data_7C1M # _entry.id 7C1M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7C1M pdb_00007c1m 10.2210/pdb7c1m/pdb WWPDB D_1300016862 ? ? BMRB 36353 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Complex structure of tyrosinated alpha-tubulin carboxy-terminal peptide and A1aY1 binder' _pdbx_database_related.db_id 36353 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7C1M _pdbx_database_status.recvd_initial_deposition_date 2020-05-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kesarwani, S.' 1 ? 'Reddy, P.P.' 2 ? 'Sirajuddin, M.' 3 ? 'Das, R.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J.Cell Biol.' _citation.journal_id_ASTM JCLBA3 _citation.journal_id_CSD 2019 _citation.journal_id_ISSN 1540-8140 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 219 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Genetically encoded live-cell sensor for tyrosinated microtubules.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1083/jcb.201912107 _citation.pdbx_database_id_PubMed 32886100 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kesarwani, S.' 1 ? primary 'Lama, P.' 2 ? primary 'Chandra, A.' 3 ? primary 'Reddy, P.P.' 4 ? primary 'Jijumon, A.S.' 5 ? primary 'Bodakuntla, S.' 6 ? primary 'Rao, B.M.' 7 ? primary 'Janke, C.' 8 ? primary 'Das, R.' 9 ? primary 'Sirajuddin, M.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nanobody binder from SSO7d library' 7486.859 1 ? ? ? ? 2 polymer syn 'Carboxy-terminal peptide from tyrosinated alpha-tubulin' 1355.272 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GSHMATVKFKYKGEEKQVDISKILSVGRYGKLIHFLYDLGGGKAGMGMVSEKDAPKELLQMLEKQKK GSHMATVKFKYKGEEKQVDISKILSVGRYGKLIHFLYDLGGGKAGMGMVSEKDAPKELLQMLEKQKK A ? 2 'polypeptide(L)' no no VEGEGEEEGEEY VEGEGEEEGEEY B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 THR n 1 7 VAL n 1 8 LYS n 1 9 PHE n 1 10 LYS n 1 11 TYR n 1 12 LYS n 1 13 GLY n 1 14 GLU n 1 15 GLU n 1 16 LYS n 1 17 GLN n 1 18 VAL n 1 19 ASP n 1 20 ILE n 1 21 SER n 1 22 LYS n 1 23 ILE n 1 24 LEU n 1 25 SER n 1 26 VAL n 1 27 GLY n 1 28 ARG n 1 29 TYR n 1 30 GLY n 1 31 LYS n 1 32 LEU n 1 33 ILE n 1 34 HIS n 1 35 PHE n 1 36 LEU n 1 37 TYR n 1 38 ASP n 1 39 LEU n 1 40 GLY n 1 41 GLY n 1 42 GLY n 1 43 LYS n 1 44 ALA n 1 45 GLY n 1 46 MET n 1 47 GLY n 1 48 MET n 1 49 VAL n 1 50 SER n 1 51 GLU n 1 52 LYS n 1 53 ASP n 1 54 ALA n 1 55 PRO n 1 56 LYS n 1 57 GLU n 1 58 LEU n 1 59 LEU n 1 60 GLN n 1 61 MET n 1 62 LEU n 1 63 GLU n 1 64 LYS n 1 65 GLN n 1 66 LYS n 1 67 LYS n 2 1 VAL n 2 2 GLU n 2 3 GLY n 2 4 GLU n 2 5 GLY n 2 6 GLU n 2 7 GLU n 2 8 GLU n 2 9 GLY n 2 10 GLU n 2 11 GLU n 2 12 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 67 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharolobus solfataricus 98/2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 555311 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 7C1M 7C1M ? 1 ? 1 2 PDB 7C1M 7C1M ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7C1M A 1 ? 67 ? 7C1M 1 ? 67 ? 1 67 2 2 7C1M B 1 ? 12 ? 7C1M 1 ? 12 ? 1 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HN(CA)CO' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 10 1 1 '3D CBCA(CO)NH' 1 isotropic 9 1 1 '3D C(CO)NH' 1 isotropic 8 1 1 '3D H(CCO)NH' 1 isotropic 7 1 1 '3D HCCH-TOCSY' 1 isotropic 6 1 1 '2D Filtered NOESY' 2 isotropic 11 1 1 '2D Filtered TOCSY' 2 isotropic 12 1 1 '3D 13C-filtered, 13C-edited NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50 mM unlabeled sodium phosphate, 200 mM unlabeled sodium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 7C1M _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 7C1M _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7C1M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'chemical shift assignment' PINE ? 'Bahrami, Markley, Assadi, and Eghbalnia' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' Sparky ? Goddard 4 'structure calculation' CS-ROSETTA ? 'Shen, Vernon, Baker and Bax' 6 'structure calculation' HADDOCK ? Bonvin # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7C1M _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7C1M _struct.title 'Complex structure of tyrosinated alpha-tubulin carboxy-terminal peptide and A1aY1 binder' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7C1M _struct_keywords.text 'Tyrosinated, Microtubule, Binder, SSO7d, yeast display, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 65 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 65 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 6 ? TYR A 11 ? THR A 6 TYR A 11 AA1 2 GLU A 14 ? ASP A 19 ? GLU A 14 ASP A 19 AA2 1 ILE A 23 ? ARG A 28 ? ILE A 23 ARG A 28 AA2 2 LEU A 32 ? GLY A 40 ? LEU A 32 GLY A 40 AA2 3 LYS A 43 ? SER A 50 ? LYS A 43 SER A 50 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 7 ? N VAL A 7 O VAL A 18 ? O VAL A 18 AA2 1 2 N GLY A 27 ? N GLY A 27 O HIS A 34 ? O HIS A 34 AA2 2 3 N ILE A 33 ? N ILE A 33 O VAL A 49 ? O VAL A 49 # _atom_sites.entry_id 7C1M _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n B 2 1 VAL 1 1 ? ? ? B . n B 2 2 GLU 2 2 ? ? ? B . n B 2 3 GLY 3 3 3 GLY GLY B . n B 2 4 GLU 4 4 4 GLU GLU B . n B 2 5 GLY 5 5 5 GLY GLY B . n B 2 6 GLU 6 6 6 GLU GLU B . n B 2 7 GLU 7 7 7 GLU GLU B . n B 2 8 GLU 8 8 8 GLU GLU B . n B 2 9 GLY 9 9 9 GLY GLY B . n B 2 10 GLU 10 10 10 GLU GLU B . n B 2 11 GLU 11 11 11 GLU GLU B . n B 2 12 TYR 12 12 12 TYR TYR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1140 ? 1 MORE -5 ? 1 'SSA (A^2)' 5270 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-02 2 'Structure model' 1 1 2020-10-14 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 50 ? mM unlabeled 1 'sodium chloride' 200 ? mM unlabeled # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 63 ? ? HZ2 A LYS 66 ? ? 1.56 2 1 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.59 3 1 HZ2 A LYS 31 ? ? OE1 A GLU 51 ? ? 1.59 4 3 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.57 5 4 HZ2 A LYS 31 ? ? OE1 A GLU 51 ? ? 1.58 6 5 HZ2 A LYS 31 ? ? OE1 A GLU 51 ? ? 1.58 7 5 HG A SER 2 ? ? OD2 A ASP 19 ? ? 1.59 8 6 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.57 9 6 HG A SER 2 ? ? OD2 A ASP 19 ? ? 1.58 10 7 HG A SER 2 ? ? OD2 A ASP 19 ? ? 1.60 11 8 HZ1 A LYS 12 ? ? OE1 B GLU 10 ? ? 1.58 12 8 HZ3 A LYS 16 ? ? OE1 B GLU 6 ? ? 1.60 13 9 HG A SER 50 ? ? OD2 A ASP 53 ? ? 1.60 14 10 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.59 15 11 HZ1 A LYS 8 ? ? OE2 A GLU 15 ? ? 1.60 16 12 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.58 17 13 OE1 A GLU 63 ? ? HZ2 A LYS 66 ? ? 1.59 18 14 HZ2 A LYS 31 ? ? OE1 A GLU 51 ? ? 1.58 19 15 HZ3 A LYS 16 ? ? OE1 B GLU 6 ? ? 1.54 20 15 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.59 21 16 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.58 22 16 HG A SER 2 ? ? OD2 A ASP 19 ? ? 1.58 23 17 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.57 24 17 OE1 A GLU 63 ? ? HZ2 A LYS 66 ? ? 1.59 25 18 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.59 26 19 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.57 27 19 OE1 A GLU 63 ? ? HZ2 A LYS 66 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 12 ? ? 55.35 19.79 2 1 LEU A 39 ? ? -97.71 -69.70 3 2 LYS A 10 ? ? -110.65 58.66 4 2 LYS A 12 ? ? 59.45 16.85 5 2 GLU B 8 ? ? -123.53 -131.37 6 3 LYS A 10 ? ? -102.69 57.33 7 4 LYS A 10 ? ? -103.49 57.88 8 4 LEU A 39 ? ? -94.59 -62.09 9 5 MET A 4 ? ? -90.08 -134.97 10 5 LYS A 12 ? ? 59.16 15.70 11 5 LEU A 39 ? ? -96.17 -70.76 12 5 GLU B 8 ? ? -118.28 -166.18 13 6 LYS A 12 ? ? 58.96 12.51 14 6 LEU A 24 ? ? -93.74 -60.13 15 7 TYR A 11 ? ? -65.38 98.97 16 8 TYR A 29 ? ? -98.76 50.32 17 8 GLU B 8 ? ? -129.93 -150.48 18 9 MET A 4 ? ? -101.32 -168.56 19 9 TYR A 29 ? ? -96.85 53.94 20 10 LYS A 12 ? ? 59.24 18.72 21 10 LEU A 24 ? ? -91.60 -63.53 22 10 LEU A 39 ? ? -102.57 -65.35 23 12 LYS A 10 ? ? -105.02 60.56 24 12 LEU A 24 ? ? -93.09 -63.41 25 13 LYS A 12 ? ? 58.17 19.27 26 13 LEU A 24 ? ? -90.69 -61.31 27 14 ALA A 44 ? ? -103.04 -165.94 28 15 LYS A 10 ? ? -100.92 62.22 29 15 LYS A 12 ? ? 56.37 19.19 30 16 GLU B 8 ? ? -122.82 -168.78 31 17 TYR A 29 ? ? -95.44 54.24 32 18 ALA A 44 ? ? -142.27 -158.65 33 19 GLU B 8 ? ? -123.77 -168.76 34 20 LYS A 10 ? ? -105.62 58.48 35 20 LEU A 24 ? ? -93.65 -66.26 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B VAL 1 ? B VAL 1 2 1 Y 1 B GLU 2 ? B GLU 2 3 2 Y 1 B VAL 1 ? B VAL 1 4 2 Y 1 B GLU 2 ? B GLU 2 5 3 Y 1 B VAL 1 ? B VAL 1 6 3 Y 1 B GLU 2 ? B GLU 2 7 4 Y 1 B VAL 1 ? B VAL 1 8 4 Y 1 B GLU 2 ? B GLU 2 9 5 Y 1 B VAL 1 ? B VAL 1 10 5 Y 1 B GLU 2 ? B GLU 2 11 6 Y 1 B VAL 1 ? B VAL 1 12 6 Y 1 B GLU 2 ? B GLU 2 13 7 Y 1 B VAL 1 ? B VAL 1 14 7 Y 1 B GLU 2 ? B GLU 2 15 8 Y 1 B VAL 1 ? B VAL 1 16 8 Y 1 B GLU 2 ? B GLU 2 17 9 Y 1 B VAL 1 ? B VAL 1 18 9 Y 1 B GLU 2 ? B GLU 2 19 10 Y 1 B VAL 1 ? B VAL 1 20 10 Y 1 B GLU 2 ? B GLU 2 21 11 Y 1 B VAL 1 ? B VAL 1 22 11 Y 1 B GLU 2 ? B GLU 2 23 12 Y 1 B VAL 1 ? B VAL 1 24 12 Y 1 B GLU 2 ? B GLU 2 25 13 Y 1 B VAL 1 ? B VAL 1 26 13 Y 1 B GLU 2 ? B GLU 2 27 14 Y 1 B VAL 1 ? B VAL 1 28 14 Y 1 B GLU 2 ? B GLU 2 29 15 Y 1 B VAL 1 ? B VAL 1 30 15 Y 1 B GLU 2 ? B GLU 2 31 16 Y 1 B VAL 1 ? B VAL 1 32 16 Y 1 B GLU 2 ? B GLU 2 33 17 Y 1 B VAL 1 ? B VAL 1 34 17 Y 1 B GLU 2 ? B GLU 2 35 18 Y 1 B VAL 1 ? B VAL 1 36 18 Y 1 B GLU 2 ? B GLU 2 37 19 Y 1 B VAL 1 ? B VAL 1 38 19 Y 1 B GLU 2 ? B GLU 2 39 20 Y 1 B VAL 1 ? B VAL 1 40 20 Y 1 B GLU 2 ? B GLU 2 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number DBT/PR5081/INF/156/2012 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #