data_7C7W # _entry.id 7C7W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7C7W pdb_00007c7w 10.2210/pdb7c7w/pdb WWPDB D_1300017071 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7C7W _pdbx_database_status.recvd_initial_deposition_date 2020-05-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Masuno, H.' 1 ? 'Numoto, N.' 2 ? 'Kagechika, H.' 3 ? 'Ito, N.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 516 _citation.page_last 526 _citation.title 'Lithocholic Acid Derivatives as Potent Vitamin D Receptor Agonists.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.0c01420 _citation.pdbx_database_id_PubMed 33369416 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sasaki, H.' 1 ? primary 'Masuno, H.' 2 ? primary 'Kawasaki, H.' 3 ? primary 'Yoshihara, A.' 4 ? primary 'Numoto, N.' 5 ? primary 'Ito, N.' 6 ? primary 'Ishida, H.' 7 ? primary 'Yamamoto, K.' 8 ? primary 'Hirata, N.' 9 ? primary 'Kanda, Y.' 10 ? primary 'Kawachi, E.' 11 ? primary 'Kagechika, H.' 12 ? primary 'Tanatani, A.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 98.581 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7C7W _cell.details ? _cell.formula_units_Z ? _cell.length_a 157.144 _cell.length_a_esd ? _cell.length_b 37.436 _cell.length_b_esd ? _cell.length_c 40.910 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7C7W _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor' 30595.037 1 ? 'deletion 166-212' ? ? 2 polymer syn 'Mediator of RNA polymerase II transcription subunit 1' 1570.898 1 ? ? ? ? 3 non-polymer syn ;(4R)-4-[(3S,5R,8R,9S,10S,13R,14S,17R)-10,13-dimethyl-3-(2-methyl-2-oxidanyl-propyl)-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoic acid ; 432.679 1 ? ? ? ? 4 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 5 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VDR,1,25-dihydroxyvitamin D3 receptor,Nuclear receptor subfamily 1 group I member 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSY SIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKF QVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; ;GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSMLPHLADLVSY SIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKF QVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; A ? 2 'polypeptide(L)' no no KNHPMLMNLLKDN KNHPMLMNLLKDN C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 SER n 1 7 PRO n 1 8 ASN n 1 9 SER n 1 10 PRO n 1 11 LEU n 1 12 LYS n 1 13 ASP n 1 14 SER n 1 15 LEU n 1 16 ARG n 1 17 PRO n 1 18 LYS n 1 19 LEU n 1 20 SER n 1 21 GLU n 1 22 GLU n 1 23 GLN n 1 24 GLN n 1 25 HIS n 1 26 ILE n 1 27 ILE n 1 28 ALA n 1 29 ILE n 1 30 LEU n 1 31 LEU n 1 32 ASP n 1 33 ALA n 1 34 HIS n 1 35 HIS n 1 36 LYS n 1 37 THR n 1 38 TYR n 1 39 ASP n 1 40 PRO n 1 41 THR n 1 42 TYR n 1 43 ALA n 1 44 ASP n 1 45 PHE n 1 46 ARG n 1 47 ASP n 1 48 PHE n 1 49 ARG n 1 50 PRO n 1 51 PRO n 1 52 VAL n 1 53 ARG n 1 54 MET n 1 55 ASP n 1 56 GLY n 1 57 SER n 1 58 THR n 1 59 GLY n 1 60 SER n 1 61 VAL n 1 62 THR n 1 63 LEU n 1 64 ASP n 1 65 LEU n 1 66 SER n 1 67 PRO n 1 68 LEU n 1 69 SER n 1 70 MET n 1 71 LEU n 1 72 PRO n 1 73 HIS n 1 74 LEU n 1 75 ALA n 1 76 ASP n 1 77 LEU n 1 78 VAL n 1 79 SER n 1 80 TYR n 1 81 SER n 1 82 ILE n 1 83 GLN n 1 84 LYS n 1 85 VAL n 1 86 ILE n 1 87 GLY n 1 88 PHE n 1 89 ALA n 1 90 LYS n 1 91 MET n 1 92 ILE n 1 93 PRO n 1 94 GLY n 1 95 PHE n 1 96 ARG n 1 97 ASP n 1 98 LEU n 1 99 THR n 1 100 SER n 1 101 ASP n 1 102 ASP n 1 103 GLN n 1 104 ILE n 1 105 VAL n 1 106 LEU n 1 107 LEU n 1 108 LYS n 1 109 SER n 1 110 SER n 1 111 ALA n 1 112 ILE n 1 113 GLU n 1 114 VAL n 1 115 ILE n 1 116 MET n 1 117 LEU n 1 118 ARG n 1 119 SER n 1 120 ASN n 1 121 GLN n 1 122 SER n 1 123 PHE n 1 124 THR n 1 125 MET n 1 126 ASP n 1 127 ASP n 1 128 MET n 1 129 SER n 1 130 TRP n 1 131 ASP n 1 132 CYS n 1 133 GLY n 1 134 SER n 1 135 GLN n 1 136 ASP n 1 137 TYR n 1 138 LYS n 1 139 TYR n 1 140 ASP n 1 141 VAL n 1 142 THR n 1 143 ASP n 1 144 VAL n 1 145 SER n 1 146 LYS n 1 147 ALA n 1 148 GLY n 1 149 HIS n 1 150 THR n 1 151 LEU n 1 152 GLU n 1 153 LEU n 1 154 ILE n 1 155 GLU n 1 156 PRO n 1 157 LEU n 1 158 ILE n 1 159 LYS n 1 160 PHE n 1 161 GLN n 1 162 VAL n 1 163 GLY n 1 164 LEU n 1 165 LYS n 1 166 LYS n 1 167 LEU n 1 168 ASN n 1 169 LEU n 1 170 HIS n 1 171 GLU n 1 172 GLU n 1 173 GLU n 1 174 HIS n 1 175 VAL n 1 176 LEU n 1 177 LEU n 1 178 MET n 1 179 ALA n 1 180 ILE n 1 181 CYS n 1 182 ILE n 1 183 VAL n 1 184 SER n 1 185 PRO n 1 186 ASP n 1 187 ARG n 1 188 PRO n 1 189 GLY n 1 190 VAL n 1 191 GLN n 1 192 ASP n 1 193 ALA n 1 194 LYS n 1 195 LEU n 1 196 VAL n 1 197 GLU n 1 198 ALA n 1 199 ILE n 1 200 GLN n 1 201 ASP n 1 202 ARG n 1 203 LEU n 1 204 SER n 1 205 ASN n 1 206 THR n 1 207 LEU n 1 208 GLN n 1 209 THR n 1 210 TYR n 1 211 ILE n 1 212 ARG n 1 213 CYS n 1 214 ARG n 1 215 HIS n 1 216 PRO n 1 217 PRO n 1 218 PRO n 1 219 GLY n 1 220 SER n 1 221 HIS n 1 222 GLN n 1 223 LEU n 1 224 TYR n 1 225 ALA n 1 226 LYS n 1 227 MET n 1 228 ILE n 1 229 GLN n 1 230 LYS n 1 231 LEU n 1 232 ALA n 1 233 ASP n 1 234 LEU n 1 235 ARG n 1 236 SER n 1 237 LEU n 1 238 ASN n 1 239 GLU n 1 240 GLU n 1 241 HIS n 1 242 SER n 1 243 LYS n 1 244 GLN n 1 245 TYR n 1 246 ARG n 1 247 SER n 1 248 LEU n 1 249 SER n 1 250 PHE n 1 251 GLN n 1 252 PRO n 1 253 GLU n 1 254 ASN n 1 255 SER n 1 256 MET n 1 257 LYS n 1 258 LEU n 1 259 THR n 1 260 PRO n 1 261 LEU n 1 262 VAL n 1 263 LEU n 1 264 GLU n 1 265 VAL n 1 266 PHE n 1 267 GLY n 1 268 ASN n 1 269 GLU n 1 270 ILE n 1 271 SER n 2 1 LYS n 2 2 ASN n 2 3 HIS n 2 4 PRO n 2 5 MET n 2 6 LEU n 2 7 MET n 2 8 ASN n 2 9 LEU n 2 10 LEU n 2 11 LYS n 2 12 ASP n 2 13 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Vdr, Nr1i1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VDR_RAT P13053 ? 1 ;LKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSSSSSDLYTTSLDMMEP SGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSF TMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRL SNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEIS ; 116 2 UNP MED1_HUMAN Q15648 ? 2 KNHPMLMNLLKDN 640 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7C7W A 11 ? 271 ? P13053 116 ? 423 ? 116 423 2 2 7C7W C 1 ? 13 ? Q15648 640 ? 652 ? 625 637 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7C7W GLY A 1 ? UNP P13053 ? ? 'expression tag' 106 1 1 7C7W SER A 2 ? UNP P13053 ? ? 'expression tag' 107 2 1 7C7W HIS A 3 ? UNP P13053 ? ? 'expression tag' 108 3 1 7C7W MET A 4 ? UNP P13053 ? ? 'expression tag' 109 4 1 7C7W GLY A 5 ? UNP P13053 ? ? 'expression tag' 110 5 1 7C7W SER A 6 ? UNP P13053 ? ? 'expression tag' 111 6 1 7C7W PRO A 7 ? UNP P13053 ? ? 'expression tag' 112 7 1 7C7W ASN A 8 ? UNP P13053 ? ? 'expression tag' 113 8 1 7C7W SER A 9 ? UNP P13053 ? ? 'expression tag' 114 9 1 7C7W PRO A 10 ? UNP P13053 ? ? 'expression tag' 115 10 1 7C7W ? A ? ? UNP P13053 TYR 166 deletion ? 11 1 7C7W ? A ? ? UNP P13053 SER 167 deletion ? 12 1 7C7W ? A ? ? UNP P13053 PRO 168 deletion ? 13 1 7C7W ? A ? ? UNP P13053 ARG 169 deletion ? 14 1 7C7W ? A ? ? UNP P13053 PRO 170 deletion ? 15 1 7C7W ? A ? ? UNP P13053 THR 171 deletion ? 16 1 7C7W ? A ? ? UNP P13053 LEU 172 deletion ? 17 1 7C7W ? A ? ? UNP P13053 SER 173 deletion ? 18 1 7C7W ? A ? ? UNP P13053 PHE 174 deletion ? 19 1 7C7W ? A ? ? UNP P13053 SER 175 deletion ? 20 1 7C7W ? A ? ? UNP P13053 GLY 176 deletion ? 21 1 7C7W ? A ? ? UNP P13053 ASN 177 deletion ? 22 1 7C7W ? A ? ? UNP P13053 SER 178 deletion ? 23 1 7C7W ? A ? ? UNP P13053 SER 179 deletion ? 24 1 7C7W ? A ? ? UNP P13053 SER 180 deletion ? 25 1 7C7W ? A ? ? UNP P13053 SER 181 deletion ? 26 1 7C7W ? A ? ? UNP P13053 SER 182 deletion ? 27 1 7C7W ? A ? ? UNP P13053 SER 183 deletion ? 28 1 7C7W ? A ? ? UNP P13053 ASP 184 deletion ? 29 1 7C7W ? A ? ? UNP P13053 LEU 185 deletion ? 30 1 7C7W ? A ? ? UNP P13053 TYR 186 deletion ? 31 1 7C7W ? A ? ? UNP P13053 THR 187 deletion ? 32 1 7C7W ? A ? ? UNP P13053 THR 188 deletion ? 33 1 7C7W ? A ? ? UNP P13053 SER 189 deletion ? 34 1 7C7W ? A ? ? UNP P13053 LEU 190 deletion ? 35 1 7C7W ? A ? ? UNP P13053 ASP 191 deletion ? 36 1 7C7W ? A ? ? UNP P13053 MET 192 deletion ? 37 1 7C7W ? A ? ? UNP P13053 MET 193 deletion ? 38 1 7C7W ? A ? ? UNP P13053 GLU 194 deletion ? 39 1 7C7W ? A ? ? UNP P13053 PRO 195 deletion ? 40 1 7C7W ? A ? ? UNP P13053 SER 196 deletion ? 41 1 7C7W ? A ? ? UNP P13053 GLY 197 deletion ? 42 1 7C7W ? A ? ? UNP P13053 PHE 198 deletion ? 43 1 7C7W ? A ? ? UNP P13053 SER 199 deletion ? 44 1 7C7W ? A ? ? UNP P13053 ASN 200 deletion ? 45 1 7C7W ? A ? ? UNP P13053 LEU 201 deletion ? 46 1 7C7W ? A ? ? UNP P13053 ASP 202 deletion ? 47 1 7C7W ? A ? ? UNP P13053 LEU 203 deletion ? 48 1 7C7W ? A ? ? UNP P13053 ASN 204 deletion ? 49 1 7C7W ? A ? ? UNP P13053 GLY 205 deletion ? 50 1 7C7W ? A ? ? UNP P13053 GLU 206 deletion ? 51 1 7C7W ? A ? ? UNP P13053 ASP 207 deletion ? 52 1 7C7W ? A ? ? UNP P13053 SER 208 deletion ? 53 1 7C7W ? A ? ? UNP P13053 ASP 209 deletion ? 54 1 7C7W ? A ? ? UNP P13053 ASP 210 deletion ? 55 1 7C7W ? A ? ? UNP P13053 PRO 211 deletion ? 56 1 7C7W ? A ? ? UNP P13053 SER 212 deletion ? 57 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FKF non-polymer . ;(4R)-4-[(3S,5R,8R,9S,10S,13R,14S,17R)-10,13-dimethyl-3-(2-methyl-2-oxidanyl-propyl)-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoic acid ; ? 'C28 H48 O3' 432.679 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7C7W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MOPS-NaOH (pH 7.0), 0.2 M sodium formate, 12% (w/v) PEG4000, and 8% (v/v) ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7C7W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 40. _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18622 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.069 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2898 _reflns_shell.percent_possible_all 95.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.pdbx_Rsym_value 0.763 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.783 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -3.413 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -1.368 _refine.aniso_B[2][2] 1.451 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 2.271 _refine.B_iso_max ? _refine.B_iso_mean 39.447 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.941 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7C7W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.900 _refine.ls_d_res_low 40 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18617 _refine.ls_number_reflns_R_free 937 _refine.ls_number_reflns_R_work 17680 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.644 _refine.ls_percent_reflns_R_free 5.033 _refine.ls_R_factor_all 0.194 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2480 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1912 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2ZLC _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.167 _refine.pdbx_overall_ESU_R_Free 0.161 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.387 _refine.overall_SU_ML 0.144 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1927 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1977 _refine_hist.d_res_high 1.900 _refine_hist.d_res_low 40 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 2001 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1915 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.532 1.664 2709 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.332 1.612 4476 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.516 5.000 237 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.715 23.542 96 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.764 15.000 369 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.628 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 267 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2123 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 360 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.212 0.200 447 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 1862 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.163 0.200 992 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.077 0.200 958 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.137 0.200 46 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.243 0.200 14 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.163 0.200 52 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.146 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 3.041 3.941 960 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.040 3.943 961 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.374 5.882 1193 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.372 5.884 1194 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.159 4.467 1041 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.156 4.464 1040 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 6.302 6.485 1516 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.300 6.486 1517 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.984 47.237 2206 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.984 47.235 2206 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.900 1.950 . . 73 1209 91.5714 . . . 0.355 . 0.395 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.950 2.003 . . 63 1258 99.3980 . . . 0.369 . 0.330 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.003 2.061 . . 69 1252 99.6229 . . . 0.266 . 0.278 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.061 2.124 . . 63 1207 99.4518 . . . 0.265 . 0.249 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.124 2.194 . . 52 1168 99.5106 . . . 0.223 . 0.227 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.194 2.271 . . 62 1115 99.3249 . . . 0.238 . 0.209 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.271 2.357 . . 64 1081 99.6519 . . . 0.270 . 0.197 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.357 2.453 . . 63 1044 99.1936 . . . 0.262 . 0.193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.453 2.562 . . 51 1009 99.3440 . . . 0.186 . 0.172 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.562 2.687 . . 45 966 98.9237 . . . 0.268 . 0.159 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.687 2.832 . . 47 921 99.5885 . . . 0.247 . 0.157 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.832 3.003 . . 44 863 99.2341 . . . 0.303 . 0.183 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.003 3.210 . . 43 823 99.1982 . . . 0.257 . 0.187 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.210 3.467 . . 45 762 99.3842 . . . 0.252 . 0.172 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.467 3.797 . . 36 711 99.4674 . . . 0.186 . 0.167 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.797 4.244 . . 32 651 98.6994 . . . 0.221 . 0.162 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.244 4.898 . . 27 549 98.6301 . . . 0.151 . 0.156 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.898 5.993 . . 26 497 98.1238 . . . 0.346 . 0.223 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.993 8.450 . . 21 370 97.7500 . . . 0.304 . 0.195 . . . . . . . . . . . 'X-RAY DIFFRACTION' 8.450 40 . . 11 224 95.9184 . . . 0.257 . 0.195 . . . . . . . . . . . # _struct.entry_id 7C7W _struct.title 'Vitamin D3 receptor/lithochoric acid derivative complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7C7W _struct_keywords.text 'vitamin D receptor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 20 ? TYR A 38 ? SER A 125 TYR A 143 1 ? 19 HELX_P HELX_P2 AA2 MET A 70 ? MET A 91 ? MET A 222 MET A 243 1 ? 22 HELX_P HELX_P3 AA3 GLY A 94 ? LEU A 98 ? GLY A 246 LEU A 250 5 ? 5 HELX_P HELX_P4 AA4 THR A 99 ? SER A 119 ? THR A 251 SER A 271 1 ? 21 HELX_P HELX_P5 AA5 ASP A 140 ? SER A 145 ? ASP A 292 SER A 297 1 ? 6 HELX_P HELX_P6 AA6 THR A 150 ? ASN A 168 ? THR A 302 ASN A 320 1 ? 19 HELX_P HELX_P7 AA7 HIS A 170 ? VAL A 183 ? HIS A 322 VAL A 335 1 ? 14 HELX_P HELX_P8 AA8 ASP A 192 ? HIS A 215 ? ASP A 344 HIS A 367 1 ? 24 HELX_P HELX_P9 AA9 GLN A 222 ? PHE A 250 ? GLN A 374 PHE A 402 1 ? 29 HELX_P HELX_P10 AB1 GLN A 251 ? MET A 256 ? GLN A 403 MET A 408 1 ? 6 HELX_P HELX_P11 AB2 THR A 259 ? GLY A 267 ? THR A 411 GLY A 419 1 ? 9 HELX_P HELX_P12 AB3 HIS B 3 ? LYS B 11 ? HIS C 627 LYS C 635 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 217 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 369 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 218 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 370 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.20 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 123 ? THR A 124 ? PHE A 275 THR A 276 AA1 2 SER A 129 ? ASP A 131 ? SER A 281 ASP A 283 AA1 3 LYS A 138 ? TYR A 139 ? LYS A 290 TYR A 291 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 124 ? N THR A 276 O SER A 129 ? O SER A 281 AA1 2 3 N TRP A 130 ? N TRP A 282 O TYR A 139 ? O TYR A 291 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FKF 501 ? 8 'binding site for residue FKF A 501' AC2 Software A FMT 502 ? 2 'binding site for residue FMT A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 38 ? TYR A 143 . ? 1_555 ? 2 AC1 8 SER A 119 ? SER A 271 . ? 1_555 ? 3 AC1 8 SER A 122 ? SER A 274 . ? 1_555 ? 4 AC1 8 TYR A 139 ? TYR A 291 . ? 1_555 ? 5 AC1 8 ALA A 147 ? ALA A 299 . ? 1_555 ? 6 AC1 8 HIS A 149 ? HIS A 301 . ? 1_555 ? 7 AC1 8 HIS A 241 ? HIS A 393 . ? 1_555 ? 8 AC1 8 HOH E . ? HOH A 603 . ? 1_555 ? 9 AC2 2 THR A 124 ? THR A 276 . ? 1_555 ? 10 AC2 2 MET A 125 ? MET A 277 . ? 1_555 ? # _atom_sites.entry_id 7C7W _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006364 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000960 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026712 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024721 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.050 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 106 ? ? ? A . n A 1 2 SER 2 107 ? ? ? A . n A 1 3 HIS 3 108 ? ? ? A . n A 1 4 MET 4 109 ? ? ? A . n A 1 5 GLY 5 110 ? ? ? A . n A 1 6 SER 6 111 ? ? ? A . n A 1 7 PRO 7 112 ? ? ? A . n A 1 8 ASN 8 113 ? ? ? A . n A 1 9 SER 9 114 ? ? ? A . n A 1 10 PRO 10 115 ? ? ? A . n A 1 11 LEU 11 116 ? ? ? A . n A 1 12 LYS 12 117 ? ? ? A . n A 1 13 ASP 13 118 ? ? ? A . n A 1 14 SER 14 119 ? ? ? A . n A 1 15 LEU 15 120 ? ? ? A . n A 1 16 ARG 16 121 ? ? ? A . n A 1 17 PRO 17 122 ? ? ? A . n A 1 18 LYS 18 123 123 LYS LYS A . n A 1 19 LEU 19 124 124 LEU LEU A . n A 1 20 SER 20 125 125 SER SER A . n A 1 21 GLU 21 126 126 GLU GLU A . n A 1 22 GLU 22 127 127 GLU GLU A . n A 1 23 GLN 23 128 128 GLN GLN A . n A 1 24 GLN 24 129 129 GLN GLN A . n A 1 25 HIS 25 130 130 HIS HIS A . n A 1 26 ILE 26 131 131 ILE ILE A . n A 1 27 ILE 27 132 132 ILE ILE A . n A 1 28 ALA 28 133 133 ALA ALA A . n A 1 29 ILE 29 134 134 ILE ILE A . n A 1 30 LEU 30 135 135 LEU LEU A . n A 1 31 LEU 31 136 136 LEU LEU A . n A 1 32 ASP 32 137 137 ASP ASP A . n A 1 33 ALA 33 138 138 ALA ALA A . n A 1 34 HIS 34 139 139 HIS HIS A . n A 1 35 HIS 35 140 140 HIS HIS A . n A 1 36 LYS 36 141 141 LYS LYS A . n A 1 37 THR 37 142 142 THR THR A . n A 1 38 TYR 38 143 143 TYR TYR A . n A 1 39 ASP 39 144 144 ASP ASP A . n A 1 40 PRO 40 145 145 PRO PRO A . n A 1 41 THR 41 146 ? ? ? A . n A 1 42 TYR 42 147 ? ? ? A . n A 1 43 ALA 43 148 ? ? ? A . n A 1 44 ASP 44 149 ? ? ? A . n A 1 45 PHE 45 150 ? ? ? A . n A 1 46 ARG 46 151 ? ? ? A . n A 1 47 ASP 47 152 152 ASP ASP A . n A 1 48 PHE 48 153 153 PHE PHE A . n A 1 49 ARG 49 154 154 ARG ARG A . n A 1 50 PRO 50 155 155 PRO PRO A . n A 1 51 PRO 51 156 156 PRO PRO A . n A 1 52 VAL 52 157 157 VAL VAL A . n A 1 53 ARG 53 205 ? ? ? A . n A 1 54 MET 54 206 ? ? ? A . n A 1 55 ASP 55 207 ? ? ? A . n A 1 56 GLY 56 208 ? ? ? A . n A 1 57 SER 57 209 ? ? ? A . n A 1 58 THR 58 210 ? ? ? A . n A 1 59 GLY 59 211 ? ? ? A . n A 1 60 SER 60 212 ? ? ? A . n A 1 61 VAL 61 213 ? ? ? A . n A 1 62 THR 62 214 ? ? ? A . n A 1 63 LEU 63 215 ? ? ? A . n A 1 64 ASP 64 216 ? ? ? A . n A 1 65 LEU 65 217 ? ? ? A . n A 1 66 SER 66 218 ? ? ? A . n A 1 67 PRO 67 219 219 PRO PRO A . n A 1 68 LEU 68 220 220 LEU LEU A . n A 1 69 SER 69 221 221 SER SER A . n A 1 70 MET 70 222 222 MET MET A . n A 1 71 LEU 71 223 223 LEU LEU A . n A 1 72 PRO 72 224 224 PRO PRO A . n A 1 73 HIS 73 225 225 HIS HIS A . n A 1 74 LEU 74 226 226 LEU LEU A . n A 1 75 ALA 75 227 227 ALA ALA A . n A 1 76 ASP 76 228 228 ASP ASP A . n A 1 77 LEU 77 229 229 LEU LEU A . n A 1 78 VAL 78 230 230 VAL VAL A . n A 1 79 SER 79 231 231 SER SER A . n A 1 80 TYR 80 232 232 TYR TYR A . n A 1 81 SER 81 233 233 SER SER A . n A 1 82 ILE 82 234 234 ILE ILE A . n A 1 83 GLN 83 235 235 GLN GLN A . n A 1 84 LYS 84 236 236 LYS LYS A . n A 1 85 VAL 85 237 237 VAL VAL A . n A 1 86 ILE 86 238 238 ILE ILE A . n A 1 87 GLY 87 239 239 GLY GLY A . n A 1 88 PHE 88 240 240 PHE PHE A . n A 1 89 ALA 89 241 241 ALA ALA A . n A 1 90 LYS 90 242 242 LYS LYS A . n A 1 91 MET 91 243 243 MET MET A . n A 1 92 ILE 92 244 244 ILE ILE A . n A 1 93 PRO 93 245 245 PRO PRO A . n A 1 94 GLY 94 246 246 GLY GLY A . n A 1 95 PHE 95 247 247 PHE PHE A . n A 1 96 ARG 96 248 248 ARG ARG A . n A 1 97 ASP 97 249 249 ASP ASP A . n A 1 98 LEU 98 250 250 LEU LEU A . n A 1 99 THR 99 251 251 THR THR A . n A 1 100 SER 100 252 252 SER SER A . n A 1 101 ASP 101 253 253 ASP ASP A . n A 1 102 ASP 102 254 254 ASP ASP A . n A 1 103 GLN 103 255 255 GLN GLN A . n A 1 104 ILE 104 256 256 ILE ILE A . n A 1 105 VAL 105 257 257 VAL VAL A . n A 1 106 LEU 106 258 258 LEU LEU A . n A 1 107 LEU 107 259 259 LEU LEU A . n A 1 108 LYS 108 260 260 LYS LYS A . n A 1 109 SER 109 261 261 SER SER A . n A 1 110 SER 110 262 262 SER SER A . n A 1 111 ALA 111 263 263 ALA ALA A . n A 1 112 ILE 112 264 264 ILE ILE A . n A 1 113 GLU 113 265 265 GLU GLU A . n A 1 114 VAL 114 266 266 VAL VAL A . n A 1 115 ILE 115 267 267 ILE ILE A . n A 1 116 MET 116 268 268 MET MET A . n A 1 117 LEU 117 269 269 LEU LEU A . n A 1 118 ARG 118 270 270 ARG ARG A . n A 1 119 SER 119 271 271 SER SER A . n A 1 120 ASN 120 272 272 ASN ASN A . n A 1 121 GLN 121 273 273 GLN GLN A . n A 1 122 SER 122 274 274 SER SER A . n A 1 123 PHE 123 275 275 PHE PHE A . n A 1 124 THR 124 276 276 THR THR A . n A 1 125 MET 125 277 277 MET MET A . n A 1 126 ASP 126 278 278 ASP ASP A . n A 1 127 ASP 127 279 279 ASP ASP A . n A 1 128 MET 128 280 280 MET MET A . n A 1 129 SER 129 281 281 SER SER A . n A 1 130 TRP 130 282 282 TRP TRP A . n A 1 131 ASP 131 283 283 ASP ASP A . n A 1 132 CYS 132 284 284 CYS CYS A . n A 1 133 GLY 133 285 285 GLY GLY A . n A 1 134 SER 134 286 286 SER SER A . n A 1 135 GLN 135 287 287 GLN GLN A . n A 1 136 ASP 136 288 288 ASP ASP A . n A 1 137 TYR 137 289 289 TYR TYR A . n A 1 138 LYS 138 290 290 LYS LYS A . n A 1 139 TYR 139 291 291 TYR TYR A . n A 1 140 ASP 140 292 292 ASP ASP A . n A 1 141 VAL 141 293 293 VAL VAL A . n A 1 142 THR 142 294 294 THR THR A . n A 1 143 ASP 143 295 295 ASP ASP A . n A 1 144 VAL 144 296 296 VAL VAL A . n A 1 145 SER 145 297 297 SER SER A . n A 1 146 LYS 146 298 298 LYS LYS A . n A 1 147 ALA 147 299 299 ALA ALA A . n A 1 148 GLY 148 300 300 GLY GLY A . n A 1 149 HIS 149 301 301 HIS HIS A . n A 1 150 THR 150 302 302 THR THR A . n A 1 151 LEU 151 303 303 LEU LEU A . n A 1 152 GLU 152 304 304 GLU GLU A . n A 1 153 LEU 153 305 305 LEU LEU A . n A 1 154 ILE 154 306 306 ILE ILE A . n A 1 155 GLU 155 307 307 GLU GLU A . n A 1 156 PRO 156 308 308 PRO PRO A . n A 1 157 LEU 157 309 309 LEU LEU A . n A 1 158 ILE 158 310 310 ILE ILE A . n A 1 159 LYS 159 311 311 LYS LYS A . n A 1 160 PHE 160 312 312 PHE PHE A . n A 1 161 GLN 161 313 313 GLN GLN A . n A 1 162 VAL 162 314 314 VAL VAL A . n A 1 163 GLY 163 315 315 GLY GLY A . n A 1 164 LEU 164 316 316 LEU LEU A . n A 1 165 LYS 165 317 317 LYS LYS A . n A 1 166 LYS 166 318 318 LYS LYS A . n A 1 167 LEU 167 319 319 LEU LEU A . n A 1 168 ASN 168 320 320 ASN ASN A . n A 1 169 LEU 169 321 321 LEU LEU A . n A 1 170 HIS 170 322 322 HIS HIS A . n A 1 171 GLU 171 323 323 GLU GLU A . n A 1 172 GLU 172 324 324 GLU GLU A . n A 1 173 GLU 173 325 325 GLU GLU A . n A 1 174 HIS 174 326 326 HIS HIS A . n A 1 175 VAL 175 327 327 VAL VAL A . n A 1 176 LEU 176 328 328 LEU LEU A . n A 1 177 LEU 177 329 329 LEU LEU A . n A 1 178 MET 178 330 330 MET MET A . n A 1 179 ALA 179 331 331 ALA ALA A . n A 1 180 ILE 180 332 332 ILE ILE A . n A 1 181 CYS 181 333 333 CYS CYS A . n A 1 182 ILE 182 334 334 ILE ILE A . n A 1 183 VAL 183 335 335 VAL VAL A . n A 1 184 SER 184 336 336 SER SER A . n A 1 185 PRO 185 337 337 PRO PRO A . n A 1 186 ASP 186 338 338 ASP ASP A . n A 1 187 ARG 187 339 339 ARG ARG A . n A 1 188 PRO 188 340 340 PRO PRO A . n A 1 189 GLY 189 341 341 GLY GLY A . n A 1 190 VAL 190 342 342 VAL VAL A . n A 1 191 GLN 191 343 343 GLN GLN A . n A 1 192 ASP 192 344 344 ASP ASP A . n A 1 193 ALA 193 345 345 ALA ALA A . n A 1 194 LYS 194 346 346 LYS LYS A . n A 1 195 LEU 195 347 347 LEU LEU A . n A 1 196 VAL 196 348 348 VAL VAL A . n A 1 197 GLU 197 349 349 GLU GLU A . n A 1 198 ALA 198 350 350 ALA ALA A . n A 1 199 ILE 199 351 351 ILE ILE A . n A 1 200 GLN 200 352 352 GLN GLN A . n A 1 201 ASP 201 353 353 ASP ASP A . n A 1 202 ARG 202 354 354 ARG ARG A . n A 1 203 LEU 203 355 355 LEU LEU A . n A 1 204 SER 204 356 356 SER SER A . n A 1 205 ASN 205 357 357 ASN ASN A . n A 1 206 THR 206 358 358 THR THR A . n A 1 207 LEU 207 359 359 LEU LEU A . n A 1 208 GLN 208 360 360 GLN GLN A . n A 1 209 THR 209 361 361 THR THR A . n A 1 210 TYR 210 362 362 TYR TYR A . n A 1 211 ILE 211 363 363 ILE ILE A . n A 1 212 ARG 212 364 364 ARG ARG A . n A 1 213 CYS 213 365 365 CYS CYS A . n A 1 214 ARG 214 366 366 ARG ARG A . n A 1 215 HIS 215 367 367 HIS HIS A . n A 1 216 PRO 216 368 368 PRO PRO A . n A 1 217 PRO 217 369 369 PRO PRO A . n A 1 218 PRO 218 370 370 PRO PRO A . n A 1 219 GLY 219 371 371 GLY GLY A . n A 1 220 SER 220 372 372 SER SER A . n A 1 221 HIS 221 373 373 HIS HIS A . n A 1 222 GLN 222 374 374 GLN GLN A . n A 1 223 LEU 223 375 375 LEU LEU A . n A 1 224 TYR 224 376 376 TYR TYR A . n A 1 225 ALA 225 377 377 ALA ALA A . n A 1 226 LYS 226 378 378 LYS LYS A . n A 1 227 MET 227 379 379 MET MET A . n A 1 228 ILE 228 380 380 ILE ILE A . n A 1 229 GLN 229 381 381 GLN GLN A . n A 1 230 LYS 230 382 382 LYS LYS A . n A 1 231 LEU 231 383 383 LEU LEU A . n A 1 232 ALA 232 384 384 ALA ALA A . n A 1 233 ASP 233 385 385 ASP ASP A . n A 1 234 LEU 234 386 386 LEU LEU A . n A 1 235 ARG 235 387 387 ARG ARG A . n A 1 236 SER 236 388 388 SER SER A . n A 1 237 LEU 237 389 389 LEU LEU A . n A 1 238 ASN 238 390 390 ASN ASN A . n A 1 239 GLU 239 391 391 GLU GLU A . n A 1 240 GLU 240 392 392 GLU GLU A . n A 1 241 HIS 241 393 393 HIS HIS A . n A 1 242 SER 242 394 394 SER SER A . n A 1 243 LYS 243 395 395 LYS LYS A . n A 1 244 GLN 244 396 396 GLN GLN A . n A 1 245 TYR 245 397 397 TYR TYR A . n A 1 246 ARG 246 398 398 ARG ARG A . n A 1 247 SER 247 399 399 SER SER A . n A 1 248 LEU 248 400 400 LEU LEU A . n A 1 249 SER 249 401 401 SER SER A . n A 1 250 PHE 250 402 402 PHE PHE A . n A 1 251 GLN 251 403 403 GLN GLN A . n A 1 252 PRO 252 404 404 PRO PRO A . n A 1 253 GLU 253 405 405 GLU GLU A . n A 1 254 ASN 254 406 406 ASN ASN A . n A 1 255 SER 255 407 407 SER SER A . n A 1 256 MET 256 408 408 MET MET A . n A 1 257 LYS 257 409 409 LYS LYS A . n A 1 258 LEU 258 410 410 LEU LEU A . n A 1 259 THR 259 411 411 THR THR A . n A 1 260 PRO 260 412 412 PRO PRO A . n A 1 261 LEU 261 413 413 LEU LEU A . n A 1 262 VAL 262 414 414 VAL VAL A . n A 1 263 LEU 263 415 415 LEU LEU A . n A 1 264 GLU 264 416 416 GLU GLU A . n A 1 265 VAL 265 417 417 VAL VAL A . n A 1 266 PHE 266 418 418 PHE PHE A . n A 1 267 GLY 267 419 419 GLY GLY A . n A 1 268 ASN 268 420 420 ASN ASN A . n A 1 269 GLU 269 421 ? ? ? A . n A 1 270 ILE 270 422 ? ? ? A . n A 1 271 SER 271 423 ? ? ? A . n B 2 1 LYS 1 625 ? ? ? C . n B 2 2 ASN 2 626 626 ASN ASN C . n B 2 3 HIS 3 627 627 HIS HIS C . n B 2 4 PRO 4 628 628 PRO PRO C . n B 2 5 MET 5 629 629 MET MET C . n B 2 6 LEU 6 630 630 LEU LEU C . n B 2 7 MET 7 631 631 MET MET C . n B 2 8 ASN 8 632 632 ASN ASN C . n B 2 9 LEU 9 633 633 LEU LEU C . n B 2 10 LEU 10 634 634 LEU LEU C . n B 2 11 LYS 11 635 635 LYS LYS C . n B 2 12 ASP 12 636 ? ? ? C . n B 2 13 ASN 13 637 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 FKF 1 501 1 FKF HS3 A . D 4 FMT 1 502 1 FMT FMT A . E 5 HOH 1 601 5 HOH HOH A . E 5 HOH 2 602 14 HOH HOH A . E 5 HOH 3 603 15 HOH HOH A . E 5 HOH 4 604 9 HOH HOH A . E 5 HOH 5 605 2 HOH HOH A . E 5 HOH 6 606 13 HOH HOH A . E 5 HOH 7 607 8 HOH HOH A . E 5 HOH 8 608 6 HOH HOH A . E 5 HOH 9 609 1 HOH HOH A . E 5 HOH 10 610 4 HOH HOH A . E 5 HOH 11 611 11 HOH HOH A . E 5 HOH 12 612 7 HOH HOH A . E 5 HOH 13 613 3 HOH HOH A . E 5 HOH 14 614 10 HOH HOH A . E 5 HOH 15 615 12 HOH HOH A . E 5 HOH 16 616 16 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1180 ? 1 MORE -10 ? 1 'SSA (A^2)' 11600 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-20 2 'Structure model' 1 1 2021-01-27 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_type 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_atom_type.pdbx_N_electrons' 7 3 'Structure model' '_atom_type.pdbx_scat_Z' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.5 4 # _pdbx_entry_details.entry_id 7C7W _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 279 ? ? -150.62 23.69 2 1 TYR A 289 ? ? -106.60 47.36 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 106 ? A GLY 1 2 1 Y 1 A SER 107 ? A SER 2 3 1 Y 1 A HIS 108 ? A HIS 3 4 1 Y 1 A MET 109 ? A MET 4 5 1 Y 1 A GLY 110 ? A GLY 5 6 1 Y 1 A SER 111 ? A SER 6 7 1 Y 1 A PRO 112 ? A PRO 7 8 1 Y 1 A ASN 113 ? A ASN 8 9 1 Y 1 A SER 114 ? A SER 9 10 1 Y 1 A PRO 115 ? A PRO 10 11 1 Y 1 A LEU 116 ? A LEU 11 12 1 Y 1 A LYS 117 ? A LYS 12 13 1 Y 1 A ASP 118 ? A ASP 13 14 1 Y 1 A SER 119 ? A SER 14 15 1 Y 1 A LEU 120 ? A LEU 15 16 1 Y 1 A ARG 121 ? A ARG 16 17 1 Y 1 A PRO 122 ? A PRO 17 18 1 Y 1 A THR 146 ? A THR 41 19 1 Y 1 A TYR 147 ? A TYR 42 20 1 Y 1 A ALA 148 ? A ALA 43 21 1 Y 1 A ASP 149 ? A ASP 44 22 1 Y 1 A PHE 150 ? A PHE 45 23 1 Y 1 A ARG 151 ? A ARG 46 24 1 Y 1 A ARG 205 ? A ARG 53 25 1 Y 1 A MET 206 ? A MET 54 26 1 Y 1 A ASP 207 ? A ASP 55 27 1 Y 1 A GLY 208 ? A GLY 56 28 1 Y 1 A SER 209 ? A SER 57 29 1 Y 1 A THR 210 ? A THR 58 30 1 Y 1 A GLY 211 ? A GLY 59 31 1 Y 1 A SER 212 ? A SER 60 32 1 Y 1 A VAL 213 ? A VAL 61 33 1 Y 1 A THR 214 ? A THR 62 34 1 Y 1 A LEU 215 ? A LEU 63 35 1 Y 1 A ASP 216 ? A ASP 64 36 1 Y 1 A LEU 217 ? A LEU 65 37 1 Y 1 A SER 218 ? A SER 66 38 1 Y 1 A GLU 421 ? A GLU 269 39 1 Y 1 A ILE 422 ? A ILE 270 40 1 Y 1 A SER 423 ? A SER 271 41 1 Y 1 C LYS 625 ? B LYS 1 42 1 Y 1 C ASP 636 ? B ASP 12 43 1 Y 1 C ASN 637 ? B ASN 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FKF C8 C N R 88 FKF C9 C N S 89 FKF C7 C N N 90 FKF O4 O N N 91 FKF C3 C N S 92 FKF C6 C N N 93 FKF C5 C N R 94 FKF C4 C N N 95 FKF C2 C N N 96 FKF C1 C N N 97 FKF C10 C N S 98 FKF O4A O N N 99 FKF C24 C N N 100 FKF C23 C N N 101 FKF C22 C N N 102 FKF C20 C N R 103 FKF C21 C N N 104 FKF C17 C N R 105 FKF C13 C N R 106 FKF C18 C N N 107 FKF C12 C N N 108 FKF C16 C N N 109 FKF C15 C N N 110 FKF C14 C N S 111 FKF C11 C N N 112 FKF C19 C N N 113 FKF C29 C N N 114 FKF C25 C N N 115 FKF C26 C N N 116 FKF C27 C N N 117 FKF O28 O N N 118 FKF H8 H N N 119 FKF H9 H N N 120 FKF H7 H N N 121 FKF H7A H N N 122 FKF H3 H N N 123 FKF H6 H N N 124 FKF H6A H N N 125 FKF H5 H N N 126 FKF H4A H N N 127 FKF H4 H N N 128 FKF H2 H N N 129 FKF H2A H N N 130 FKF H1 H N N 131 FKF H1A H N N 132 FKF H10 H N N 133 FKF H23 H N N 134 FKF H23A H N N 135 FKF H22 H N N 136 FKF H22A H N N 137 FKF H20 H N N 138 FKF H21 H N N 139 FKF H21B H N N 140 FKF H21A H N N 141 FKF H17 H N N 142 FKF H18 H N N 143 FKF H18B H N N 144 FKF H18A H N N 145 FKF H12 H N N 146 FKF H12A H N N 147 FKF H16 H N N 148 FKF H16A H N N 149 FKF H15 H N N 150 FKF H15A H N N 151 FKF H14 H N N 152 FKF H11A H N N 153 FKF H11 H N N 154 FKF H19A H N N 155 FKF H19 H N N 156 FKF H19B H N N 157 FKF HO1B H N N 158 FKF H31 H N N 159 FKF H262 H N N 160 FKF H26 H N N 161 FKF H261 H N N 162 FKF H272 H N N 163 FKF H27 H N N 164 FKF H271 H N N 165 FKF H30 H N N 166 FMT C C N N 167 FMT O1 O N N 168 FMT O2 O N N 169 FMT H H N N 170 FMT HO2 H N N 171 GLN N N N N 172 GLN CA C N S 173 GLN C C N N 174 GLN O O N N 175 GLN CB C N N 176 GLN CG C N N 177 GLN CD C N N 178 GLN OE1 O N N 179 GLN NE2 N N N 180 GLN OXT O N N 181 GLN H H N N 182 GLN H2 H N N 183 GLN HA H N N 184 GLN HB2 H N N 185 GLN HB3 H N N 186 GLN HG2 H N N 187 GLN HG3 H N N 188 GLN HE21 H N N 189 GLN HE22 H N N 190 GLN HXT H N N 191 GLU N N N N 192 GLU CA C N S 193 GLU C C N N 194 GLU O O N N 195 GLU CB C N N 196 GLU CG C N N 197 GLU CD C N N 198 GLU OE1 O N N 199 GLU OE2 O N N 200 GLU OXT O N N 201 GLU H H N N 202 GLU H2 H N N 203 GLU HA H N N 204 GLU HB2 H N N 205 GLU HB3 H N N 206 GLU HG2 H N N 207 GLU HG3 H N N 208 GLU HE2 H N N 209 GLU HXT H N N 210 GLY N N N N 211 GLY CA C N N 212 GLY C C N N 213 GLY O O N N 214 GLY OXT O N N 215 GLY H H N N 216 GLY H2 H N N 217 GLY HA2 H N N 218 GLY HA3 H N N 219 GLY HXT H N N 220 HIS N N N N 221 HIS CA C N S 222 HIS C C N N 223 HIS O O N N 224 HIS CB C N N 225 HIS CG C Y N 226 HIS ND1 N Y N 227 HIS CD2 C Y N 228 HIS CE1 C Y N 229 HIS NE2 N Y N 230 HIS OXT O N N 231 HIS H H N N 232 HIS H2 H N N 233 HIS HA H N N 234 HIS HB2 H N N 235 HIS HB3 H N N 236 HIS HD1 H N N 237 HIS HD2 H N N 238 HIS HE1 H N N 239 HIS HE2 H N N 240 HIS HXT H N N 241 HOH O O N N 242 HOH H1 H N N 243 HOH H2 H N N 244 ILE N N N N 245 ILE CA C N S 246 ILE C C N N 247 ILE O O N N 248 ILE CB C N S 249 ILE CG1 C N N 250 ILE CG2 C N N 251 ILE CD1 C N N 252 ILE OXT O N N 253 ILE H H N N 254 ILE H2 H N N 255 ILE HA H N N 256 ILE HB H N N 257 ILE HG12 H N N 258 ILE HG13 H N N 259 ILE HG21 H N N 260 ILE HG22 H N N 261 ILE HG23 H N N 262 ILE HD11 H N N 263 ILE HD12 H N N 264 ILE HD13 H N N 265 ILE HXT H N N 266 LEU N N N N 267 LEU CA C N S 268 LEU C C N N 269 LEU O O N N 270 LEU CB C N N 271 LEU CG C N N 272 LEU CD1 C N N 273 LEU CD2 C N N 274 LEU OXT O N N 275 LEU H H N N 276 LEU H2 H N N 277 LEU HA H N N 278 LEU HB2 H N N 279 LEU HB3 H N N 280 LEU HG H N N 281 LEU HD11 H N N 282 LEU HD12 H N N 283 LEU HD13 H N N 284 LEU HD21 H N N 285 LEU HD22 H N N 286 LEU HD23 H N N 287 LEU HXT H N N 288 LYS N N N N 289 LYS CA C N S 290 LYS C C N N 291 LYS O O N N 292 LYS CB C N N 293 LYS CG C N N 294 LYS CD C N N 295 LYS CE C N N 296 LYS NZ N N N 297 LYS OXT O N N 298 LYS H H N N 299 LYS H2 H N N 300 LYS HA H N N 301 LYS HB2 H N N 302 LYS HB3 H N N 303 LYS HG2 H N N 304 LYS HG3 H N N 305 LYS HD2 H N N 306 LYS HD3 H N N 307 LYS HE2 H N N 308 LYS HE3 H N N 309 LYS HZ1 H N N 310 LYS HZ2 H N N 311 LYS HZ3 H N N 312 LYS HXT H N N 313 MET N N N N 314 MET CA C N S 315 MET C C N N 316 MET O O N N 317 MET CB C N N 318 MET CG C N N 319 MET SD S N N 320 MET CE C N N 321 MET OXT O N N 322 MET H H N N 323 MET H2 H N N 324 MET HA H N N 325 MET HB2 H N N 326 MET HB3 H N N 327 MET HG2 H N N 328 MET HG3 H N N 329 MET HE1 H N N 330 MET HE2 H N N 331 MET HE3 H N N 332 MET HXT H N N 333 PHE N N N N 334 PHE CA C N S 335 PHE C C N N 336 PHE O O N N 337 PHE CB C N N 338 PHE CG C Y N 339 PHE CD1 C Y N 340 PHE CD2 C Y N 341 PHE CE1 C Y N 342 PHE CE2 C Y N 343 PHE CZ C Y N 344 PHE OXT O N N 345 PHE H H N N 346 PHE H2 H N N 347 PHE HA H N N 348 PHE HB2 H N N 349 PHE HB3 H N N 350 PHE HD1 H N N 351 PHE HD2 H N N 352 PHE HE1 H N N 353 PHE HE2 H N N 354 PHE HZ H N N 355 PHE HXT H N N 356 PRO N N N N 357 PRO CA C N S 358 PRO C C N N 359 PRO O O N N 360 PRO CB C N N 361 PRO CG C N N 362 PRO CD C N N 363 PRO OXT O N N 364 PRO H H N N 365 PRO HA H N N 366 PRO HB2 H N N 367 PRO HB3 H N N 368 PRO HG2 H N N 369 PRO HG3 H N N 370 PRO HD2 H N N 371 PRO HD3 H N N 372 PRO HXT H N N 373 SER N N N N 374 SER CA C N S 375 SER C C N N 376 SER O O N N 377 SER CB C N N 378 SER OG O N N 379 SER OXT O N N 380 SER H H N N 381 SER H2 H N N 382 SER HA H N N 383 SER HB2 H N N 384 SER HB3 H N N 385 SER HG H N N 386 SER HXT H N N 387 THR N N N N 388 THR CA C N S 389 THR C C N N 390 THR O O N N 391 THR CB C N R 392 THR OG1 O N N 393 THR CG2 C N N 394 THR OXT O N N 395 THR H H N N 396 THR H2 H N N 397 THR HA H N N 398 THR HB H N N 399 THR HG1 H N N 400 THR HG21 H N N 401 THR HG22 H N N 402 THR HG23 H N N 403 THR HXT H N N 404 TRP N N N N 405 TRP CA C N S 406 TRP C C N N 407 TRP O O N N 408 TRP CB C N N 409 TRP CG C Y N 410 TRP CD1 C Y N 411 TRP CD2 C Y N 412 TRP NE1 N Y N 413 TRP CE2 C Y N 414 TRP CE3 C Y N 415 TRP CZ2 C Y N 416 TRP CZ3 C Y N 417 TRP CH2 C Y N 418 TRP OXT O N N 419 TRP H H N N 420 TRP H2 H N N 421 TRP HA H N N 422 TRP HB2 H N N 423 TRP HB3 H N N 424 TRP HD1 H N N 425 TRP HE1 H N N 426 TRP HE3 H N N 427 TRP HZ2 H N N 428 TRP HZ3 H N N 429 TRP HH2 H N N 430 TRP HXT H N N 431 TYR N N N N 432 TYR CA C N S 433 TYR C C N N 434 TYR O O N N 435 TYR CB C N N 436 TYR CG C Y N 437 TYR CD1 C Y N 438 TYR CD2 C Y N 439 TYR CE1 C Y N 440 TYR CE2 C Y N 441 TYR CZ C Y N 442 TYR OH O N N 443 TYR OXT O N N 444 TYR H H N N 445 TYR H2 H N N 446 TYR HA H N N 447 TYR HB2 H N N 448 TYR HB3 H N N 449 TYR HD1 H N N 450 TYR HD2 H N N 451 TYR HE1 H N N 452 TYR HE2 H N N 453 TYR HH H N N 454 TYR HXT H N N 455 VAL N N N N 456 VAL CA C N S 457 VAL C C N N 458 VAL O O N N 459 VAL CB C N N 460 VAL CG1 C N N 461 VAL CG2 C N N 462 VAL OXT O N N 463 VAL H H N N 464 VAL H2 H N N 465 VAL HA H N N 466 VAL HB H N N 467 VAL HG11 H N N 468 VAL HG12 H N N 469 VAL HG13 H N N 470 VAL HG21 H N N 471 VAL HG22 H N N 472 VAL HG23 H N N 473 VAL HXT H N N 474 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FKF O4 C24 doub N N 83 FKF O4A C24 sing N N 84 FKF C24 C23 sing N N 85 FKF C23 C22 sing N N 86 FKF C22 C20 sing N N 87 FKF C16 C17 sing N N 88 FKF C16 C15 sing N N 89 FKF C20 C17 sing N N 90 FKF C20 C21 sing N N 91 FKF C17 C13 sing N N 92 FKF C15 C14 sing N N 93 FKF C14 C13 sing N N 94 FKF C14 C8 sing N N 95 FKF C13 C12 sing N N 96 FKF C13 C18 sing N N 97 FKF C12 C11 sing N N 98 FKF C27 C25 sing N N 99 FKF C7 C8 sing N N 100 FKF C7 C6 sing N N 101 FKF C8 C9 sing N N 102 FKF C4 C3 sing N N 103 FKF C4 C5 sing N N 104 FKF C3 C2 sing N N 105 FKF C3 C29 sing N N 106 FKF C9 C11 sing N N 107 FKF C9 C10 sing N N 108 FKF C2 C1 sing N N 109 FKF C6 C5 sing N N 110 FKF C25 C29 sing N N 111 FKF C25 O28 sing N N 112 FKF C25 C26 sing N N 113 FKF C5 C10 sing N N 114 FKF C10 C1 sing N N 115 FKF C10 C19 sing N N 116 FKF C8 H8 sing N N 117 FKF C9 H9 sing N N 118 FKF C7 H7 sing N N 119 FKF C7 H7A sing N N 120 FKF C3 H3 sing N N 121 FKF C6 H6 sing N N 122 FKF C6 H6A sing N N 123 FKF C5 H5 sing N N 124 FKF C4 H4A sing N N 125 FKF C4 H4 sing N N 126 FKF C2 H2 sing N N 127 FKF C2 H2A sing N N 128 FKF C1 H1 sing N N 129 FKF C1 H1A sing N N 130 FKF O4A H10 sing N N 131 FKF C23 H23 sing N N 132 FKF C23 H23A sing N N 133 FKF C22 H22 sing N N 134 FKF C22 H22A sing N N 135 FKF C20 H20 sing N N 136 FKF C21 H21 sing N N 137 FKF C21 H21B sing N N 138 FKF C21 H21A sing N N 139 FKF C17 H17 sing N N 140 FKF C18 H18 sing N N 141 FKF C18 H18B sing N N 142 FKF C18 H18A sing N N 143 FKF C12 H12 sing N N 144 FKF C12 H12A sing N N 145 FKF C16 H16 sing N N 146 FKF C16 H16A sing N N 147 FKF C15 H15 sing N N 148 FKF C15 H15A sing N N 149 FKF C14 H14 sing N N 150 FKF C11 H11A sing N N 151 FKF C11 H11 sing N N 152 FKF C19 H19A sing N N 153 FKF C19 H19 sing N N 154 FKF C19 H19B sing N N 155 FKF C29 HO1B sing N N 156 FKF C29 H31 sing N N 157 FKF C26 H262 sing N N 158 FKF C26 H26 sing N N 159 FKF C26 H261 sing N N 160 FKF C27 H272 sing N N 161 FKF C27 H27 sing N N 162 FKF C27 H271 sing N N 163 FKF O28 H30 sing N N 164 FMT C O1 doub N N 165 FMT C O2 sing N N 166 FMT C H sing N N 167 FMT O2 HO2 sing N N 168 GLN N CA sing N N 169 GLN N H sing N N 170 GLN N H2 sing N N 171 GLN CA C sing N N 172 GLN CA CB sing N N 173 GLN CA HA sing N N 174 GLN C O doub N N 175 GLN C OXT sing N N 176 GLN CB CG sing N N 177 GLN CB HB2 sing N N 178 GLN CB HB3 sing N N 179 GLN CG CD sing N N 180 GLN CG HG2 sing N N 181 GLN CG HG3 sing N N 182 GLN CD OE1 doub N N 183 GLN CD NE2 sing N N 184 GLN NE2 HE21 sing N N 185 GLN NE2 HE22 sing N N 186 GLN OXT HXT sing N N 187 GLU N CA sing N N 188 GLU N H sing N N 189 GLU N H2 sing N N 190 GLU CA C sing N N 191 GLU CA CB sing N N 192 GLU CA HA sing N N 193 GLU C O doub N N 194 GLU C OXT sing N N 195 GLU CB CG sing N N 196 GLU CB HB2 sing N N 197 GLU CB HB3 sing N N 198 GLU CG CD sing N N 199 GLU CG HG2 sing N N 200 GLU CG HG3 sing N N 201 GLU CD OE1 doub N N 202 GLU CD OE2 sing N N 203 GLU OE2 HE2 sing N N 204 GLU OXT HXT sing N N 205 GLY N CA sing N N 206 GLY N H sing N N 207 GLY N H2 sing N N 208 GLY CA C sing N N 209 GLY CA HA2 sing N N 210 GLY CA HA3 sing N N 211 GLY C O doub N N 212 GLY C OXT sing N N 213 GLY OXT HXT sing N N 214 HIS N CA sing N N 215 HIS N H sing N N 216 HIS N H2 sing N N 217 HIS CA C sing N N 218 HIS CA CB sing N N 219 HIS CA HA sing N N 220 HIS C O doub N N 221 HIS C OXT sing N N 222 HIS CB CG sing N N 223 HIS CB HB2 sing N N 224 HIS CB HB3 sing N N 225 HIS CG ND1 sing Y N 226 HIS CG CD2 doub Y N 227 HIS ND1 CE1 doub Y N 228 HIS ND1 HD1 sing N N 229 HIS CD2 NE2 sing Y N 230 HIS CD2 HD2 sing N N 231 HIS CE1 NE2 sing Y N 232 HIS CE1 HE1 sing N N 233 HIS NE2 HE2 sing N N 234 HIS OXT HXT sing N N 235 HOH O H1 sing N N 236 HOH O H2 sing N N 237 ILE N CA sing N N 238 ILE N H sing N N 239 ILE N H2 sing N N 240 ILE CA C sing N N 241 ILE CA CB sing N N 242 ILE CA HA sing N N 243 ILE C O doub N N 244 ILE C OXT sing N N 245 ILE CB CG1 sing N N 246 ILE CB CG2 sing N N 247 ILE CB HB sing N N 248 ILE CG1 CD1 sing N N 249 ILE CG1 HG12 sing N N 250 ILE CG1 HG13 sing N N 251 ILE CG2 HG21 sing N N 252 ILE CG2 HG22 sing N N 253 ILE CG2 HG23 sing N N 254 ILE CD1 HD11 sing N N 255 ILE CD1 HD12 sing N N 256 ILE CD1 HD13 sing N N 257 ILE OXT HXT sing N N 258 LEU N CA sing N N 259 LEU N H sing N N 260 LEU N H2 sing N N 261 LEU CA C sing N N 262 LEU CA CB sing N N 263 LEU CA HA sing N N 264 LEU C O doub N N 265 LEU C OXT sing N N 266 LEU CB CG sing N N 267 LEU CB HB2 sing N N 268 LEU CB HB3 sing N N 269 LEU CG CD1 sing N N 270 LEU CG CD2 sing N N 271 LEU CG HG sing N N 272 LEU CD1 HD11 sing N N 273 LEU CD1 HD12 sing N N 274 LEU CD1 HD13 sing N N 275 LEU CD2 HD21 sing N N 276 LEU CD2 HD22 sing N N 277 LEU CD2 HD23 sing N N 278 LEU OXT HXT sing N N 279 LYS N CA sing N N 280 LYS N H sing N N 281 LYS N H2 sing N N 282 LYS CA C sing N N 283 LYS CA CB sing N N 284 LYS CA HA sing N N 285 LYS C O doub N N 286 LYS C OXT sing N N 287 LYS CB CG sing N N 288 LYS CB HB2 sing N N 289 LYS CB HB3 sing N N 290 LYS CG CD sing N N 291 LYS CG HG2 sing N N 292 LYS CG HG3 sing N N 293 LYS CD CE sing N N 294 LYS CD HD2 sing N N 295 LYS CD HD3 sing N N 296 LYS CE NZ sing N N 297 LYS CE HE2 sing N N 298 LYS CE HE3 sing N N 299 LYS NZ HZ1 sing N N 300 LYS NZ HZ2 sing N N 301 LYS NZ HZ3 sing N N 302 LYS OXT HXT sing N N 303 MET N CA sing N N 304 MET N H sing N N 305 MET N H2 sing N N 306 MET CA C sing N N 307 MET CA CB sing N N 308 MET CA HA sing N N 309 MET C O doub N N 310 MET C OXT sing N N 311 MET CB CG sing N N 312 MET CB HB2 sing N N 313 MET CB HB3 sing N N 314 MET CG SD sing N N 315 MET CG HG2 sing N N 316 MET CG HG3 sing N N 317 MET SD CE sing N N 318 MET CE HE1 sing N N 319 MET CE HE2 sing N N 320 MET CE HE3 sing N N 321 MET OXT HXT sing N N 322 PHE N CA sing N N 323 PHE N H sing N N 324 PHE N H2 sing N N 325 PHE CA C sing N N 326 PHE CA CB sing N N 327 PHE CA HA sing N N 328 PHE C O doub N N 329 PHE C OXT sing N N 330 PHE CB CG sing N N 331 PHE CB HB2 sing N N 332 PHE CB HB3 sing N N 333 PHE CG CD1 doub Y N 334 PHE CG CD2 sing Y N 335 PHE CD1 CE1 sing Y N 336 PHE CD1 HD1 sing N N 337 PHE CD2 CE2 doub Y N 338 PHE CD2 HD2 sing N N 339 PHE CE1 CZ doub Y N 340 PHE CE1 HE1 sing N N 341 PHE CE2 CZ sing Y N 342 PHE CE2 HE2 sing N N 343 PHE CZ HZ sing N N 344 PHE OXT HXT sing N N 345 PRO N CA sing N N 346 PRO N CD sing N N 347 PRO N H sing N N 348 PRO CA C sing N N 349 PRO CA CB sing N N 350 PRO CA HA sing N N 351 PRO C O doub N N 352 PRO C OXT sing N N 353 PRO CB CG sing N N 354 PRO CB HB2 sing N N 355 PRO CB HB3 sing N N 356 PRO CG CD sing N N 357 PRO CG HG2 sing N N 358 PRO CG HG3 sing N N 359 PRO CD HD2 sing N N 360 PRO CD HD3 sing N N 361 PRO OXT HXT sing N N 362 SER N CA sing N N 363 SER N H sing N N 364 SER N H2 sing N N 365 SER CA C sing N N 366 SER CA CB sing N N 367 SER CA HA sing N N 368 SER C O doub N N 369 SER C OXT sing N N 370 SER CB OG sing N N 371 SER CB HB2 sing N N 372 SER CB HB3 sing N N 373 SER OG HG sing N N 374 SER OXT HXT sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TRP N CA sing N N 392 TRP N H sing N N 393 TRP N H2 sing N N 394 TRP CA C sing N N 395 TRP CA CB sing N N 396 TRP CA HA sing N N 397 TRP C O doub N N 398 TRP C OXT sing N N 399 TRP CB CG sing N N 400 TRP CB HB2 sing N N 401 TRP CB HB3 sing N N 402 TRP CG CD1 doub Y N 403 TRP CG CD2 sing Y N 404 TRP CD1 NE1 sing Y N 405 TRP CD1 HD1 sing N N 406 TRP CD2 CE2 doub Y N 407 TRP CD2 CE3 sing Y N 408 TRP NE1 CE2 sing Y N 409 TRP NE1 HE1 sing N N 410 TRP CE2 CZ2 sing Y N 411 TRP CE3 CZ3 doub Y N 412 TRP CE3 HE3 sing N N 413 TRP CZ2 CH2 doub Y N 414 TRP CZ2 HZ2 sing N N 415 TRP CZ3 CH2 sing Y N 416 TRP CZ3 HZ3 sing N N 417 TRP CH2 HH2 sing N N 418 TRP OXT HXT sing N N 419 TYR N CA sing N N 420 TYR N H sing N N 421 TYR N H2 sing N N 422 TYR CA C sing N N 423 TYR CA CB sing N N 424 TYR CA HA sing N N 425 TYR C O doub N N 426 TYR C OXT sing N N 427 TYR CB CG sing N N 428 TYR CB HB2 sing N N 429 TYR CB HB3 sing N N 430 TYR CG CD1 doub Y N 431 TYR CG CD2 sing Y N 432 TYR CD1 CE1 sing Y N 433 TYR CD1 HD1 sing N N 434 TYR CD2 CE2 doub Y N 435 TYR CD2 HD2 sing N N 436 TYR CE1 CZ doub Y N 437 TYR CE1 HE1 sing N N 438 TYR CE2 CZ sing Y N 439 TYR CE2 HE2 sing N N 440 TYR CZ OH sing N N 441 TYR OH HH sing N N 442 TYR OXT HXT sing N N 443 VAL N CA sing N N 444 VAL N H sing N N 445 VAL N H2 sing N N 446 VAL CA C sing N N 447 VAL CA CB sing N N 448 VAL CA HA sing N N 449 VAL C O doub N N 450 VAL C OXT sing N N 451 VAL CB CG1 sing N N 452 VAL CB CG2 sing N N 453 VAL CB HB sing N N 454 VAL CG1 HG11 sing N N 455 VAL CG1 HG12 sing N N 456 VAL CG1 HG13 sing N N 457 VAL CG2 HG21 sing N N 458 VAL CG2 HG22 sing N N 459 VAL CG2 HG23 sing N N 460 VAL OXT HXT sing N N 461 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FKF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FKF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ;(4R)-4-[(3S,5R,8R,9S,10S,13R,14S,17R)-10,13-dimethyl-3-(2-methyl-2-oxidanyl-propyl)-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoic acid ; FKF 4 'FORMIC ACID' FMT 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2ZLC _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #