n 1 86 GLN n 1 87 GLU n 1 88 LEU n 1 89 ARG n 1 90 SER n 1 91 PRO n 1 92 LEU n 1 93 PHE n 1 94 GLY n 1 95 ASP n 1 96 LYS n 1 97 ALA n 1 98 PRO n 1 99 ALA n 1 100 HIS n 1 101 ALA n 1 102 HIS n 1 103 LYS n 1 104 GLU n 1 105 LYS n 1 106 ALA n 1 107 GLY n 1 108 HIS n 1 109 GLU n 1 110 HIS n 1 111 GLU n 1 112 HIS n 1 113 GLU n 1 114 HIS n 1 115 GLU n 1 116 HIS n 1 117 GLU n 1 118 HIS n 1 119 GLY n 1 120 HIS n 1 121 ALA n 1 122 ASP n 1 123 ILE n 1 124 HIS n 1 125 ALA n 1 126 HIS n 1 127 TYR n 1 128 GLN n 1 129 LEU n 1 130 SER n 1 131 CYS n 1 132 GLU n 1 133 LYS n 1 134 PRO n 1 135 GLU n 1 136 LEU n 1 137 LEU n 1 138 LYS n 1 139 LEU n 1 140 LEU n 1 141 THR n 1 142 LEU n 1 143 ALA n 1 144 GLU n 1 145 PHE n 1 146 PHE n 1 147 LYS n 1 148 ARG n 1 149 PHE n 1 150 PRO n 1 151 ALA n 1 152 THR n 1 153 GLN n 1 154 LYS n 1 155 ILE n 1 156 GLN n 1 157 VAL n 1 158 GLN n 1 159 LEU n 1 160 ILE n 1 161 GLY n 1 162 PRO n 1 163 ASP n 1 164 GLY n 1 165 GLN n 1 166 LYS n 1 167 GLY n 1 168 ALA n 1 169 ASP n 1 170 LEU n 1 171 ALA n 1 172 PRO n 1 173 ALA n 1 174 SER n 1 175 ALA n 1 176 GLU n 1 177 LEU n 1 178 LYS n 1 179 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 179 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene F3H14_19710 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 ? ? ? AAA . n A 1 2 ASP 2 2 ? ? ? AAA . n A 1 3 ASP 3 3 ? ? ? AAA . n A 1 4 HIS 4 4 ? ? ? AAA . n A 1 5 ASP 5 5 ? ? ? AAA . n A 1 6 HIS 6 6 ? ? ? AAA . n A 1 7 ASP 7 7 ? ? ? AAA . n A 1 8 HIS 8 8 ? ? ? AAA . n A 1 9 ALA 9 9 ? ? ? AAA . n A 1 10 HIS 10 10 ? ? ? AAA . n A 1 11 GLY 11 11 ? ? ? AAA . n A 1 12 SER 12 12 ? ? ? AAA . n A 1 13 LEU 13 13 ? ? ? AAA . n A 1 14 GLY 14 14 ? ? ? AAA . n A 1 15 LYS 15 15 15 LYS LYS AAA . n A 1 16 HIS 16 16 16 HIS HIS AAA . n A 1 17 GLU 17 17 17 GLU GLU AAA . n A 1 18 HIS 18 18 18 HIS HIS AAA . n A 1 19 GLY 19 19 19 GLY GLY AAA . n A 1 20 VAL 20 20 20 VAL VAL AAA . n A 1 21 ALA 21 21 21 ALA ALA AAA . n A 1 22 GLN 22 22 22 GLN GLN AAA . n A 1 23 LEU 23 23 23 LEU LEU AAA . n A 1 24 ASN 24 24 24 ASN ASN AAA . n A 1 25 VAL 25 25 25 VAL VAL AAA . n A 1 26 ALA 26 26 26 ALA ALA AAA . n A 1 27 LEU 27 27 27 LEU LEU AAA . n A 1 28 ASP 28 28 28 ASP ASP AAA . n A 1 29 GLY 29 29 29 GLY GLY AAA . n A 1 30 LYS 30 30 30 LYS LYS AAA . n A 1 31 THR 31 31 31 THR THR AAA . n A 1 32 LEU 32 32 32 LEU LEU AAA . n A 1 33 GLU 33 33 33 GLU GLU AAA . n A 1 34 LEU 34 34 34 LEU LEU AAA . n A 1 35 GLU 35 35 35 GLU GLU AAA . n A 1 36 LEU 36 36 36 LEU LEU AAA . n A 1 37 ASP 37 37 37 ASP ASP AAA . n A 1 38 SER 38 38 38 SER SER AAA . n A 1 39 PRO 39 39 39 PRO PRO AAA . n A 1 40 ALA 40 40 40 ALA ALA AAA . n A 1 41 MET 41 41 41 MET MET AAA . n A 1 42 ASN 42 42 42 ASN ASN AAA . n A 1 43 LEU 43 43 43 LEU LEU AAA . n A 1 44 VAL 44 44 44 VAL VAL AAA . n A 1 45 GLY 45 45 45 GLY GLY AAA . n A 1 46 PHE 46 46 46 PHE PHE AAA . n A 1 47 GLU 47 47 47 GLU GLU AAA . n A 1 48 HIS 48 48 48 HIS HIS AAA . n A 1 49 ALA 49 49 49 ALA ALA AAA . n A 1 50 ALA 50 50 50 ALA ALA AAA . n A 1 51 SER 51 51 51 SER SER AAA . n A 1 52 THR 52 52 52 THR THR AAA . n A 1 53 ASP 53 53 53 ASP ASP AAA . n A 1 54 ALA 54 54 54 ALA ALA AAA . n A 1 55 ASP 55 55 55 ASP ASP AAA . n A 1 56 LYS 56 56 56 LYS LYS AAA . n A 1 57 ALA 57 57 57 ALA ALA AAA . n A 1 58 ALA 58 58 58 ALA ALA AAA . n A 1 59 VAL 59 59 59 VAL VAL AAA . n A 1 60 ALA 60 60 60 ALA ALA AAA . n A 1 61 LYS 61 61 61 LYS LYS AAA . n A 1 62 ALA 62 62 62 ALA ALA AAA . n A 1 63 ARG 63 63 63 ARG ARG AAA . n A 1 64 ALA 64 64 64 ALA ALA AAA . n A 1 65 GLN 65 65 65 GLN GLN AAA . n A 1 66 LEU 66 66 66 LEU LEU AAA . n A 1 67 GLU 67 67 67 GLU GLU AAA . n A 1 68 LYS 68 68 68 LYS LYS AAA . n A 1 69 PRO 69 69 69 PRO PRO AAA . n A 1 70 LEU 70 70 70 LEU LEU AAA . n A 1 71 GLU 71 71 71 GLU GLU AAA . n A 1 72 LEU 72 72 72 LEU LEU AAA . n A 1 73 PHE 73 73 73 PHE PHE AAA . n A 1 74 ALA 74 74 74 ALA ALA AAA . n A 1 75 LEU 75 75 75 LEU LEU AAA . n A 1 76 PRO 76 76 76 PRO PRO AAA . n A 1 77 VAL 77 77 77 VAL VAL AAA . n A 1 78 THR 78 78 78 THR THR AAA . n A 1 79 ALA 79 79 79 ALA ALA AAA . n A 1 80 GLY 80 80 80 GLY GLY AAA . n A 1 81 CYS 81 81 81 CYS CYS AAA . n A 1 82 SER 82 82 82 SER SER AAA . n A 1 83 VAL 83 83 83 VAL VAL AAA . n A 1 84 ALA 84 84 84 ALA ALA AAA . n A 1 85 SER 85 85 85 SER SER AAA . n A 1 86 GLN 86 86 86 GLN GLN AAA . n A 1 87 GLU 87 87 87 GLU GLU AAA . n A 1 88 LEU 88 88 88 LEU LEU AAA . n A 1 89 ARG 89 89 89 ARG ARG AAA . n A 1 90 SER 90 90 90 SER SER AAA . n A 1 91 PRO 91 91 91 PRO PRO AAA . n A 1 92 LEU 92 92 92 LEU LEU AAA . n A 1 93 PHE 93 93 93 PHE PHE AAA . n A 1 94 GLY 94 94 ? ? ? AAA . n A 1 95 ASP 95 95 ? ? ? AAA . n A 1 96 LYS 96 96 ? ? ? AAA . n A 1 97 ALA 97 97 ? ? ? AAA . n A 1 98 PRO 98 98 ? ? ? AAA . n A 1 99 ALA 99 99 ? ? ? AAA . n A 1 100 HIS 100 100 ? ? ? AAA . n A 1 101 ALA 101 101 ? ? ? AAA . n A 1 102 HIS 102 102 ? ? ? AAA . n A 1 103 LYS 103 103 ? ? ? AAA . n A 1 104 GLU 104 104 ? ? ? AAA . n A 1 105 LYS 105 105 ? ? ? AAA . n A 1 106 ALA 106 106 ? ? ? AAA . n A 1 107 GLY 107 107 ? ? ? AAA . n A 1 108 HIS 108 108 ? ? ? AAA . n A 1 109 GLU 109 109 ? ? ? AAA . n A 1 110 HIS 110 110 ? ? ? AAA . n A 1 111 GLU 111 111 ? ? ? AAA . n A 1 112 HIS 112 112 ? ? ? AAA . n A 1 113 GLU 113 113 ? ? ? AAA . n A 1 114 HIS 114 114 ? ? ? AAA . n A 1 115 GLU 115 115 ? ? ? AAA . n A 1 116 HIS 116 116 ? ? ? AAA . n A 1 117 GLU 117 117 ? ? ? AAA . n A 1 118 HIS 118 118 ? ? ? AAA . n A 1 119 GLY 119 119 119 GLY GLY AAA . n A 1 120 HIS 120 120 120 HIS HIS AAA . n A 1 121 ALA 121 121 121 ALA ALA AAA . n A 1 122 ASP 122 122 122 ASP ASP AAA . n A 1 123 ILE 123 123 123 ILE ILE AAA . n A 1 124 HIS 124 124 124 HIS HIS AAA . n A 1 125 ALA 125 125 125 ALA ALA AAA . n A 1 126 HIS 126 126 126 HIS HIS AAA . n A 1 127 TYR 127 127 127 TYR TYR AAA . n A 1 128 GLN 128 128 128 GLN GLN AAA . n A 1 129 LEU 129 129 129 LEU LEU AAA . n A 1 130 SER 130 130 130 SER SER AAA . n A 1 131 CYS 131 131 131 CYS CYS AAA . n A 1 132 GLU 132 132 132 GLU GLU AAA . n A 1 133 LYS 133 133 133 LYS LYS AAA . n A 1 134 PRO 134 134 134 PRO PRO AAA . n A 1 135 GLU 135 135 135 GLU GLU AAA . n A 1 136 LEU 136 136 136 LEU LEU AAA . n A 1 137 LEU 137 137 137 LEU LEU AAA . n A 1 138 LYS 138 138 138 LYS LYS AAA . n A 1 139 LEU 139 139 139 LEU LEU AAA . n A 1 140 LEU 140 140 140 LEU LEU AAA . n A 1 141 THR 141 141 141 THR THR AAA . n A 1 142 LEU 142 142 142 LEU LEU AAA . n A 1 143 ALA 143 143 143 ALA ALA AAA . n A 1 144 GLU 144 144 144 GLU GLU AAA . n A 1 145 PHE 145 145 145 PHE PHE AAA . n A 1 146 PHE 146 146 146 PHE PHE AAA . n A 1 147 LYS 147 147 147 LYS LYS AAA . n A 1 148 ARG 148 148 148 ARG ARG AAA . n A 1 149 PHE 149 149 149 PHE PHE AAA . n A 1 150 PRO 150 150 150 PRO PRO AAA . n A 1 151 ALA 151 151 151 ALA ALA AAA . n A 1 152 THR 152 152 152 THR THR AAA . n A 1 153 GLN 153 153 153 GLN GLN AAA . n A 1 154 LYS 154 154 154 LYS LYS AAA . n A 1 155 ILE 155 155 155 ILE ILE AAA . n A 1 156 GLN 156 156 156 GLN GLN AAA . n A 1 157 VAL 157 157 157 VAL VAL AAA . n A 1 158 GLN 158 158 158 GLN GLN AAA . n A 1 159 LEU 159 159 159 LEU LEU AAA . n A 1 160 ILE 160 160 160 ILE ILE AAA . n A 1 161 GLY 161 161 161 GLY GLY AAA . n A 1 162 PRO 162 162 162 PRO PRO AAA . n A 1 163 ASP 163 163 163 ASP ASP AAA . n A 1 164 GLY 164 164 164 GLY GLY AAA . n A 1 165 GLN 165 165 165 GLN GLN AAA . n A 1 166 LYS 166 166 166 LYS LYS AAA . n A 1 167 GLY 167 167 167 GLY GLY AAA . n A 1 168 ALA 168 168 168 ALA ALA AAA . n A 1 169 ASP 169 169 169 ASP ASP AAA . n A 1 170 LEU 170 170 170 LEU LEU AAA . n A 1 171 ALA 171 171 171 ALA ALA AAA . n A 1 172 PRO 172 172 172 PRO PRO AAA . n A 1 173 ALA 173 173 173 ALA ALA AAA . n A 1 174 SER 174 174 174 SER SER AAA . n A 1 175 ALA 175 175 175 ALA ALA AAA . n A 1 176 GLU 176 176 176 GLU GLU AAA . n A 1 177 LEU 177 177 177 LEU LEU AAA . n A 1 178 LYS 178 178 178 LYS LYS AAA . n A 1 179 LEU 179 179 179 LEU LEU AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 202 ZN ZN AAA . C 2 ZN 1 202 201 ZN ZN AAA . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 2 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7AMX _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.467 _cell.length_a_esd ? _cell.length_b 62.467 _cell.length_b_esd ? _cell.length_c 102.076 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AMX _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AMX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.56 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'ammonium sulfate 2.3M, NaCl 2.1M' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96770 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96770 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7AMX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 62.47 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5107 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.5 _reflns.pdbx_Rmerge_I_obs 0.203 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.212 _reflns.pdbx_Rpim_I_all 0.062 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 9.01 62.47 ? ? ? ? ? ? 204 ? ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 16.1 ? ? ? ? 0.143 0.043 ? 1 1 0.983 ? ? 2.85 3.00 ? ? ? ? ? ? 718 ? ? ? ? ? 3.102 ? ? ? ? ? ? ? ? 20.7 ? ? ? ? 3.249 0.962 ? 2 1 0.518 ? ? # _refine.aniso_B[1][1] -1.738 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -1.738 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 3.475 _refine.B_iso_max ? _refine.B_iso_mean 81.095 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.935 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AMX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.850 _refine.ls_d_res_low 44.210 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5071 _refine.ls_number_reflns_R_free 258 _refine.ls_number_reflns_R_work 4813 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.490 _refine.ls_percent_reflns_R_free 5.088 _refine.ls_R_factor_all 0.188 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2369 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1849 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7AHW _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.731 _refine.pdbx_overall_ESU_R_Free 0.323 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 13.813 _refine.overall_SU_ML 0.256 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.850 _refine_hist.d_res_low 44.210 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1060 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1058 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.017 0.013 1085 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1057 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.686 1.643 1469 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.164 1.580 2448 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.498 5.000 138 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.522 24.681 47 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 21.104 15.000 187 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.687 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.059 0.200 140 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1215 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 211 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.202 0.200 151 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 906 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.153 0.200 464 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.084 0.200 601 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.120 0.200 14 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.097 0.200 6 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.150 0.200 24 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 6.246 8.037 558 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.194 8.027 557 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.856 12.061 694 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.876 12.069 695 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 8.802 9.028 527 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 8.799 9.022 527 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 13.411 13.119 775 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 13.405 13.113 775 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 15.727 91.815 986 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 15.739 91.892 987 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.850 2.924 . . 12 342 99.7183 . . . 0.262 . 0.269 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.924 3.004 . . 16 344 100.0000 . . . 0.359 . 0.266 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.004 3.091 . . 16 331 100.0000 . . . 0.299 . 0.280 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.091 3.186 . . 19 308 99.3921 . . . 0.263 . 0.276 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.186 3.291 . . 19 300 94.9405 . . . 0.360 . 0.240 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.291 3.406 . . 13 295 99.3548 . . . 0.209 . 0.228 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.406 3.534 . . 28 283 99.6795 . . . 0.277 . 0.217 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.534 3.679 . . 8 292 100.0000 . . . 0.284 . 0.216 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.679 3.842 . . 15 267 100.0000 . . . 0.195 . 0.194 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.842 4.029 . . 17 256 100.0000 . . . 0.227 . 0.169 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.029 4.247 . . 17 245 100.0000 . . . 0.308 . 0.162 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.247 4.504 . . 22 234 100.0000 . . . 0.177 . 0.148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.504 4.814 . . 5 232 100.0000 . . . 0.231 . 0.155 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.814 5.199 . . 12 213 100.0000 . . . 0.147 . 0.158 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.199 5.694 . . 8 194 100.0000 . . . 0.350 . 0.164 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.694 6.363 . . 8 184 100.0000 . . . 0.312 . 0.161 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.363 7.343 . . 7 161 100.0000 . . . 0.334 . 0.174 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.343 8.981 . . 11 141 100.0000 . . . 0.215 . 0.142 . . . . . . . . . . . 'X-RAY DIFFRACTION' 8.981 12.653 . . 3 118 100.0000 . . . 0.063 . 0.143 . . . . . . . . . . . 'X-RAY DIFFRACTION' 12.653 44.210 . . 2 73 96.1538 . . . 0.211 . 0.261 . . . . . . . . . . . # _struct.entry_id 7AMX _struct.title 'The crystal structure of gene product PA4063 from Pseudomonas aeruginosa in complex with zinc' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AMX _struct_keywords.text 'ferredoxin-like, zinc-binding, periplasmic, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5M6H2N4_PSEAI _struct_ref.pdbx_db_accession A0A5M6H2N4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HDDHDHDHAHGSLGKHEHGVAQLNVALDGKTLELELDSPAMNLVGFEHAASTDADKAAVAKARAQLEKPLELFALPVTAG CSVASQELRSPLFGDKAPAHAHKEKAGHEHEHEHEHEHGHADIHAHYQLSCEKPELLKLLTLAEFFKRFPATQKIQVQLI GPDGQKGADLAPASAELKL ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7AMX _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5M6H2N4 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 179 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -33 ? 1 'SSA (A^2)' 7320 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 41 ? LEU A 43 ? MET AAA 41 LEU AAA 43 5 ? 3 HELX_P HELX_P2 AA2 ALA A 54 ? LEU A 66 ? ALA AAA 54 LEU AAA 66 1 ? 13 HELX_P HELX_P3 AA3 LYS A 68 ? PHE A 73 ? LYS AAA 68 PHE AAA 73 1 ? 6 HELX_P HELX_P4 AA4 PRO A 76 ? ALA A 79 ? PRO AAA 76 ALA AAA 79 5 ? 4 HELX_P HELX_P5 AA5 LYS A 133 ? LEU A 137 ? LYS AAA 133 LEU AAA 137 5 ? 5 HELX_P HELX_P6 AA6 LEU A 142 ? PHE A 149 ? LEU AAA 142 PHE AAA 149 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 81 SG ? ? ? 1_555 A CYS 131 SG ? ? AAA CYS 81 AAA CYS 131 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc1 metalc ? ? A HIS 16 NE2 ? ? ? 1_555 B ZN . ZN ? ? AAA HIS 16 AAA ZN 201 1_555 ? ? ? ? ? ? ? 1.873 ? ? metalc2 metalc ? ? A HIS 18 NE2 ? ? ? 1_555 B ZN . ZN ? ? AAA HIS 18 AAA ZN 201 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc3 metalc ? ? A GLU 47 OE1 ? ? ? 1_555 B ZN . ZN ? ? AAA GLU 47 AAA ZN 201 1_555 ? ? ? ? ? ? ? 2.044 ? ? metalc4 metalc ? ? A GLU 87 OE1 ? ? ? 1_555 C ZN . ZN ? ? AAA GLU 87 AAA ZN 202 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc5 metalc ? ? A HIS 120 ND1 ? ? ? 1_555 B ZN . ZN ? ? AAA HIS 120 AAA ZN 201 1_555 ? ? ? ? ? ? ? 2.047 ? ? metalc6 metalc ? ? A HIS 124 NE2 ? ? ? 1_555 C ZN . ZN ? ? AAA HIS 124 AAA ZN 202 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc7 metalc ? ? A HIS 126 ND1 ? ? ? 1_555 C ZN . ZN ? ? AAA HIS 126 AAA ZN 202 1_555 ? ? ? ? ? ? ? 2.469 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 16 ? AAA HIS 16 ? 1_555 ZN ? B ZN . ? AAA ZN 201 ? 1_555 NE2 ? A HIS 18 ? AAA HIS 18 ? 1_555 99.0 ? 2 NE2 ? A HIS 16 ? AAA HIS 16 ? 1_555 ZN ? B ZN . ? AAA ZN 201 ? 1_555 OE1 ? A GLU 47 ? AAA GLU 47 ? 1_555 113.3 ? 3 NE2 ? A HIS 18 ? AAA HIS 18 ? 1_555 ZN ? B ZN . ? AAA ZN 201 ? 1_555 OE1 ? A GLU 47 ? AAA GLU 47 ? 1_555 125.5 ? 4 NE2 ? A HIS 16 ? AAA HIS 16 ? 1_555 ZN ? B ZN . ? AAA ZN 201 ? 1_555 ND1 ? A HIS 120 ? AAA HIS 120 ? 1_555 122.8 ? 5 NE2 ? A HIS 18 ? AAA HIS 18 ? 1_555 ZN ? B ZN . ? AAA ZN 201 ? 1_555 ND1 ? A HIS 120 ? AAA HIS 120 ? 1_555 106.3 ? 6 OE1 ? A GLU 47 ? AAA GLU 47 ? 1_555 ZN ? B ZN . ? AAA ZN 201 ? 1_555 ND1 ? A HIS 120 ? AAA HIS 120 ? 1_555 92.0 ? 7 OE1 ? A GLU 87 ? AAA GLU 87 ? 1_555 ZN ? C ZN . ? AAA ZN 202 ? 1_555 NE2 ? A HIS 124 ? AAA HIS 124 ? 1_555 89.4 ? 8 OE1 ? A GLU 87 ? AAA GLU 87 ? 1_555 ZN ? C ZN . ? AAA ZN 202 ? 1_555 ND1 ? A HIS 126 ? AAA HIS 126 ? 1_555 111.1 ? 9 NE2 ? A HIS 124 ? AAA HIS 124 ? 1_555 ZN ? C ZN . ? AAA ZN 202 ? 1_555 ND1 ? A HIS 126 ? AAA HIS 126 ? 1_555 117.5 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 81 ? ARG A 89 ? CYS AAA 81 ARG AAA 89 AA1 2 ASP A 122 ? CYS A 131 ? ASP AAA 122 CYS AAA 131 AA1 3 THR A 31 ? PRO A 39 ? THR AAA 31 PRO AAA 39 AA1 4 VAL A 20 ? ASP A 28 ? VAL AAA 20 ASP AAA 28 AA1 5 LYS A 154 ? GLY A 161 ? LYS AAA 154 GLY AAA 161 AA1 6 GLY A 164 ? LEU A 170 ? GLY AAA 164 LEU AAA 170 AA2 1 LEU A 139 ? THR A 141 ? LEU AAA 139 THR AAA 141 AA2 2 GLU A 176 ? LYS A 178 ? GLU AAA 176 LYS AAA 178 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 82 ? N SER AAA 82 O SER A 130 ? O SER AAA 130 AA1 2 3 O ALA A 125 ? O ALA AAA 125 N LEU A 36 ? N LEU AAA 36 AA1 3 4 O GLU A 35 ? O GLU AAA 35 N ASN A 24 ? N ASN AAA 24 AA1 4 5 N LEU A 23 ? N LEU AAA 23 O GLN A 156 ? O GLN AAA 156 AA1 5 6 N LEU A 159 ? N LEU AAA 159 O LYS A 166 ? O LYS AAA 166 AA2 1 2 N LEU A 140 ? N LEU AAA 140 O LEU A 177 ? O LEU AAA 177 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU AAA 47 ? ? -144.43 -12.27 2 1 SER AAA 51 ? ? -58.08 -72.23 3 1 THR AAA 52 ? ? -77.49 -168.37 4 1 GLN AAA 86 ? ? -165.24 116.64 5 1 ALA AAA 168 ? ? -173.47 136.23 6 1 ALA AAA 173 ? ? -49.42 -71.15 # _pdbx_entry_details.entry_id 7AMX _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA HIS 1 ? A HIS 1 2 1 Y 1 AAA ASP 2 ? A ASP 2 3 1 Y 1 AAA ASP 3 ? A ASP 3 4 1 Y 1 AAA HIS 4 ? A HIS 4 5 1 Y 1 AAA ASP 5 ? A ASP 5 6 1 Y 1 AAA HIS 6 ? A HIS 6 7 1 Y 1 AAA ASP 7 ? A ASP 7 8 1 Y 1 AAA HIS 8 ? A HIS 8 9 1 Y 1 AAA ALA 9 ? A ALA 9 10 1 Y 1 AAA HIS 10 ? A HIS 10 11 1 Y 1 AAA GLY 11 ? A GLY 11 12 1 Y 1 AAA SER 12 ? A SER 12 13 1 Y 1 AAA LEU 13 ? A LEU 13 14 1 Y 1 AAA GLY 14 ? A GLY 14 15 1 Y 1 AAA GLY 94 ? A GLY 94 16 1 Y 1 AAA ASP 95 ? A ASP 95 17 1 Y 1 AAA LYS 96 ? A LYS 96 18 1 Y 1 AAA ALA 97 ? A ALA 97 19 1 Y 1 AAA PRO 98 ? A PRO 98 20 1 Y 1 AAA ALA 99 ? A ALA 99 21 1 Y 1 AAA HIS 100 ? A HIS 100 22 1 Y 1 AAA ALA 101 ? A ALA 101 23 1 Y 1 AAA HIS 102 ? A HIS 102 24 1 Y 1 AAA LYS 103 ? A LYS 103 25 1 Y 1 AAA GLU 104 ? A GLU 104 26 1 Y 1 AAA LYS 105 ? A LYS 105 27 1 Y 1 AAA ALA 106 ? A ALA 106 28 1 Y 1 AAA GLY 107 ? A GLY 107 29 1 Y 1 AAA HIS 108 ? A HIS 108 30 1 Y 1 AAA GLU 109 ? A GLU 109 31 1 Y 1 AAA HIS 110 ? A HIS 110 32 1 Y 1 AAA GLU 111 ? A GLU 111 33 1 Y 1 AAA HIS 112 ? A HIS 112 34 1 Y 1 AAA GLU 113 ? A GLU 113 35 1 Y 1 AAA HIS 114 ? A HIS 114 36 1 Y 1 AAA GLU 115 ? A GLU 115 37 1 Y 1 AAA HIS 116 ? A HIS 116 38 1 Y 1 AAA GLU 117 ? A GLU 117 39 1 Y 1 AAA HIS 118 ? A HIS 118 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7AHW _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7AMX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016008 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016008 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009797 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.046 ZN 30 30 14.081 3.266 7.035 0.233 5.168 10.316 2.411 58.710 1.032 # loop_