data_7CCH # _entry.id 7CCH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CCH pdb_00007cch 10.2210/pdb7cch/pdb WWPDB D_1300017382 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CCH _pdbx_database_status.recvd_initial_deposition_date 2020-06-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wen, Y.' 1 ? 'Felix, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iscience _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2589-0042 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first 102476 _citation.page_last 102476 _citation.title 'Proteolysis and multimerization regulate signaling along the two-component regulatory system AdeRS.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.isci.2021.102476 _citation.pdbx_database_id_PubMed 34113820 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ouyang, Z.' 1 ? primary 'Zheng, F.' 2 ? primary 'Zhu, L.' 3 ? primary 'Felix, J.' 4 ? primary 'Wu, D.' 5 ? primary 'Wu, K.' 6 ? primary 'Gutsche, I.' 7 ? primary 'Wu, Y.' 8 ? primary 'Hwang, P.M.' 9 ? primary 'She, J.' 10 ? primary 'Wen, Y.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7CCH _cell.details ? _cell.formula_units_Z ? _cell.length_a 141.052 _cell.length_a_esd ? _cell.length_b 141.052 _cell.length_b_esd ? _cell.length_c 50.826 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CCH _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description AdeS _entity.formula_weight 25908.738 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHKNAQVWNAAIAHELRTPITILQGRLQGIIDGVFKPDEVLFKSLLNQVEVLSHLVEDLRTLSLVENQQLRLNY ELFDFKAVVEKVLKAFEDRLDQAKLVPELDLTSTPVYCDRRRIEQVLIALIDNAIRYSHAGKLKISSEVVSQNWILKIED EGPGIATEFQDDLFKPFFRLEESRNKEFGGTGLGLAVVHAIIVALKGTIQYSNQGSKSIFTIKISMNN ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHKNAQVWNAAIAHELRTPITILQGRLQGIIDGVFKPDEVLFKSLLNQVEVLSHLVEDLRTLSLVENQQLRLNY ELFDFKAVVEKVLKAFEDRLDQAKLVPELDLTSTPVYCDRRRIEQVLIALIDNAIRYSHAGKLKISSEVVSQNWILKIED EGPGIATEFQDDLFKPFFRLEESRNKEFGGTGLGLAVVHAIIVALKGTIQYSNQGSKSIFTIKISMNN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 LYS n 1 10 ASN n 1 11 ALA n 1 12 GLN n 1 13 VAL n 1 14 TRP n 1 15 ASN n 1 16 ALA n 1 17 ALA n 1 18 ILE n 1 19 ALA n 1 20 HIS n 1 21 GLU n 1 22 LEU n 1 23 ARG n 1 24 THR n 1 25 PRO n 1 26 ILE n 1 27 THR n 1 28 ILE n 1 29 LEU n 1 30 GLN n 1 31 GLY n 1 32 ARG n 1 33 LEU n 1 34 GLN n 1 35 GLY n 1 36 ILE n 1 37 ILE n 1 38 ASP n 1 39 GLY n 1 40 VAL n 1 41 PHE n 1 42 LYS n 1 43 PRO n 1 44 ASP n 1 45 GLU n 1 46 VAL n 1 47 LEU n 1 48 PHE n 1 49 LYS n 1 50 SER n 1 51 LEU n 1 52 LEU n 1 53 ASN n 1 54 GLN n 1 55 VAL n 1 56 GLU n 1 57 VAL n 1 58 LEU n 1 59 SER n 1 60 HIS n 1 61 LEU n 1 62 VAL n 1 63 GLU n 1 64 ASP n 1 65 LEU n 1 66 ARG n 1 67 THR n 1 68 LEU n 1 69 SER n 1 70 LEU n 1 71 VAL n 1 72 GLU n 1 73 ASN n 1 74 GLN n 1 75 GLN n 1 76 LEU n 1 77 ARG n 1 78 LEU n 1 79 ASN n 1 80 TYR n 1 81 GLU n 1 82 LEU n 1 83 PHE n 1 84 ASP n 1 85 PHE n 1 86 LYS n 1 87 ALA n 1 88 VAL n 1 89 VAL n 1 90 GLU n 1 91 LYS n 1 92 VAL n 1 93 LEU n 1 94 LYS n 1 95 ALA n 1 96 PHE n 1 97 GLU n 1 98 ASP n 1 99 ARG n 1 100 LEU n 1 101 ASP n 1 102 GLN n 1 103 ALA n 1 104 LYS n 1 105 LEU n 1 106 VAL n 1 107 PRO n 1 108 GLU n 1 109 LEU n 1 110 ASP n 1 111 LEU n 1 112 THR n 1 113 SER n 1 114 THR n 1 115 PRO n 1 116 VAL n 1 117 TYR n 1 118 CYS n 1 119 ASP n 1 120 ARG n 1 121 ARG n 1 122 ARG n 1 123 ILE n 1 124 GLU n 1 125 GLN n 1 126 VAL n 1 127 LEU n 1 128 ILE n 1 129 ALA n 1 130 LEU n 1 131 ILE n 1 132 ASP n 1 133 ASN n 1 134 ALA n 1 135 ILE n 1 136 ARG n 1 137 TYR n 1 138 SER n 1 139 HIS n 1 140 ALA n 1 141 GLY n 1 142 LYS n 1 143 LEU n 1 144 LYS n 1 145 ILE n 1 146 SER n 1 147 SER n 1 148 GLU n 1 149 VAL n 1 150 VAL n 1 151 SER n 1 152 GLN n 1 153 ASN n 1 154 TRP n 1 155 ILE n 1 156 LEU n 1 157 LYS n 1 158 ILE n 1 159 GLU n 1 160 ASP n 1 161 GLU n 1 162 GLY n 1 163 PRO n 1 164 GLY n 1 165 ILE n 1 166 ALA n 1 167 THR n 1 168 GLU n 1 169 PHE n 1 170 GLN n 1 171 ASP n 1 172 ASP n 1 173 LEU n 1 174 PHE n 1 175 LYS n 1 176 PRO n 1 177 PHE n 1 178 PHE n 1 179 ARG n 1 180 LEU n 1 181 GLU n 1 182 GLU n 1 183 SER n 1 184 ARG n 1 185 ASN n 1 186 LYS n 1 187 GLU n 1 188 PHE n 1 189 GLY n 1 190 GLY n 1 191 THR n 1 192 GLY n 1 193 LEU n 1 194 GLY n 1 195 LEU n 1 196 ALA n 1 197 VAL n 1 198 VAL n 1 199 HIS n 1 200 ALA n 1 201 ILE n 1 202 ILE n 1 203 VAL n 1 204 ALA n 1 205 LEU n 1 206 LYS n 1 207 GLY n 1 208 THR n 1 209 ILE n 1 210 GLN n 1 211 TYR n 1 212 SER n 1 213 ASN n 1 214 GLN n 1 215 GLY n 1 216 SER n 1 217 LYS n 1 218 SER n 1 219 ILE n 1 220 PHE n 1 221 THR n 1 222 ILE n 1 223 LYS n 1 224 ILE n 1 225 SER n 1 226 MET n 1 227 ASN n 1 228 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 228 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene adeS _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 470 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E3TGV8_ACIBA _struct_ref.pdbx_db_accession E3TGV8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KNAQVWNAAIAHELRTPITILQGRLQGIIDGVFKPDEVLFKSLLNQVEVLSHLVEDLRTLSLVENQQLRLNYELFDFKAV VEKVLKAFEDRLDQAKLVPELDLTSTPVYCDRRRIEQVLIALIDNAIRYSHAGKLKISSEVVSQNWILKIEDEGPGIATE FQDDLFKPFFRLEESRNKEFGGTGLGLAVVHAIIVALKGTIQYSNQGSKSIFTIKISMNN ; _struct_ref.pdbx_align_begin 138 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CCH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E3TGV8 _struct_ref_seq.db_align_beg 138 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 357 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 138 _struct_ref_seq.pdbx_auth_seq_align_end 357 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7CCH MET A 1 ? UNP E3TGV8 ? ? 'initiating methionine' 130 1 1 7CCH GLY A 2 ? UNP E3TGV8 ? ? 'expression tag' 131 2 1 7CCH HIS A 3 ? UNP E3TGV8 ? ? 'expression tag' 132 3 1 7CCH HIS A 4 ? UNP E3TGV8 ? ? 'expression tag' 133 4 1 7CCH HIS A 5 ? UNP E3TGV8 ? ? 'expression tag' 134 5 1 7CCH HIS A 6 ? UNP E3TGV8 ? ? 'expression tag' 135 6 1 7CCH HIS A 7 ? UNP E3TGV8 ? ? 'expression tag' 136 7 1 7CCH HIS A 8 ? UNP E3TGV8 ? ? 'expression tag' 137 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CCH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.7 M Sodium citrate tribasic dehydrate, 0.1 M BIS-TRIS propane pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7CCH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.848 _reflns.d_resolution_low 40.718 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7192 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.53 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 35.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.071 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 2.95 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 708 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.909 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 191.230 _refine.B_iso_mean 100.0485 _refine.B_iso_min 20.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CCH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8480 _refine.ls_d_res_low 40.7180 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7192 _refine.ls_number_reflns_R_free 720 _refine.ls_number_reflns_R_work 6472 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.5800 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2523 _refine.ls_R_factor_R_free 0.2838 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2489 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5LFK _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.1600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8480 _refine_hist.d_res_low 40.7180 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1526 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 197 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1526 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.848 3.0676 . . 142 1279 100.0000 . . . 0.3792 0.0000 0.3315 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0676 3.3762 . . 143 1290 100.0000 . . . 0.3524 0.0000 0.3140 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3762 3.8644 . . 129 1154 88.0000 . . . 0.3392 0.0000 0.2938 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8644 4.8674 . . 147 1325 100.0000 . . . 0.2542 0.0000 0.2337 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.8674 40.7180 . . 159 1424 100.0000 . . . 0.2630 0.0000 0.2265 . . . . . . . . . . . # _struct.entry_id 7CCH _struct.title 'Acinetobacter baumannii histidine kinase AdeS' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CCH _struct_keywords.text 'Two-Component regulatory system, Acinetobacter baumannii, Histidine Kinase, AdeS, Multidrug resistance, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 19 ? GLU A 21 ? ALA A 148 GLU A 150 5 ? 3 HELX_P HELX_P2 AA2 LEU A 22 ? ASP A 38 ? LEU A 151 ASP A 167 1 ? 17 HELX_P HELX_P3 AA3 ASP A 44 ? ASN A 73 ? ASP A 173 ASN A 202 1 ? 30 HELX_P HELX_P4 AA4 ASP A 84 ? PHE A 96 ? ASP A 213 PHE A 225 1 ? 13 HELX_P HELX_P5 AA5 PHE A 96 ? ALA A 103 ? PHE A 225 ALA A 232 1 ? 8 HELX_P HELX_P6 AA6 ARG A 120 ? SER A 138 ? ARG A 249 SER A 267 1 ? 19 HELX_P HELX_P7 AA7 LEU A 193 ? LEU A 205 ? LEU A 322 LEU A 334 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 17 A . ? ALA 146 A ILE 18 A ? ILE 147 A 1 -7.78 2 ILE 18 A . ? ILE 147 A ALA 19 A ? ALA 148 A 1 -19.68 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 80 ? PHE A 83 ? TYR A 209 PHE A 212 AA1 2 VAL A 116 ? ASP A 119 ? VAL A 245 ASP A 248 AA2 1 LEU A 105 ? LEU A 111 ? LEU A 234 LEU A 240 AA2 2 GLY A 141 ? VAL A 149 ? GLY A 270 VAL A 278 AA2 3 ASN A 153 ? ASP A 160 ? ASN A 282 ASP A 289 AA2 4 SER A 218 ? SER A 225 ? SER A 347 SER A 354 AA2 5 GLY A 207 ? ASN A 213 ? GLY A 336 ASN A 342 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 83 ? N PHE A 212 O VAL A 116 ? O VAL A 245 AA2 1 2 N GLU A 108 ? N GLU A 237 O LEU A 143 ? O LEU A 272 AA2 2 3 N LYS A 144 ? N LYS A 273 O GLU A 159 ? O GLU A 288 AA2 3 4 N TRP A 154 ? N TRP A 283 O ILE A 224 ? O ILE A 353 AA2 4 5 O THR A 221 ? O THR A 350 N GLN A 210 ? N GLN A 339 # _atom_sites.entry_id 7CCH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007090 _atom_sites.fract_transf_matrix[1][2] 0.004093 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008186 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019675 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 130 ? ? ? A . n A 1 2 GLY 2 131 ? ? ? A . n A 1 3 HIS 3 132 ? ? ? A . n A 1 4 HIS 4 133 ? ? ? A . n A 1 5 HIS 5 134 ? ? ? A . n A 1 6 HIS 6 135 ? ? ? A . n A 1 7 HIS 7 136 ? ? ? A . n A 1 8 HIS 8 137 ? ? ? A . n A 1 9 LYS 9 138 ? ? ? A . n A 1 10 ASN 10 139 ? ? ? A . n A 1 11 ALA 11 140 ? ? ? A . n A 1 12 GLN 12 141 ? ? ? A . n A 1 13 VAL 13 142 ? ? ? A . n A 1 14 TRP 14 143 ? ? ? A . n A 1 15 ASN 15 144 ? ? ? A . n A 1 16 ALA 16 145 ? ? ? A . n A 1 17 ALA 17 146 146 ALA ALA A . n A 1 18 ILE 18 147 147 ILE ILE A . n A 1 19 ALA 19 148 148 ALA ALA A . n A 1 20 HIS 20 149 149 HIS HIS A . n A 1 21 GLU 21 150 150 GLU GLU A . n A 1 22 LEU 22 151 151 LEU LEU A . n A 1 23 ARG 23 152 152 ARG ARG A . n A 1 24 THR 24 153 153 THR THR A . n A 1 25 PRO 25 154 154 PRO PRO A . n A 1 26 ILE 26 155 155 ILE ILE A . n A 1 27 THR 27 156 156 THR THR A . n A 1 28 ILE 28 157 157 ILE ILE A . n A 1 29 LEU 29 158 158 LEU LEU A . n A 1 30 GLN 30 159 159 GLN GLN A . n A 1 31 GLY 31 160 160 GLY GLY A . n A 1 32 ARG 32 161 161 ARG ARG A . n A 1 33 LEU 33 162 162 LEU LEU A . n A 1 34 GLN 34 163 163 GLN GLN A . n A 1 35 GLY 35 164 164 GLY GLY A . n A 1 36 ILE 36 165 165 ILE ILE A . n A 1 37 ILE 37 166 166 ILE ILE A . n A 1 38 ASP 38 167 167 ASP ASP A . n A 1 39 GLY 39 168 168 GLY GLY A . n A 1 40 VAL 40 169 169 VAL VAL A . n A 1 41 PHE 41 170 170 PHE PHE A . n A 1 42 LYS 42 171 171 LYS LYS A . n A 1 43 PRO 43 172 172 PRO PRO A . n A 1 44 ASP 44 173 173 ASP ASP A . n A 1 45 GLU 45 174 174 GLU GLU A . n A 1 46 VAL 46 175 175 VAL VAL A . n A 1 47 LEU 47 176 176 LEU LEU A . n A 1 48 PHE 48 177 177 PHE PHE A . n A 1 49 LYS 49 178 178 LYS LYS A . n A 1 50 SER 50 179 179 SER SER A . n A 1 51 LEU 51 180 180 LEU LEU A . n A 1 52 LEU 52 181 181 LEU LEU A . n A 1 53 ASN 53 182 182 ASN ASN A . n A 1 54 GLN 54 183 183 GLN GLN A . n A 1 55 VAL 55 184 184 VAL VAL A . n A 1 56 GLU 56 185 185 GLU GLU A . n A 1 57 VAL 57 186 186 VAL VAL A . n A 1 58 LEU 58 187 187 LEU LEU A . n A 1 59 SER 59 188 188 SER SER A . n A 1 60 HIS 60 189 189 HIS HIS A . n A 1 61 LEU 61 190 190 LEU LEU A . n A 1 62 VAL 62 191 191 VAL VAL A . n A 1 63 GLU 63 192 192 GLU GLU A . n A 1 64 ASP 64 193 193 ASP ASP A . n A 1 65 LEU 65 194 194 LEU LEU A . n A 1 66 ARG 66 195 195 ARG ARG A . n A 1 67 THR 67 196 196 THR THR A . n A 1 68 LEU 68 197 197 LEU LEU A . n A 1 69 SER 69 198 198 SER SER A . n A 1 70 LEU 70 199 199 LEU LEU A . n A 1 71 VAL 71 200 200 VAL VAL A . n A 1 72 GLU 72 201 201 GLU GLU A . n A 1 73 ASN 73 202 202 ASN ASN A . n A 1 74 GLN 74 203 203 GLN GLN A . n A 1 75 GLN 75 204 204 GLN GLN A . n A 1 76 LEU 76 205 205 LEU LEU A . n A 1 77 ARG 77 206 206 ARG ARG A . n A 1 78 LEU 78 207 207 LEU LEU A . n A 1 79 ASN 79 208 208 ASN ASN A . n A 1 80 TYR 80 209 209 TYR TYR A . n A 1 81 GLU 81 210 210 GLU GLU A . n A 1 82 LEU 82 211 211 LEU LEU A . n A 1 83 PHE 83 212 212 PHE PHE A . n A 1 84 ASP 84 213 213 ASP ASP A . n A 1 85 PHE 85 214 214 PHE PHE A . n A 1 86 LYS 86 215 215 LYS LYS A . n A 1 87 ALA 87 216 216 ALA ALA A . n A 1 88 VAL 88 217 217 VAL VAL A . n A 1 89 VAL 89 218 218 VAL VAL A . n A 1 90 GLU 90 219 219 GLU GLU A . n A 1 91 LYS 91 220 220 LYS LYS A . n A 1 92 VAL 92 221 221 VAL VAL A . n A 1 93 LEU 93 222 222 LEU LEU A . n A 1 94 LYS 94 223 223 LYS LYS A . n A 1 95 ALA 95 224 224 ALA ALA A . n A 1 96 PHE 96 225 225 PHE PHE A . n A 1 97 GLU 97 226 226 GLU GLU A . n A 1 98 ASP 98 227 227 ASP ASP A . n A 1 99 ARG 99 228 228 ARG ARG A . n A 1 100 LEU 100 229 229 LEU LEU A . n A 1 101 ASP 101 230 230 ASP ASP A . n A 1 102 GLN 102 231 231 GLN GLN A . n A 1 103 ALA 103 232 232 ALA ALA A . n A 1 104 LYS 104 233 233 LYS LYS A . n A 1 105 LEU 105 234 234 LEU LEU A . n A 1 106 VAL 106 235 235 VAL VAL A . n A 1 107 PRO 107 236 236 PRO PRO A . n A 1 108 GLU 108 237 237 GLU GLU A . n A 1 109 LEU 109 238 238 LEU LEU A . n A 1 110 ASP 110 239 239 ASP ASP A . n A 1 111 LEU 111 240 240 LEU LEU A . n A 1 112 THR 112 241 241 THR THR A . n A 1 113 SER 113 242 242 SER SER A . n A 1 114 THR 114 243 243 THR THR A . n A 1 115 PRO 115 244 244 PRO PRO A . n A 1 116 VAL 116 245 245 VAL VAL A . n A 1 117 TYR 117 246 246 TYR TYR A . n A 1 118 CYS 118 247 247 CYS CYS A . n A 1 119 ASP 119 248 248 ASP ASP A . n A 1 120 ARG 120 249 249 ARG ARG A . n A 1 121 ARG 121 250 250 ARG ARG A . n A 1 122 ARG 122 251 251 ARG ARG A . n A 1 123 ILE 123 252 252 ILE ILE A . n A 1 124 GLU 124 253 253 GLU GLU A . n A 1 125 GLN 125 254 254 GLN GLN A . n A 1 126 VAL 126 255 255 VAL VAL A . n A 1 127 LEU 127 256 256 LEU LEU A . n A 1 128 ILE 128 257 257 ILE ILE A . n A 1 129 ALA 129 258 258 ALA ALA A . n A 1 130 LEU 130 259 259 LEU LEU A . n A 1 131 ILE 131 260 260 ILE ILE A . n A 1 132 ASP 132 261 261 ASP ASP A . n A 1 133 ASN 133 262 262 ASN ASN A . n A 1 134 ALA 134 263 263 ALA ALA A . n A 1 135 ILE 135 264 264 ILE ILE A . n A 1 136 ARG 136 265 265 ARG ARG A . n A 1 137 TYR 137 266 266 TYR TYR A . n A 1 138 SER 138 267 267 SER SER A . n A 1 139 HIS 139 268 268 HIS HIS A . n A 1 140 ALA 140 269 269 ALA ALA A . n A 1 141 GLY 141 270 270 GLY GLY A . n A 1 142 LYS 142 271 271 LYS LYS A . n A 1 143 LEU 143 272 272 LEU LEU A . n A 1 144 LYS 144 273 273 LYS LYS A . n A 1 145 ILE 145 274 274 ILE ILE A . n A 1 146 SER 146 275 275 SER SER A . n A 1 147 SER 147 276 276 SER SER A . n A 1 148 GLU 148 277 277 GLU GLU A . n A 1 149 VAL 149 278 278 VAL VAL A . n A 1 150 VAL 150 279 279 VAL VAL A . n A 1 151 SER 151 280 280 SER SER A . n A 1 152 GLN 152 281 281 GLN GLN A . n A 1 153 ASN 153 282 282 ASN ASN A . n A 1 154 TRP 154 283 283 TRP TRP A . n A 1 155 ILE 155 284 284 ILE ILE A . n A 1 156 LEU 156 285 285 LEU LEU A . n A 1 157 LYS 157 286 286 LYS LYS A . n A 1 158 ILE 158 287 287 ILE ILE A . n A 1 159 GLU 159 288 288 GLU GLU A . n A 1 160 ASP 160 289 289 ASP ASP A . n A 1 161 GLU 161 290 290 GLU GLU A . n A 1 162 GLY 162 291 291 GLY GLY A . n A 1 163 PRO 163 292 292 PRO PRO A . n A 1 164 GLY 164 293 293 GLY GLY A . n A 1 165 ILE 165 294 294 ILE ILE A . n A 1 166 ALA 166 295 295 ALA ALA A . n A 1 167 THR 167 296 296 THR THR A . n A 1 168 GLU 168 297 297 GLU GLU A . n A 1 169 PHE 169 298 ? ? ? A . n A 1 170 GLN 170 299 ? ? ? A . n A 1 171 ASP 171 300 300 ASP ASP A . n A 1 172 ASP 172 301 301 ASP ASP A . n A 1 173 LEU 173 302 302 LEU LEU A . n A 1 174 PHE 174 303 303 PHE PHE A . n A 1 175 LYS 175 304 304 LYS LYS A . n A 1 176 PRO 176 305 305 PRO PRO A . n A 1 177 PHE 177 306 306 PHE PHE A . n A 1 178 PHE 178 307 ? ? ? A . n A 1 179 ARG 179 308 ? ? ? A . n A 1 180 LEU 180 309 ? ? ? A . n A 1 181 GLU 181 310 ? ? ? A . n A 1 182 GLU 182 311 ? ? ? A . n A 1 183 SER 183 312 ? ? ? A . n A 1 184 ARG 184 313 ? ? ? A . n A 1 185 ASN 185 314 ? ? ? A . n A 1 186 LYS 186 315 ? ? ? A . n A 1 187 GLU 187 316 ? ? ? A . n A 1 188 PHE 188 317 ? ? ? A . n A 1 189 GLY 189 318 ? ? ? A . n A 1 190 GLY 190 319 ? ? ? A . n A 1 191 THR 191 320 320 THR THR A . n A 1 192 GLY 192 321 321 GLY GLY A . n A 1 193 LEU 193 322 322 LEU LEU A . n A 1 194 GLY 194 323 323 GLY GLY A . n A 1 195 LEU 195 324 324 LEU LEU A . n A 1 196 ALA 196 325 325 ALA ALA A . n A 1 197 VAL 197 326 326 VAL VAL A . n A 1 198 VAL 198 327 327 VAL VAL A . n A 1 199 HIS 199 328 328 HIS HIS A . n A 1 200 ALA 200 329 329 ALA ALA A . n A 1 201 ILE 201 330 330 ILE ILE A . n A 1 202 ILE 202 331 331 ILE ILE A . n A 1 203 VAL 203 332 332 VAL VAL A . n A 1 204 ALA 204 333 333 ALA ALA A . n A 1 205 LEU 205 334 334 LEU LEU A . n A 1 206 LYS 206 335 335 LYS LYS A . n A 1 207 GLY 207 336 336 GLY GLY A . n A 1 208 THR 208 337 337 THR THR A . n A 1 209 ILE 209 338 338 ILE ILE A . n A 1 210 GLN 210 339 339 GLN GLN A . n A 1 211 TYR 211 340 340 TYR TYR A . n A 1 212 SER 212 341 341 SER SER A . n A 1 213 ASN 213 342 342 ASN ASN A . n A 1 214 GLN 214 343 343 GLN GLN A . n A 1 215 GLY 215 344 344 GLY GLY A . n A 1 216 SER 216 345 345 SER SER A . n A 1 217 LYS 217 346 346 LYS LYS A . n A 1 218 SER 218 347 347 SER SER A . n A 1 219 ILE 219 348 348 ILE ILE A . n A 1 220 PHE 220 349 349 PHE PHE A . n A 1 221 THR 221 350 350 THR THR A . n A 1 222 ILE 222 351 351 ILE ILE A . n A 1 223 LYS 223 352 352 LYS LYS A . n A 1 224 ILE 224 353 353 ILE ILE A . n A 1 225 SER 225 354 354 SER SER A . n A 1 226 MET 226 355 355 MET MET A . n A 1 227 ASN 227 356 356 ASN ASN A . n A 1 228 ASN 228 357 357 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2530 ? 1 MORE -22 ? 1 'SSA (A^2)' 20770 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_445 -y-1,-x-1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 -70.5260000000 -0.8660254038 -0.5000000000 0.0000000000 -122.1546152546 0.0000000000 0.0000000000 -1.0000000000 8.4710000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-23 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -17.7488 _pdbx_refine_tls.origin_y -49.9170 _pdbx_refine_tls.origin_z 4.1076 _pdbx_refine_tls.T[1][1] 0.8136 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0557 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.2839 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.8090 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0245 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.6136 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 4.4410 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 1.6807 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.5584 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.6175 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.2797 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.5824 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.2012 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.3680 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.5567 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.4901 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.1197 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.4449 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.4307 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0235 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.2463 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 146 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 357 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 148 ? ? 177.72 -52.52 2 1 HIS A 149 ? ? -69.83 16.27 3 1 CYS A 247 ? ? -166.20 -167.57 4 1 TYR A 266 ? ? -130.64 -34.61 5 1 SER A 280 ? ? 52.52 80.62 6 1 GLN A 281 ? ? 59.25 18.41 7 1 LEU A 322 ? ? 47.96 20.21 8 1 ASN A 356 ? ? -66.42 97.83 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 150 ? CG ? A GLU 21 CG 2 1 Y 1 A GLU 150 ? CD ? A GLU 21 CD 3 1 Y 1 A GLU 150 ? OE1 ? A GLU 21 OE1 4 1 Y 1 A GLU 150 ? OE2 ? A GLU 21 OE2 5 1 Y 1 A LYS 215 ? CG ? A LYS 86 CG 6 1 Y 1 A LYS 215 ? CD ? A LYS 86 CD 7 1 Y 1 A LYS 215 ? CE ? A LYS 86 CE 8 1 Y 1 A LYS 215 ? NZ ? A LYS 86 NZ 9 1 Y 1 A GLN 281 ? CG ? A GLN 152 CG 10 1 Y 1 A GLN 281 ? CD ? A GLN 152 CD 11 1 Y 1 A GLN 281 ? OE1 ? A GLN 152 OE1 12 1 Y 1 A GLN 281 ? NE2 ? A GLN 152 NE2 13 1 Y 1 A GLU 297 ? CG ? A GLU 168 CG 14 1 Y 1 A GLU 297 ? CD ? A GLU 168 CD 15 1 Y 1 A GLU 297 ? OE1 ? A GLU 168 OE1 16 1 Y 1 A GLU 297 ? OE2 ? A GLU 168 OE2 17 1 Y 1 A ASP 300 ? CG ? A ASP 171 CG 18 1 Y 1 A ASP 300 ? OD1 ? A ASP 171 OD1 19 1 Y 1 A ASP 300 ? OD2 ? A ASP 171 OD2 20 1 Y 1 A LYS 304 ? CG ? A LYS 175 CG 21 1 Y 1 A LYS 304 ? CD ? A LYS 175 CD 22 1 Y 1 A LYS 304 ? CE ? A LYS 175 CE 23 1 Y 1 A LYS 304 ? NZ ? A LYS 175 NZ 24 1 Y 1 A LYS 335 ? CG ? A LYS 206 CG 25 1 Y 1 A LYS 335 ? CD ? A LYS 206 CD 26 1 Y 1 A LYS 335 ? CE ? A LYS 206 CE 27 1 Y 1 A LYS 335 ? NZ ? A LYS 206 NZ 28 1 Y 1 A GLN 343 ? CG ? A GLN 214 CG 29 1 Y 1 A GLN 343 ? CD ? A GLN 214 CD 30 1 Y 1 A GLN 343 ? OE1 ? A GLN 214 OE1 31 1 Y 1 A GLN 343 ? NE2 ? A GLN 214 NE2 32 1 Y 1 A ASN 356 ? CG ? A ASN 227 CG 33 1 Y 1 A ASN 356 ? OD1 ? A ASN 227 OD1 34 1 Y 1 A ASN 356 ? ND2 ? A ASN 227 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 130 ? A MET 1 2 1 Y 1 A GLY 131 ? A GLY 2 3 1 Y 1 A HIS 132 ? A HIS 3 4 1 Y 1 A HIS 133 ? A HIS 4 5 1 Y 1 A HIS 134 ? A HIS 5 6 1 Y 1 A HIS 135 ? A HIS 6 7 1 Y 1 A HIS 136 ? A HIS 7 8 1 Y 1 A HIS 137 ? A HIS 8 9 1 Y 1 A LYS 138 ? A LYS 9 10 1 Y 1 A ASN 139 ? A ASN 10 11 1 Y 1 A ALA 140 ? A ALA 11 12 1 Y 1 A GLN 141 ? A GLN 12 13 1 Y 1 A VAL 142 ? A VAL 13 14 1 Y 1 A TRP 143 ? A TRP 14 15 1 Y 1 A ASN 144 ? A ASN 15 16 1 Y 1 A ALA 145 ? A ALA 16 17 1 Y 1 A PHE 298 ? A PHE 169 18 1 Y 1 A GLN 299 ? A GLN 170 19 1 Y 1 A PHE 307 ? A PHE 178 20 1 Y 1 A ARG 308 ? A ARG 179 21 1 Y 1 A LEU 309 ? A LEU 180 22 1 Y 1 A GLU 310 ? A GLU 181 23 1 Y 1 A GLU 311 ? A GLU 182 24 1 Y 1 A SER 312 ? A SER 183 25 1 Y 1 A ARG 313 ? A ARG 184 26 1 Y 1 A ASN 314 ? A ASN 185 27 1 Y 1 A LYS 315 ? A LYS 186 28 1 Y 1 A GLU 316 ? A GLU 187 29 1 Y 1 A PHE 317 ? A PHE 188 30 1 Y 1 A GLY 318 ? A GLY 189 31 1 Y 1 A GLY 319 ? A GLY 190 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31870132 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5LFK _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? #