data_7BUT # _entry.id 7BUT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BUT pdb_00007but 10.2210/pdb7but/pdb WWPDB D_1300016528 ? ? BMRB 36341 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'N-terminal domain (NTD) Solution structure of aciniform spidroin (AcSpN) from Nephila antipodiana.' _pdbx_database_related.db_id 36341 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7BUT _pdbx_database_status.recvd_initial_deposition_date 2020-04-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fan, J.S.' 1 ? 'Yang, D.W.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 21 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Basis of Oligomerization of N-Terminal Domain of Spider Aciniform Silk Protein.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms21124466 _citation.pdbx_database_id_PubMed 32586030 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chakraborty, R.' 1 ? primary 'Fan, J.S.' 2 0000-0002-3290-7083 primary 'Lai, C.C.' 3 ? primary 'Raghuvamsi, P.V.' 4 ? primary 'Chee, P.X.' 5 ? primary 'Anand, G.S.' 6 ? primary 'Yang, D.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Aciniform Spidroin' _entity.formula_weight 15318.378 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal Domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMSSKSPWANPKKANAFMKCLIQKISVSPVFPQQEKEDMESIVETMMSAISGVSTSRGSSEATLQAMNMAFASSMAELV IAEDVNNPDSIAEKTEALSQALKQCFRSTMGTVNRQFITEIKHLMTMFAAEAAQEAAAGDNE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMSSKSPWANPKKANAFMKCLIQKISVSPVFPQQEKEDMESIVETMMSAISGVSTSRGSSEATLQAMNMAFASSMAELV IAEDVNNPDSIAEKTEALSQALKQCFRSTMGTVNRQFITEIKHLMTMFAAEAAQEAAAGDNE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 SER n 1 5 SER n 1 6 LYS n 1 7 SER n 1 8 PRO n 1 9 TRP n 1 10 ALA n 1 11 ASN n 1 12 PRO n 1 13 LYS n 1 14 LYS n 1 15 ALA n 1 16 ASN n 1 17 ALA n 1 18 PHE n 1 19 MET n 1 20 LYS n 1 21 CYS n 1 22 LEU n 1 23 ILE n 1 24 GLN n 1 25 LYS n 1 26 ILE n 1 27 SER n 1 28 VAL n 1 29 SER n 1 30 PRO n 1 31 VAL n 1 32 PHE n 1 33 PRO n 1 34 GLN n 1 35 GLN n 1 36 GLU n 1 37 LYS n 1 38 GLU n 1 39 ASP n 1 40 MET n 1 41 GLU n 1 42 SER n 1 43 ILE n 1 44 VAL n 1 45 GLU n 1 46 THR n 1 47 MET n 1 48 MET n 1 49 SER n 1 50 ALA n 1 51 ILE n 1 52 SER n 1 53 GLY n 1 54 VAL n 1 55 SER n 1 56 THR n 1 57 SER n 1 58 ARG n 1 59 GLY n 1 60 SER n 1 61 SER n 1 62 GLU n 1 63 ALA n 1 64 THR n 1 65 LEU n 1 66 GLN n 1 67 ALA n 1 68 MET n 1 69 ASN n 1 70 MET n 1 71 ALA n 1 72 PHE n 1 73 ALA n 1 74 SER n 1 75 SER n 1 76 MET n 1 77 ALA n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 ILE n 1 82 ALA n 1 83 GLU n 1 84 ASP n 1 85 VAL n 1 86 ASN n 1 87 ASN n 1 88 PRO n 1 89 ASP n 1 90 SER n 1 91 ILE n 1 92 ALA n 1 93 GLU n 1 94 LYS n 1 95 THR n 1 96 GLU n 1 97 ALA n 1 98 LEU n 1 99 SER n 1 100 GLN n 1 101 ALA n 1 102 LEU n 1 103 LYS n 1 104 GLN n 1 105 CYS n 1 106 PHE n 1 107 ARG n 1 108 SER n 1 109 THR n 1 110 MET n 1 111 GLY n 1 112 THR n 1 113 VAL n 1 114 ASN n 1 115 ARG n 1 116 GLN n 1 117 PHE n 1 118 ILE n 1 119 THR n 1 120 GLU n 1 121 ILE n 1 122 LYS n 1 123 HIS n 1 124 LEU n 1 125 MET n 1 126 THR n 1 127 MET n 1 128 PHE n 1 129 ALA n 1 130 ALA n 1 131 GLU n 1 132 ALA n 1 133 ALA n 1 134 GLN n 1 135 GLU n 1 136 ALA n 1 137 ALA n 1 138 ALA n 1 139 GLY n 1 140 ASP n 1 141 ASN n 1 142 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 142 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nephila antipodiana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 171624 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7BUT _struct_ref.pdbx_db_accession 7BUT _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BUT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7BUT _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HCCH-TOCSY' 1 isotropic 5 1 1 '3D 1H-15N NOESY' 1 isotropic 6 1 1 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 500 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label con_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] NTD, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label CN_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7BUT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 7BUT _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7BUT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 2.53 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' 'X-PLOR NIH' 2.53 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BUT _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7BUT _struct.title 'N-terminal domain (NTD) Solution structure of aciniform spidroin (AcSpN) from Nephila antipodiana.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BUT _struct_keywords.text 'N-terminal domain, spidroin, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 11 ? SER A 29 ? ASN A 11 SER A 29 1 ? 19 HELX_P HELX_P2 AA2 GLN A 34 ? SER A 55 ? GLN A 34 SER A 55 1 ? 22 HELX_P HELX_P3 AA3 SER A 61 ? ASN A 87 ? SER A 61 ASN A 87 1 ? 27 HELX_P HELX_P4 AA4 ASN A 87 ? THR A 109 ? ASN A 87 THR A 109 1 ? 23 HELX_P HELX_P5 AA5 ARG A 115 ? ASP A 140 ? ARG A 115 ASP A 140 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 21 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 105 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 21 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 105 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.022 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7BUT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 MET 127 127 127 MET MET A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 GLU 142 142 142 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8990 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-22 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component NTD _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 9 O A ALA 82 ? ? HD21 A ASN 86 ? ? 1.60 2 11 O A ALA 82 ? ? HD21 A ASN 86 ? ? 1.60 3 15 O A ALA 82 ? ? HD21 A ASN 86 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 8 ? ? -72.35 -71.78 2 1 VAL A 31 ? ? -133.46 -39.31 3 1 SER A 57 ? ? -176.08 -45.26 4 1 ASN A 87 ? ? -161.91 102.48 5 1 THR A 109 ? ? -113.52 -84.60 6 2 SER A 4 ? ? 69.19 -153.85 7 2 SER A 55 ? ? -92.63 50.36 8 2 SER A 57 ? ? -163.67 -162.80 9 2 THR A 109 ? ? -120.48 -66.03 10 3 SER A 5 ? ? -164.60 96.41 11 3 PRO A 8 ? ? -87.91 -75.52 12 3 SER A 55 ? ? 177.69 142.05 13 3 SER A 57 ? ? -174.38 -172.68 14 4 PRO A 8 ? ? -84.11 -81.47 15 4 THR A 56 ? ? -100.28 -81.50 16 4 SER A 57 ? ? -142.74 16.01 17 4 ASN A 87 ? ? -161.05 99.81 18 4 THR A 109 ? ? -119.02 -87.90 19 5 PRO A 8 ? ? -68.66 -75.40 20 5 PRO A 30 ? ? -58.29 -7.63 21 5 ASN A 87 ? ? -157.33 88.34 22 5 THR A 109 ? ? -125.54 -60.34 23 5 ASP A 140 ? ? -169.68 -50.25 24 6 SER A 2 ? ? 69.63 -153.98 25 6 PRO A 8 ? ? -70.02 -72.77 26 6 SER A 57 ? ? 176.73 41.11 27 6 THR A 109 ? ? -117.08 -76.05 28 6 ASP A 140 ? ? -163.33 -73.22 29 7 PRO A 8 ? ? -85.51 -82.20 30 7 SER A 29 ? ? 70.89 60.86 31 7 VAL A 31 ? ? -143.04 -34.84 32 7 SER A 57 ? ? -152.95 -81.59 33 7 THR A 109 ? ? -119.30 -77.84 34 8 SER A 5 ? ? -151.09 45.69 35 8 THR A 56 ? ? -126.08 -75.34 36 8 ASN A 87 ? ? -157.23 86.08 37 8 THR A 109 ? ? -115.91 -74.83 38 9 PRO A 8 ? ? -84.52 -76.16 39 9 SER A 57 ? ? -157.51 69.10 40 9 ARG A 58 ? ? 75.88 -73.00 41 9 ASN A 87 ? ? -161.86 102.63 42 9 THR A 109 ? ? -120.15 -70.25 43 10 PRO A 8 ? ? -77.19 -71.24 44 10 SER A 55 ? ? 65.96 -169.59 45 10 SER A 57 ? ? -162.59 119.04 46 10 ARG A 58 ? ? 60.77 -160.55 47 10 THR A 109 ? ? -117.49 -74.52 48 10 THR A 112 ? ? 60.16 73.29 49 11 SER A 5 ? ? 79.86 -53.92 50 11 PRO A 8 ? ? -89.73 -77.87 51 11 SER A 55 ? ? 82.48 -51.54 52 11 THR A 56 ? ? 74.65 69.76 53 11 ASN A 87 ? ? -161.64 102.36 54 11 THR A 109 ? ? -117.46 -72.20 55 12 THR A 109 ? ? -116.01 -82.28 56 12 THR A 112 ? ? 61.88 89.95 57 13 MET A 3 ? ? 68.82 178.10 58 13 PRO A 8 ? ? -73.51 -71.90 59 13 SER A 29 ? ? 71.10 61.18 60 13 VAL A 31 ? ? -143.03 -34.20 61 13 ASN A 87 ? ? -164.68 112.54 62 13 THR A 109 ? ? -119.63 -85.70 63 14 SER A 55 ? ? 63.08 -149.99 64 14 ASN A 87 ? ? -160.80 98.08 65 14 THR A 109 ? ? -119.51 -76.66 66 14 ASN A 141 ? ? 73.38 -176.46 67 15 SER A 57 ? ? -140.80 -81.78 68 15 ASN A 87 ? ? -160.17 103.16 69 15 THR A 109 ? ? -116.63 -87.28 70 16 LYS A 6 ? ? -104.48 55.20 71 16 SER A 57 ? ? -154.95 -87.77 72 16 THR A 109 ? ? -123.78 -87.05 73 17 MET A 3 ? ? -138.77 -74.55 74 17 PRO A 8 ? ? -67.98 -72.03 75 17 PRO A 30 ? ? -86.49 48.47 76 17 SER A 57 ? ? -155.16 -90.31 77 17 ASN A 87 ? ? -164.01 105.48 78 17 THR A 109 ? ? -114.28 -88.12 79 18 PRO A 8 ? ? -83.76 -82.47 80 18 SER A 55 ? ? 66.05 -138.86 81 18 ASN A 87 ? ? -164.47 105.53 82 18 THR A 109 ? ? -112.30 -82.37 83 18 ASN A 141 ? ? 73.51 -177.27 84 19 PRO A 8 ? ? -76.45 -83.38 85 19 THR A 56 ? ? 70.86 58.00 86 19 ASN A 87 ? ? -165.45 106.12 87 20 PRO A 8 ? ? -89.39 -81.33 88 20 THR A 56 ? ? 80.63 -54.64 89 20 THR A 109 ? ? -117.21 -84.96 90 20 ASN A 141 ? ? 73.79 -177.76 # _pdbx_audit_support.funding_organization 'Ministry of Education (MoE, Singapore)' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number Tier1-R154000A50114 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #