data_7CJR # _entry.id 7CJR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.333 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 7CJR WWPDB D_1300016913 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CJR _pdbx_database_status.recvd_initial_deposition_date 2020-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Goh, B.C.' 1 0000-0002-0292-0922 'Chua, Y.K.' 2 ? 'Qian, X.' 3 ? 'Savko, M.' 4 ? 'Lescar, J.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 212 _citation.language ? _citation.page_first 107610 _citation.page_last 107610 _citation.title 'Crystal structure of the periplasmic sensor domain of histidine kinase VbrK suggests indirect sensing of beta-lactam antibiotics.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2020.107610 _citation.pdbx_database_id_PubMed 32890780 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goh, B.C.' 1 ? primary 'Chua, Y.K.' 2 ? primary 'Qian, X.' 3 ? primary 'Lin, J.' 4 ? primary 'Savko, M.' 5 ? primary 'Dedon, P.C.' 6 ? primary 'Lescar, J.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CJR _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.550 _cell.length_a_esd ? _cell.length_b 52.550 _cell.length_b_esd ? _cell.length_c 157.160 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CJR _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histidine kinase' 27283.117 1 2.7.13.3 ? ? ? 2 non-polymer nat 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 3 ? ? ? ? 4 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIKQFLLGVASILPLFSAPALSDSLPERIDTFTELFNYEVALKSYDIRILQSNYPTKLLSPDSLLPQTSDYPLKDIQQLY SLANTCRGKLPLSPLITEPLVFTRAICKGTQLTPRWFSRSGLIHPGGGTYAARYVEKYPELRPKLAQYMHIKERDNEEGD ELLESLQNMDDDAINALIAGASMFIEGKEMWLRRGDRYFVFSKDVWQENVANAGLSYTLASQSKSCFVKRGNICWDVEDH ; _entity_poly.pdbx_seq_one_letter_code_can ;MIKQFLLGVASILPLFSAPALSDSLPERIDTFTELFNYEVALKSYDIRILQSNYPTKLLSPDSLLPQTSDYPLKDIQQLY SLANTCRGKLPLSPLITEPLVFTRAICKGTQLTPRWFSRSGLIHPGGGTYAARYVEKYPELRPKLAQYMHIKERDNEEGD ELLESLQNMDDDAINALIAGASMFIEGKEMWLRRGDRYFVFSKDVWQENVANAGLSYTLASQSKSCFVKRGNICWDVEDH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 LYS n 1 4 GLN n 1 5 PHE n 1 6 LEU n 1 7 LEU n 1 8 GLY n 1 9 VAL n 1 10 ALA n 1 11 SER n 1 12 ILE n 1 13 LEU n 1 14 PRO n 1 15 LEU n 1 16 PHE n 1 17 SER n 1 18 ALA n 1 19 PRO n 1 20 ALA n 1 21 LEU n 1 22 SER n 1 23 ASP n 1 24 SER n 1 25 LEU n 1 26 PRO n 1 27 GLU n 1 28 ARG n 1 29 ILE n 1 30 ASP n 1 31 THR n 1 32 PHE n 1 33 THR n 1 34 GLU n 1 35 LEU n 1 36 PHE n 1 37 ASN n 1 38 TYR n 1 39 GLU n 1 40 VAL n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 SER n 1 45 TYR n 1 46 ASP n 1 47 ILE n 1 48 ARG n 1 49 ILE n 1 50 LEU n 1 51 GLN n 1 52 SER n 1 53 ASN n 1 54 TYR n 1 55 PRO n 1 56 THR n 1 57 LYS n 1 58 LEU n 1 59 LEU n 1 60 SER n 1 61 PRO n 1 62 ASP n 1 63 SER n 1 64 LEU n 1 65 LEU n 1 66 PRO n 1 67 GLN n 1 68 THR n 1 69 SER n 1 70 ASP n 1 71 TYR n 1 72 PRO n 1 73 LEU n 1 74 LYS n 1 75 ASP n 1 76 ILE n 1 77 GLN n 1 78 GLN n 1 79 LEU n 1 80 TYR n 1 81 SER n 1 82 LEU n 1 83 ALA n 1 84 ASN n 1 85 THR n 1 86 CYS n 1 87 ARG n 1 88 GLY n 1 89 LYS n 1 90 LEU n 1 91 PRO n 1 92 LEU n 1 93 SER n 1 94 PRO n 1 95 LEU n 1 96 ILE n 1 97 THR n 1 98 GLU n 1 99 PRO n 1 100 LEU n 1 101 VAL n 1 102 PHE n 1 103 THR n 1 104 ARG n 1 105 ALA n 1 106 ILE n 1 107 CYS n 1 108 LYS n 1 109 GLY n 1 110 THR n 1 111 GLN n 1 112 LEU n 1 113 THR n 1 114 PRO n 1 115 ARG n 1 116 TRP n 1 117 PHE n 1 118 SER n 1 119 ARG n 1 120 SER n 1 121 GLY n 1 122 LEU n 1 123 ILE n 1 124 HIS n 1 125 PRO n 1 126 GLY n 1 127 GLY n 1 128 GLY n 1 129 THR n 1 130 TYR n 1 131 ALA n 1 132 ALA n 1 133 ARG n 1 134 TYR n 1 135 VAL n 1 136 GLU n 1 137 LYS n 1 138 TYR n 1 139 PRO n 1 140 GLU n 1 141 LEU n 1 142 ARG n 1 143 PRO n 1 144 LYS n 1 145 LEU n 1 146 ALA n 1 147 GLN n 1 148 TYR n 1 149 MET n 1 150 HIS n 1 151 ILE n 1 152 LYS n 1 153 GLU n 1 154 ARG n 1 155 ASP n 1 156 ASN n 1 157 GLU n 1 158 GLU n 1 159 GLY n 1 160 ASP n 1 161 GLU n 1 162 LEU n 1 163 LEU n 1 164 GLU n 1 165 SER n 1 166 LEU n 1 167 GLN n 1 168 ASN n 1 169 MET n 1 170 ASP n 1 171 ASP n 1 172 ASP n 1 173 ALA n 1 174 ILE n 1 175 ASN n 1 176 ALA n 1 177 LEU n 1 178 ILE n 1 179 ALA n 1 180 GLY n 1 181 ALA n 1 182 SER n 1 183 MET n 1 184 PHE n 1 185 ILE n 1 186 GLU n 1 187 GLY n 1 188 LYS n 1 189 GLU n 1 190 MET n 1 191 TRP n 1 192 LEU n 1 193 ARG n 1 194 ARG n 1 195 GLY n 1 196 ASP n 1 197 ARG n 1 198 TYR n 1 199 PHE n 1 200 VAL n 1 201 PHE n 1 202 SER n 1 203 LYS n 1 204 ASP n 1 205 VAL n 1 206 TRP n 1 207 GLN n 1 208 GLU n 1 209 ASN n 1 210 VAL n 1 211 ALA n 1 212 ASN n 1 213 ALA n 1 214 GLY n 1 215 LEU n 1 216 SER n 1 217 TYR n 1 218 THR n 1 219 LEU n 1 220 ALA n 1 221 SER n 1 222 GLN n 1 223 SER n 1 224 LYS n 1 225 SER n 1 226 CYS n 1 227 PHE n 1 228 VAL n 1 229 LYS n 1 230 ARG n 1 231 GLY n 1 232 ASN n 1 233 ILE n 1 234 CYS n 1 235 TRP n 1 236 ASP n 1 237 VAL n 1 238 GLU n 1 239 ASP n 1 240 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 240 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CGJ74_25135, WR32_19055' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio parahaemolyticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 670 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant 'Rosetta T1R' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC-CH _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0L8SC43_VIBPH _struct_ref.pdbx_db_accession A0A0L8SC43 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIKQFLLGVASILPLFSAPALSDSLPERIDTFTELFNYEVALKSYDIRILQSNYPTKLLSPDSLLPQTSDYPLKDIQQLY SLANTCRGKLPLSPLITEPLVFTRAICKGTQLTPRWFSRSGLIHPGGGTYAARYVEKYPELRPKLAQYMHIKERDNEEGD ELLESLQNMDDDAINALIAGASMFIEGKEMWLRRGDRYFVFSKDVWQENVANAGLSYTLASQSKSCFVKRGNICWDVEDH ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CJR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0L8SC43 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CJR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.130 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M NaCl, 25% PEG 3350, 0.1M Bis-Tris pH5.5' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency ? PIXEL 1 'DECTRIS EIGER X 9M' ? ? ? ? 2018-12-09 ? ? PIXEL 2 'DECTRIS EIGER X 9M' ? ? ? ? 2018-12-09 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.98 1.0 2 2.0 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'SOLEIL BEAMLINE PROXIMA 2' ? ? 0.98 ? 'PROXIMA 2' SOLEIL ? ? 2 ? ? SYNCHROTRON ? 'SOLEIL BEAMLINE PROXIMA 2' ? ? 2.0 ? 'PROXIMA 2' SOLEIL # _reflns.B_iso_Wilson_estimate 74.570 _reflns.entry_id 7CJR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.280 _reflns.d_resolution_low 43.680 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10752 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.100 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 34.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.052 _reflns.pdbx_Rpim_I_all 0.0103 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.280 2.340 ? ? ? ? ? ? 731 95.800 ? ? ? ? 1.860 ? ? ? ? ? ? ? ? 24.300 ? ? ? ? 1.898 0.373 ? 1 1 0.857 ? ? 2.782 2.881 ? 6 ? ? ? ? 589 98.99 ? ? ? ? ? ? ? ? ? ? ? ? ? 243.6 ? ? ? ? ? ? ? 2 2 1.000 ? ? # _refine.aniso_B[1][1] -10.1785 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -10.1785 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 20.3571 _refine.B_iso_max 144.910 _refine.B_iso_mean 78.8000 _refine.B_iso_min 52.280 _refine.correlation_coeff_Fo_to_Fc 0.9330 _refine.correlation_coeff_Fo_to_Fc_free 0.9280 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CJR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2800 _refine.ls_d_res_low 43.6800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10693 _refine.ls_number_reflns_R_free 535 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7000 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2339 _refine.ls_R_factor_R_free 0.2731 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2316 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.2520 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.2550 _refine.pdbx_overall_SU_R_Blow_DPI 0.3930 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.3700 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7CJR _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.360 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2800 _refine_hist.d_res_low 43.6800 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1769 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 214 _refine_hist.pdbx_B_iso_mean_ligand 120.85 _refine_hist.pdbx_B_iso_mean_solvent 68.28 _refine_hist.pdbx_number_atoms_protein 1690 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 52 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 614 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 296 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1763 ? t_it 10.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 227 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1367 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.008 ? 1793 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 0.970 ? 2452 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.960 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.110 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2800 _refine_ls_shell.d_res_low 2.3100 _refine_ls_shell.number_reflns_all 412 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 20 _refine_ls_shell.number_reflns_R_work 392 _refine_ls_shell.percent_reflns_obs 93.0600 _refine_ls_shell.percent_reflns_R_free 4.8500 _refine_ls_shell.R_factor_all 0.2666 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2835 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2659 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 27 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7CJR _struct.title 'Crystal structure of a periplasmic sensor domain of histidine kinase VbrK' _struct.pdbx_descriptor 'Histidine kinase (E.C.2.7.13.3)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CJR _struct_keywords.text 'histidine kinase, sensor, signaling protein, transferase, tetratricopeptide repeat' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 24 ? LEU A 35 ? SER A 24 LEU A 35 1 ? 12 HELX_P HELX_P2 AA2 ILE A 47 ? TYR A 54 ? ILE A 47 TYR A 54 1 ? 8 HELX_P HELX_P3 AA3 PRO A 55 ? LEU A 59 ? PRO A 55 LEU A 59 5 ? 5 HELX_P HELX_P4 AA4 SER A 60 ? LEU A 65 ? SER A 60 LEU A 65 5 ? 6 HELX_P HELX_P5 AA5 PRO A 72 ? CYS A 86 ? PRO A 72 CYS A 86 1 ? 15 HELX_P HELX_P6 AA6 ILE A 96 ? GLY A 109 ? ILE A 96 GLY A 109 1 ? 14 HELX_P HELX_P7 AA7 THR A 113 ? SER A 120 ? THR A 113 SER A 120 1 ? 8 HELX_P HELX_P8 AA8 THR A 129 ? TYR A 138 ? THR A 129 TYR A 138 1 ? 10 HELX_P HELX_P9 AA9 LEU A 141 ? ALA A 146 ? LEU A 141 ALA A 146 1 ? 6 HELX_P HELX_P10 AB1 GLN A 147 ? MET A 149 ? GLN A 147 MET A 149 5 ? 3 HELX_P HELX_P11 AB2 HIS A 150 ? ARG A 154 ? HIS A 150 ARG A 154 5 ? 5 HELX_P HELX_P12 AB3 GLU A 161 ? ASN A 168 ? GLU A 161 ASN A 168 1 ? 8 HELX_P HELX_P13 AB4 ASP A 170 ? GLY A 180 ? ASP A 170 GLY A 180 1 ? 11 HELX_P HELX_P14 AB5 SER A 202 ? GLY A 214 ? SER A 202 GLY A 214 1 ? 13 HELX_P HELX_P15 AB6 SER A 221 ? SER A 223 ? SER A 221 SER A 223 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 86 SG ? ? ? 1_555 A CYS 107 SG ? ? A CYS 86 A CYS 107 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf2 disulf ? ? A CYS 226 SG ? ? ? 1_555 A CYS 234 SG ? ? A CYS 226 A CYS 234 1_555 ? ? ? ? ? ? ? 2.019 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 43 ? ASP A 46 ? LYS A 43 ASP A 46 AA1 2 ARG A 197 ? PHE A 201 ? ARG A 197 PHE A 201 AA1 3 GLU A 189 ? ARG A 194 ? GLU A 189 ARG A 194 AA1 4 MET A 183 ? GLU A 186 ? MET A 183 GLU A 186 AA2 1 LEU A 215 ? LEU A 219 ? LEU A 215 LEU A 219 AA2 2 ILE A 233 ? VAL A 237 ? ILE A 233 VAL A 237 AA2 3 LYS A 229 ? ARG A 230 ? LYS A 229 ARG A 230 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 45 ? N TYR A 45 O TYR A 198 ? O TYR A 198 AA1 2 3 O PHE A 199 ? O PHE A 199 N LEU A 192 ? N LEU A 192 AA1 3 4 O TRP A 191 ? O TRP A 191 N PHE A 184 ? N PHE A 184 AA2 1 2 N THR A 218 ? N THR A 218 O CYS A 234 ? O CYS A 234 AA2 2 3 O ILE A 233 ? O ILE A 233 N ARG A 230 ? N ARG A 230 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 301 ? 3 'binding site for residue CL A 301' AC2 Software A PEG 302 ? 7 'binding site for residue PEG A 302' AC3 Software A PEG 303 ? 3 'binding site for residue PEG A 303' AC4 Software A PEG 304 ? 3 'binding site for residue PEG A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 SER A 182 ? SER A 182 . ? 1_555 ? 2 AC1 3 ARG A 230 ? ARG A 230 . ? 8_665 ? 3 AC1 3 HOH F . ? HOH A 405 . ? 8_665 ? 4 AC2 7 GLN A 51 ? GLN A 51 . ? 1_555 ? 5 AC2 7 TYR A 54 ? TYR A 54 . ? 1_555 ? 6 AC2 7 THR A 56 ? THR A 56 . ? 1_555 ? 7 AC2 7 LEU A 59 ? LEU A 59 . ? 1_555 ? 8 AC2 7 LEU A 177 ? LEU A 177 . ? 1_555 ? 9 AC2 7 ILE A 178 ? ILE A 178 . ? 1_555 ? 10 AC2 7 HOH F . ? HOH A 422 . ? 1_555 ? 11 AC3 3 SER A 44 ? SER A 44 . ? 3_545 ? 12 AC3 3 ARG A 197 ? ARG A 197 . ? 3_545 ? 13 AC3 3 ASP A 239 ? ASP A 239 . ? 1_555 ? 14 AC4 3 GLU A 136 ? GLU A 136 . ? 5_545 ? 15 AC4 3 LYS A 137 ? LYS A 137 . ? 5_545 ? 16 AC4 3 TYR A 217 ? TYR A 217 . ? 1_555 ? # _atom_sites.entry_id 7CJR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019029 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019029 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006363 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 ILE 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 PRO 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 PHE 16 16 ? ? ? A . n A 1 17 SER 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 PRO 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 LEU 21 21 ? ? ? A . n A 1 22 SER 22 22 ? ? ? A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 ? ? ? A . n A 1 89 LYS 89 89 ? ? ? A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 TRP 116 116 116 TRP TRP A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLY 159 159 ? ? ? A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 TRP 191 191 191 TRP TRP A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ARG 197 197 197 ARG ARG A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 TRP 206 206 206 TRP TRP A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 ASN 212 212 212 ASN ASN A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 PHE 227 227 227 PHE PHE A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 CYS 234 234 234 CYS CYS A . n A 1 235 TRP 235 235 235 TRP TRP A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 HIS 240 240 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 301 301 CL CL A . C 3 PEG 1 302 601 PEG PEG A . D 3 PEG 1 303 701 PEG PEG A . E 3 PEG 1 304 901 PEG PEG A . F 4 HOH 1 401 19 HOH HOH A . F 4 HOH 2 402 3 HOH HOH A . F 4 HOH 3 403 2 HOH HOH A . F 4 HOH 4 404 10 HOH HOH A . F 4 HOH 5 405 11 HOH HOH A . F 4 HOH 6 406 21 HOH HOH A . F 4 HOH 7 407 36 HOH HOH A . F 4 HOH 8 408 7 HOH HOH A . F 4 HOH 9 409 23 HOH HOH A . F 4 HOH 10 410 34 HOH HOH A . F 4 HOH 11 411 9 HOH HOH A . F 4 HOH 12 412 17 HOH HOH A . F 4 HOH 13 413 4 HOH HOH A . F 4 HOH 14 414 15 HOH HOH A . F 4 HOH 15 415 1 HOH HOH A . F 4 HOH 16 416 16 HOH HOH A . F 4 HOH 17 417 35 HOH HOH A . F 4 HOH 18 418 31 HOH HOH A . F 4 HOH 19 419 5 HOH HOH A . F 4 HOH 20 420 12 HOH HOH A . F 4 HOH 21 421 22 HOH HOH A . F 4 HOH 22 422 14 HOH HOH A . F 4 HOH 23 423 13 HOH HOH A . F 4 HOH 24 424 18 HOH HOH A . F 4 HOH 25 425 6 HOH HOH A . F 4 HOH 26 426 27 HOH HOH A . F 4 HOH 27 427 8 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -7 ? 1 'SSA (A^2)' 11570 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-16 2 'Structure model' 1 1 2020-10-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation_author.name' # _phasing.method SAD # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.10.3 (19-MAR-2020)' 1 ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 2 ? 'data scaling' ? ? 'Phil Evans' ? 15/08/18 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.7.3 3 ? phasing ? ? 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de ? ? ? ? Fortran_77 http://shelx.uni-ac.gwdg.de/SHELX/ ? SHELX ? ? package . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 5 # _pdbx_entry_details.entry_id 7CJR _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 24 ? ? -178.32 145.94 2 1 TYR A 38 ? ? -69.07 9.48 3 1 PRO A 66 ? ? -63.17 4.36 4 1 ILE A 96 ? ? -69.25 17.77 5 1 LEU A 122 ? ? 75.37 -33.23 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 39 ? CG ? A GLU 39 CG 2 1 Y 1 A GLU 39 ? CD ? A GLU 39 CD 3 1 Y 1 A GLU 39 ? OE1 ? A GLU 39 OE1 4 1 Y 1 A GLU 39 ? OE2 ? A GLU 39 OE2 5 1 Y 1 A ASP 70 ? CG ? A ASP 70 CG 6 1 Y 1 A ASP 70 ? OD1 ? A ASP 70 OD1 7 1 Y 1 A ASP 70 ? OD2 ? A ASP 70 OD2 8 1 Y 1 A LEU 73 ? CG ? A LEU 73 CG 9 1 Y 1 A LEU 73 ? CD1 ? A LEU 73 CD1 10 1 Y 1 A LEU 73 ? CD2 ? A LEU 73 CD2 11 1 Y 1 A LYS 74 ? CG ? A LYS 74 CG 12 1 Y 1 A LYS 74 ? CD ? A LYS 74 CD 13 1 Y 1 A LYS 74 ? CE ? A LYS 74 CE 14 1 Y 1 A LYS 74 ? NZ ? A LYS 74 NZ 15 1 Y 1 A ASP 75 ? CG ? A ASP 75 CG 16 1 Y 1 A ASP 75 ? OD1 ? A ASP 75 OD1 17 1 Y 1 A ASP 75 ? OD2 ? A ASP 75 OD2 18 1 Y 1 A ARG 87 ? CG ? A ARG 87 CG 19 1 Y 1 A ARG 87 ? CD ? A ARG 87 CD 20 1 Y 1 A ARG 87 ? NE ? A ARG 87 NE 21 1 Y 1 A ARG 87 ? CZ ? A ARG 87 CZ 22 1 Y 1 A ARG 87 ? NH1 ? A ARG 87 NH1 23 1 Y 1 A ARG 87 ? NH2 ? A ARG 87 NH2 24 1 Y 1 A LEU 90 ? CG ? A LEU 90 CG 25 1 Y 1 A LEU 90 ? CD1 ? A LEU 90 CD1 26 1 Y 1 A LEU 90 ? CD2 ? A LEU 90 CD2 27 1 Y 1 A LEU 92 ? CG ? A LEU 92 CG 28 1 Y 1 A LEU 92 ? CD1 ? A LEU 92 CD1 29 1 Y 1 A LEU 92 ? CD2 ? A LEU 92 CD2 30 1 Y 1 A ILE 96 ? CG1 ? A ILE 96 CG1 31 1 Y 1 A ILE 96 ? CG2 ? A ILE 96 CG2 32 1 Y 1 A ILE 96 ? CD1 ? A ILE 96 CD1 33 1 Y 1 A GLU 157 ? CG ? A GLU 157 CG 34 1 Y 1 A GLU 157 ? CD ? A GLU 157 CD 35 1 Y 1 A GLU 157 ? OE1 ? A GLU 157 OE1 36 1 Y 1 A GLU 157 ? OE2 ? A GLU 157 OE2 37 1 Y 1 A LYS 188 ? CG ? A LYS 188 CG 38 1 Y 1 A LYS 188 ? CD ? A LYS 188 CD 39 1 Y 1 A LYS 188 ? CE ? A LYS 188 CE 40 1 Y 1 A LYS 188 ? NZ ? A LYS 188 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A ILE 12 ? A ILE 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A PRO 14 ? A PRO 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A PHE 16 ? A PHE 16 17 1 Y 1 A SER 17 ? A SER 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A PRO 19 ? A PRO 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A LEU 21 ? A LEU 21 22 1 Y 1 A SER 22 ? A SER 22 23 1 Y 1 A GLY 88 ? A GLY 88 24 1 Y 1 A LYS 89 ? A LYS 89 25 1 Y 1 A GLY 159 ? A GLY 159 26 1 Y 1 A HIS 240 ? A HIS 240 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Singapore)' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'DI(HYDROXYETHYL)ETHER' PEG 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #