data_7CPZ # _entry.id 7CPZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CPZ pdb_00007cpz 10.2210/pdb7cpz/pdb WWPDB D_1300018041 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CPZ _pdbx_database_status.recvd_initial_deposition_date 2020-08-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jeon, B.J.' 1 ? 'Kim, S.' 2 ? 'Lee, J.-H.' 3 ? 'Kim, M.S.' 4 ? 'Hwang, K.Y.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iucrj _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2052-2525 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 168 _citation.page_last 177 _citation.title ;Insights into the structure of mature streptavidin C1 from Streptomyces cinnamonensis reveal the self-binding of the extension C-terminal peptide to biotin-binding sites. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2052252520015675 _citation.pdbx_database_id_PubMed 33708394 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jeon, B.J.' 1 0000-0001-7302-4298 primary 'Kim, S.' 2 ? primary 'Kim, M.S.' 3 ? primary 'Lee, J.H.' 4 ? primary 'Kim, B.S.' 5 0000-0003-0817-8623 primary 'Hwang, K.Y.' 6 0000-0002-2076-5030 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CPZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.997 _cell.length_a_esd ? _cell.length_b 57.997 _cell.length_b_esd ? _cell.length_c 74.847 _cell.length_c_esd ? _cell.volume 251759.262 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CPZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall 'P 4n 2n' _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mature Streptoavidin-C1' 20172.203 1 ? ? ? ? 2 non-polymer syn BIOTIN 244.311 1 ? ? ? ? 3 water nat water 18.015 49 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Streptoavidin-C1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTRVRQALVALCALSLTFVTVSASASADPRETVSADAAETGSATESRPGILGTWYNQLGSVMVVTRAANGGFVGTYESAV GNAEKRYVMTGRYDSAPADGTGTAVGWTVAYRNAHRNAHSVATWSGQYVGGSQERIVTQWLLSYGTTPADQWKSTFLGHD EFTRVKPSAADVEKARQLGVTSANPPASDGE ; _entity_poly.pdbx_seq_one_letter_code_can ;MTRVRQALVALCALSLTFVTVSASASADPRETVSADAAETGSATESRPGILGTWYNQLGSVMVVTRAANGGFVGTYESAV GNAEKRYVMTGRYDSAPADGTGTAVGWTVAYRNAHRNAHSVATWSGQYVGGSQERIVTQWLLSYGTTPADQWKSTFLGHD EFTRVKPSAADVEKARQLGVTSANPPASDGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ARG n 1 4 VAL n 1 5 ARG n 1 6 GLN n 1 7 ALA n 1 8 LEU n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 CYS n 1 13 ALA n 1 14 LEU n 1 15 SER n 1 16 LEU n 1 17 THR n 1 18 PHE n 1 19 VAL n 1 20 THR n 1 21 VAL n 1 22 SER n 1 23 ALA n 1 24 SER n 1 25 ALA n 1 26 SER n 1 27 ALA n 1 28 ASP n 1 29 PRO n 1 30 ARG n 1 31 GLU n 1 32 THR n 1 33 VAL n 1 34 SER n 1 35 ALA n 1 36 ASP n 1 37 ALA n 1 38 ALA n 1 39 GLU n 1 40 THR n 1 41 GLY n 1 42 SER n 1 43 ALA n 1 44 THR n 1 45 GLU n 1 46 SER n 1 47 ARG n 1 48 PRO n 1 49 GLY n 1 50 ILE n 1 51 LEU n 1 52 GLY n 1 53 THR n 1 54 TRP n 1 55 TYR n 1 56 ASN n 1 57 GLN n 1 58 LEU n 1 59 GLY n 1 60 SER n 1 61 VAL n 1 62 MET n 1 63 VAL n 1 64 VAL n 1 65 THR n 1 66 ARG n 1 67 ALA n 1 68 ALA n 1 69 ASN n 1 70 GLY n 1 71 GLY n 1 72 PHE n 1 73 VAL n 1 74 GLY n 1 75 THR n 1 76 TYR n 1 77 GLU n 1 78 SER n 1 79 ALA n 1 80 VAL n 1 81 GLY n 1 82 ASN n 1 83 ALA n 1 84 GLU n 1 85 LYS n 1 86 ARG n 1 87 TYR n 1 88 VAL n 1 89 MET n 1 90 THR n 1 91 GLY n 1 92 ARG n 1 93 TYR n 1 94 ASP n 1 95 SER n 1 96 ALA n 1 97 PRO n 1 98 ALA n 1 99 ASP n 1 100 GLY n 1 101 THR n 1 102 GLY n 1 103 THR n 1 104 ALA n 1 105 VAL n 1 106 GLY n 1 107 TRP n 1 108 THR n 1 109 VAL n 1 110 ALA n 1 111 TYR n 1 112 ARG n 1 113 ASN n 1 114 ALA n 1 115 HIS n 1 116 ARG n 1 117 ASN n 1 118 ALA n 1 119 HIS n 1 120 SER n 1 121 VAL n 1 122 ALA n 1 123 THR n 1 124 TRP n 1 125 SER n 1 126 GLY n 1 127 GLN n 1 128 TYR n 1 129 VAL n 1 130 GLY n 1 131 GLY n 1 132 SER n 1 133 GLN n 1 134 GLU n 1 135 ARG n 1 136 ILE n 1 137 VAL n 1 138 THR n 1 139 GLN n 1 140 TRP n 1 141 LEU n 1 142 LEU n 1 143 SER n 1 144 TYR n 1 145 GLY n 1 146 THR n 1 147 THR n 1 148 PRO n 1 149 ALA n 1 150 ASP n 1 151 GLN n 1 152 TRP n 1 153 LYS n 1 154 SER n 1 155 THR n 1 156 PHE n 1 157 LEU n 1 158 GLY n 1 159 HIS n 1 160 ASP n 1 161 GLU n 1 162 PHE n 1 163 THR n 1 164 ARG n 1 165 VAL n 1 166 LYS n 1 167 PRO n 1 168 SER n 1 169 ALA n 1 170 ALA n 1 171 ASP n 1 172 VAL n 1 173 GLU n 1 174 LYS n 1 175 ALA n 1 176 ARG n 1 177 GLN n 1 178 LEU n 1 179 GLY n 1 180 VAL n 1 181 THR n 1 182 SER n 1 183 ALA n 1 184 ASN n 1 185 PRO n 1 186 PRO n 1 187 ALA n 1 188 SER n 1 189 ASP n 1 190 GLY n 1 191 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 191 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ADK98_07690 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces sp. H036' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1519487 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0M8UVL7_9ACTN _struct_ref.pdbx_db_accession A0A0M8UVL7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTRVRQALVALCALSLTFVTVSASASADPRETVSADAAETGSATESRPGILGTWYNQLGSVMVVTRAANGGFVGTYESAV GNAEKRYVMTGRYDSAPADGTGTAVGWTVAYRNAHRNAHSVATWSGQYVGGSQERIVTQWLLSYGTTPADQWKSTFLGHD EFTRVKPSAADVEKARQLGVTSANPPASDGE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CPZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 191 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0M8UVL7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 191 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BTN non-polymer . BIOTIN ? 'C10 H16 N2 O3 S' 244.311 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CPZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.56 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 21.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details PEG3350 _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-05-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9794 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 11C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9794 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 11C _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7CPZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 41 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4763 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.51 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.335 _reflns.pdbx_Rpim_I_all 0.09 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 229 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.258 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 32.38 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CPZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5 _refine.ls_d_res_low 37.42 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4763 _refine.ls_number_reflns_R_free 221 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2085 _refine.ls_R_factor_R_free 0.2611 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.206 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2BC3 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 921 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 986 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 37.42 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0052 ? 964 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8562 ? 1314 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0559 ? 139 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0034 ? 167 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 22.7386 ? 332 ? f_dihedral_angle_d ? ? # _struct.entry_id 7CPZ _struct.title 'Crystal structure of Streptoavidin-C1 from Streptomyces cinamonensis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CPZ _struct_keywords.text 'Avidin, Antifungal, Biotin, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 147 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 153 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 147 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 153 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 132 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 132 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLN _struct_mon_prot_cis.pdbx_label_seq_id_2 133 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLN _struct_mon_prot_cis.pdbx_auth_seq_id_2 133 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.52 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 52 ? ASN A 56 ? GLY A 52 ASN A 56 AA1 2 VAL A 61 ? ALA A 68 ? VAL A 61 ALA A 68 AA1 3 GLY A 71 ? GLU A 77 ? GLY A 71 GLU A 77 AA1 4 TYR A 87 ? TYR A 93 ? TYR A 87 TYR A 93 AA1 5 THR A 103 ? ARG A 112 ? THR A 103 ARG A 112 AA1 6 ASN A 117 ? VAL A 129 ? ASN A 117 VAL A 129 AA1 7 ARG A 135 ? TYR A 144 ? ARG A 135 TYR A 144 AA1 8 THR A 155 ? THR A 163 ? THR A 155 THR A 163 AA1 9 GLY A 52 ? ASN A 56 ? GLY A 52 ASN A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 52 ? N GLY A 52 O VAL A 64 ? O VAL A 64 AA1 2 3 N VAL A 61 ? N VAL A 61 O GLU A 77 ? O GLU A 77 AA1 3 4 N PHE A 72 ? N PHE A 72 O GLY A 91 ? O GLY A 91 AA1 4 5 N THR A 90 ? N THR A 90 O THR A 108 ? O THR A 108 AA1 5 6 N THR A 103 ? N THR A 103 O TYR A 128 ? O TYR A 128 AA1 6 7 N VAL A 129 ? N VAL A 129 O ARG A 135 ? O ARG A 135 AA1 7 8 N ILE A 136 ? N ILE A 136 O PHE A 162 ? O PHE A 162 AA1 8 9 O THR A 163 ? O THR A 163 N TYR A 55 ? N TYR A 55 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BTN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'binding site for residue BTN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ASN A 56 ? ASN A 56 . ? 1_555 ? 2 AC1 14 SER A 60 ? SER A 60 . ? 1_555 ? 3 AC1 14 TYR A 76 ? TYR A 76 . ? 1_555 ? 4 AC1 14 SER A 78 ? SER A 78 . ? 1_555 ? 5 AC1 14 GLY A 81 ? GLY A 81 . ? 1_555 ? 6 AC1 14 ASN A 82 ? ASN A 82 . ? 1_555 ? 7 AC1 14 TYR A 111 ? TYR A 111 . ? 1_555 ? 8 AC1 14 ALA A 118 ? ALA A 118 . ? 1_555 ? 9 AC1 14 SER A 120 ? SER A 120 . ? 1_555 ? 10 AC1 14 TRP A 124 ? TRP A 124 . ? 1_555 ? 11 AC1 14 TRP A 140 ? TRP A 140 . ? 1_555 ? 12 AC1 14 TYR A 144 ? TYR A 144 . ? 1_555 ? 13 AC1 14 TRP A 152 ? TRP A 152 . ? 2_645 ? 14 AC1 14 ASP A 160 ? ASP A 160 . ? 1_555 ? # _atom_sites.entry_id 7CPZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017242 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017242 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013361 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 CYS 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 THR 17 17 ? ? ? A . n A 1 18 PHE 18 18 ? ? ? A . n A 1 19 VAL 19 19 ? ? ? A . n A 1 20 THR 20 20 ? ? ? A . n A 1 21 VAL 21 21 ? ? ? A . n A 1 22 SER 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 ALA 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 PRO 29 29 ? ? ? A . n A 1 30 ARG 30 30 ? ? ? A . n A 1 31 GLU 31 31 ? ? ? A . n A 1 32 THR 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 SER 34 34 ? ? ? A . n A 1 35 ALA 35 35 ? ? ? A . n A 1 36 ASP 36 36 ? ? ? A . n A 1 37 ALA 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 GLU 39 39 ? ? ? A . n A 1 40 THR 40 40 ? ? ? A . n A 1 41 GLY 41 41 ? ? ? A . n A 1 42 SER 42 42 ? ? ? A . n A 1 43 ALA 43 43 ? ? ? A . n A 1 44 THR 44 44 ? ? ? A . n A 1 45 GLU 45 45 ? ? ? A . n A 1 46 SER 46 46 ? ? ? A . n A 1 47 ARG 47 47 ? ? ? A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 TRP 124 124 124 TRP TRP A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 SER 168 168 ? ? ? A . n A 1 169 ALA 169 169 ? ? ? A . n A 1 170 ALA 170 170 ? ? ? A . n A 1 171 ASP 171 171 ? ? ? A . n A 1 172 VAL 172 172 ? ? ? A . n A 1 173 GLU 173 173 ? ? ? A . n A 1 174 LYS 174 174 ? ? ? A . n A 1 175 ALA 175 175 ? ? ? A . n A 1 176 ARG 176 176 ? ? ? A . n A 1 177 GLN 177 177 ? ? ? A . n A 1 178 LEU 178 178 ? ? ? A . n A 1 179 GLY 179 179 ? ? ? A . n A 1 180 VAL 180 180 ? ? ? A . n A 1 181 THR 181 181 ? ? ? A . n A 1 182 SER 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 ASN 184 184 ? ? ? A . n A 1 185 PRO 185 185 ? ? ? A . n A 1 186 PRO 186 186 ? ? ? A . n A 1 187 ALA 187 187 ? ? ? A . n A 1 188 SER 188 188 ? ? ? A . n A 1 189 ASP 189 189 ? ? ? A . n A 1 190 GLY 190 190 ? ? ? A . n A 1 191 GLU 191 191 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BTN 1 201 1 BTN BTN A . C 3 HOH 1 301 33 HOH HOH A . C 3 HOH 2 302 41 HOH HOH A . C 3 HOH 3 303 38 HOH HOH A . C 3 HOH 4 304 23 HOH HOH A . C 3 HOH 5 305 6 HOH HOH A . C 3 HOH 6 306 13 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 1 HOH HOH A . C 3 HOH 9 309 3 HOH HOH A . C 3 HOH 10 310 20 HOH HOH A . C 3 HOH 11 311 19 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 14 HOH HOH A . C 3 HOH 14 314 15 HOH HOH A . C 3 HOH 15 315 5 HOH HOH A . C 3 HOH 16 316 10 HOH HOH A . C 3 HOH 17 317 17 HOH HOH A . C 3 HOH 18 318 48 HOH HOH A . C 3 HOH 19 319 21 HOH HOH A . C 3 HOH 20 320 4 HOH HOH A . C 3 HOH 21 321 27 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 8 HOH HOH A . C 3 HOH 24 324 2 HOH HOH A . C 3 HOH 25 325 30 HOH HOH A . C 3 HOH 26 326 28 HOH HOH A . C 3 HOH 27 327 32 HOH HOH A . C 3 HOH 28 328 18 HOH HOH A . C 3 HOH 29 329 11 HOH HOH A . C 3 HOH 30 330 31 HOH HOH A . C 3 HOH 31 331 43 HOH HOH A . C 3 HOH 32 332 40 HOH HOH A . C 3 HOH 33 333 26 HOH HOH A . C 3 HOH 34 334 49 HOH HOH A . C 3 HOH 35 335 42 HOH HOH A . C 3 HOH 36 336 16 HOH HOH A . C 3 HOH 37 337 39 HOH HOH A . C 3 HOH 38 338 9 HOH HOH A . C 3 HOH 39 339 44 HOH HOH A . C 3 HOH 40 340 34 HOH HOH A . C 3 HOH 41 341 46 HOH HOH A . C 3 HOH 42 342 29 HOH HOH A . C 3 HOH 43 343 36 HOH HOH A . C 3 HOH 44 344 37 HOH HOH A . C 3 HOH 45 345 35 HOH HOH A . C 3 HOH 46 346 25 HOH HOH A . C 3 HOH 47 347 24 HOH HOH A . C 3 HOH 48 348 45 HOH HOH A . C 3 HOH 49 349 47 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9540 ? 1 MORE -49 ? 1 'SSA (A^2)' 19140 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_645 -x+1,-y-1,z -1.0000000000 0.0000000000 0.0000000000 57.9970000000 0.0000000000 -1.0000000000 0.0000000000 -57.9970000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_645 y+1,x-1,-z 0.0000000000 1.0000000000 0.0000000000 57.9970000000 1.0000000000 0.0000000000 0.0000000000 -57.9970000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-14 2 'Structure model' 1 1 2021-07-21 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_struct_assembly 2 2 'Structure model' pdbx_struct_assembly_gen 3 2 'Structure model' pdbx_struct_assembly_prop 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 8 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_struct_assembly.details' 2 2 'Structure model' '_pdbx_struct_assembly.method_details' 3 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 2 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/2 3 y+1/2,-x+1/2,z+1/2 4 x+1/2,-y+1/2,-z+1/2 5 -x+1/2,y+1/2,-z+1/2 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2-3874 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7CPZ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 339 ? ? O A HOH 341 ? ? 1.81 2 1 O A HOH 331 ? ? O A HOH 346 ? ? 1.97 3 1 O A HOH 327 ? ? O A HOH 348 ? ? 2.04 4 1 O A HOH 323 ? ? O A HOH 336 ? ? 2.13 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 85 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 60.40 _pdbx_validate_torsion.psi -151.75 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A CYS 12 ? A CYS 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A THR 17 ? A THR 17 18 1 Y 1 A PHE 18 ? A PHE 18 19 1 Y 1 A VAL 19 ? A VAL 19 20 1 Y 1 A THR 20 ? A THR 20 21 1 Y 1 A VAL 21 ? A VAL 21 22 1 Y 1 A SER 22 ? A SER 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A ALA 25 ? A ALA 25 26 1 Y 1 A SER 26 ? A SER 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A PRO 29 ? A PRO 29 30 1 Y 1 A ARG 30 ? A ARG 30 31 1 Y 1 A GLU 31 ? A GLU 31 32 1 Y 1 A THR 32 ? A THR 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A SER 34 ? A SER 34 35 1 Y 1 A ALA 35 ? A ALA 35 36 1 Y 1 A ASP 36 ? A ASP 36 37 1 Y 1 A ALA 37 ? A ALA 37 38 1 Y 1 A ALA 38 ? A ALA 38 39 1 Y 1 A GLU 39 ? A GLU 39 40 1 Y 1 A THR 40 ? A THR 40 41 1 Y 1 A GLY 41 ? A GLY 41 42 1 Y 1 A SER 42 ? A SER 42 43 1 Y 1 A ALA 43 ? A ALA 43 44 1 Y 1 A THR 44 ? A THR 44 45 1 Y 1 A GLU 45 ? A GLU 45 46 1 Y 1 A SER 46 ? A SER 46 47 1 Y 1 A ARG 47 ? A ARG 47 48 1 Y 1 A SER 168 ? A SER 168 49 1 Y 1 A ALA 169 ? A ALA 169 50 1 Y 1 A ALA 170 ? A ALA 170 51 1 Y 1 A ASP 171 ? A ASP 171 52 1 Y 1 A VAL 172 ? A VAL 172 53 1 Y 1 A GLU 173 ? A GLU 173 54 1 Y 1 A LYS 174 ? A LYS 174 55 1 Y 1 A ALA 175 ? A ALA 175 56 1 Y 1 A ARG 176 ? A ARG 176 57 1 Y 1 A GLN 177 ? A GLN 177 58 1 Y 1 A LEU 178 ? A LEU 178 59 1 Y 1 A GLY 179 ? A GLY 179 60 1 Y 1 A VAL 180 ? A VAL 180 61 1 Y 1 A THR 181 ? A THR 181 62 1 Y 1 A SER 182 ? A SER 182 63 1 Y 1 A ALA 183 ? A ALA 183 64 1 Y 1 A ASN 184 ? A ASN 184 65 1 Y 1 A PRO 185 ? A PRO 185 66 1 Y 1 A PRO 186 ? A PRO 186 67 1 Y 1 A ALA 187 ? A ALA 187 68 1 Y 1 A SER 188 ? A SER 188 69 1 Y 1 A ASP 189 ? A ASP 189 70 1 Y 1 A GLY 190 ? A GLY 190 71 1 Y 1 A GLU 191 ? A GLU 191 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BTN C11 C N N 74 BTN O11 O N N 75 BTN O12 O N N 76 BTN C10 C N N 77 BTN C9 C N N 78 BTN C8 C N N 79 BTN C7 C N N 80 BTN C2 C N S 81 BTN S1 S N N 82 BTN C6 C N N 83 BTN C5 C N R 84 BTN N1 N N N 85 BTN C3 C N N 86 BTN O3 O N N 87 BTN N2 N N N 88 BTN C4 C N S 89 BTN HO2 H N N 90 BTN H101 H N N 91 BTN H102 H N N 92 BTN H91 H N N 93 BTN H92 H N N 94 BTN H81 H N N 95 BTN H82 H N N 96 BTN H71 H N N 97 BTN H72 H N N 98 BTN H2 H N N 99 BTN H61 H N N 100 BTN H62 H N N 101 BTN H5 H N N 102 BTN HN1 H N N 103 BTN HN2 H N N 104 BTN H4 H N N 105 CYS N N N N 106 CYS CA C N R 107 CYS C C N N 108 CYS O O N N 109 CYS CB C N N 110 CYS SG S N N 111 CYS OXT O N N 112 CYS H H N N 113 CYS H2 H N N 114 CYS HA H N N 115 CYS HB2 H N N 116 CYS HB3 H N N 117 CYS HG H N N 118 CYS HXT H N N 119 GLN N N N N 120 GLN CA C N S 121 GLN C C N N 122 GLN O O N N 123 GLN CB C N N 124 GLN CG C N N 125 GLN CD C N N 126 GLN OE1 O N N 127 GLN NE2 N N N 128 GLN OXT O N N 129 GLN H H N N 130 GLN H2 H N N 131 GLN HA H N N 132 GLN HB2 H N N 133 GLN HB3 H N N 134 GLN HG2 H N N 135 GLN HG3 H N N 136 GLN HE21 H N N 137 GLN HE22 H N N 138 GLN HXT H N N 139 GLU N N N N 140 GLU CA C N S 141 GLU C C N N 142 GLU O O N N 143 GLU CB C N N 144 GLU CG C N N 145 GLU CD C N N 146 GLU OE1 O N N 147 GLU OE2 O N N 148 GLU OXT O N N 149 GLU H H N N 150 GLU H2 H N N 151 GLU HA H N N 152 GLU HB2 H N N 153 GLU HB3 H N N 154 GLU HG2 H N N 155 GLU HG3 H N N 156 GLU HE2 H N N 157 GLU HXT H N N 158 GLY N N N N 159 GLY CA C N N 160 GLY C C N N 161 GLY O O N N 162 GLY OXT O N N 163 GLY H H N N 164 GLY H2 H N N 165 GLY HA2 H N N 166 GLY HA3 H N N 167 GLY HXT H N N 168 HIS N N N N 169 HIS CA C N S 170 HIS C C N N 171 HIS O O N N 172 HIS CB C N N 173 HIS CG C Y N 174 HIS ND1 N Y N 175 HIS CD2 C Y N 176 HIS CE1 C Y N 177 HIS NE2 N Y N 178 HIS OXT O N N 179 HIS H H N N 180 HIS H2 H N N 181 HIS HA H N N 182 HIS HB2 H N N 183 HIS HB3 H N N 184 HIS HD1 H N N 185 HIS HD2 H N N 186 HIS HE1 H N N 187 HIS HE2 H N N 188 HIS HXT H N N 189 HOH O O N N 190 HOH H1 H N N 191 HOH H2 H N N 192 ILE N N N N 193 ILE CA C N S 194 ILE C C N N 195 ILE O O N N 196 ILE CB C N S 197 ILE CG1 C N N 198 ILE CG2 C N N 199 ILE CD1 C N N 200 ILE OXT O N N 201 ILE H H N N 202 ILE H2 H N N 203 ILE HA H N N 204 ILE HB H N N 205 ILE HG12 H N N 206 ILE HG13 H N N 207 ILE HG21 H N N 208 ILE HG22 H N N 209 ILE HG23 H N N 210 ILE HD11 H N N 211 ILE HD12 H N N 212 ILE HD13 H N N 213 ILE HXT H N N 214 LEU N N N N 215 LEU CA C N S 216 LEU C C N N 217 LEU O O N N 218 LEU CB C N N 219 LEU CG C N N 220 LEU CD1 C N N 221 LEU CD2 C N N 222 LEU OXT O N N 223 LEU H H N N 224 LEU H2 H N N 225 LEU HA H N N 226 LEU HB2 H N N 227 LEU HB3 H N N 228 LEU HG H N N 229 LEU HD11 H N N 230 LEU HD12 H N N 231 LEU HD13 H N N 232 LEU HD21 H N N 233 LEU HD22 H N N 234 LEU HD23 H N N 235 LEU HXT H N N 236 LYS N N N N 237 LYS CA C N S 238 LYS C C N N 239 LYS O O N N 240 LYS CB C N N 241 LYS CG C N N 242 LYS CD C N N 243 LYS CE C N N 244 LYS NZ N N N 245 LYS OXT O N N 246 LYS H H N N 247 LYS H2 H N N 248 LYS HA H N N 249 LYS HB2 H N N 250 LYS HB3 H N N 251 LYS HG2 H N N 252 LYS HG3 H N N 253 LYS HD2 H N N 254 LYS HD3 H N N 255 LYS HE2 H N N 256 LYS HE3 H N N 257 LYS HZ1 H N N 258 LYS HZ2 H N N 259 LYS HZ3 H N N 260 LYS HXT H N N 261 MET N N N N 262 MET CA C N S 263 MET C C N N 264 MET O O N N 265 MET CB C N N 266 MET CG C N N 267 MET SD S N N 268 MET CE C N N 269 MET OXT O N N 270 MET H H N N 271 MET H2 H N N 272 MET HA H N N 273 MET HB2 H N N 274 MET HB3 H N N 275 MET HG2 H N N 276 MET HG3 H N N 277 MET HE1 H N N 278 MET HE2 H N N 279 MET HE3 H N N 280 MET HXT H N N 281 PHE N N N N 282 PHE CA C N S 283 PHE C C N N 284 PHE O O N N 285 PHE CB C N N 286 PHE CG C Y N 287 PHE CD1 C Y N 288 PHE CD2 C Y N 289 PHE CE1 C Y N 290 PHE CE2 C Y N 291 PHE CZ C Y N 292 PHE OXT O N N 293 PHE H H N N 294 PHE H2 H N N 295 PHE HA H N N 296 PHE HB2 H N N 297 PHE HB3 H N N 298 PHE HD1 H N N 299 PHE HD2 H N N 300 PHE HE1 H N N 301 PHE HE2 H N N 302 PHE HZ H N N 303 PHE HXT H N N 304 PRO N N N N 305 PRO CA C N S 306 PRO C C N N 307 PRO O O N N 308 PRO CB C N N 309 PRO CG C N N 310 PRO CD C N N 311 PRO OXT O N N 312 PRO H H N N 313 PRO HA H N N 314 PRO HB2 H N N 315 PRO HB3 H N N 316 PRO HG2 H N N 317 PRO HG3 H N N 318 PRO HD2 H N N 319 PRO HD3 H N N 320 PRO HXT H N N 321 SER N N N N 322 SER CA C N S 323 SER C C N N 324 SER O O N N 325 SER CB C N N 326 SER OG O N N 327 SER OXT O N N 328 SER H H N N 329 SER H2 H N N 330 SER HA H N N 331 SER HB2 H N N 332 SER HB3 H N N 333 SER HG H N N 334 SER HXT H N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TRP N N N N 353 TRP CA C N S 354 TRP C C N N 355 TRP O O N N 356 TRP CB C N N 357 TRP CG C Y N 358 TRP CD1 C Y N 359 TRP CD2 C Y N 360 TRP NE1 N Y N 361 TRP CE2 C Y N 362 TRP CE3 C Y N 363 TRP CZ2 C Y N 364 TRP CZ3 C Y N 365 TRP CH2 C Y N 366 TRP OXT O N N 367 TRP H H N N 368 TRP H2 H N N 369 TRP HA H N N 370 TRP HB2 H N N 371 TRP HB3 H N N 372 TRP HD1 H N N 373 TRP HE1 H N N 374 TRP HE3 H N N 375 TRP HZ2 H N N 376 TRP HZ3 H N N 377 TRP HH2 H N N 378 TRP HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BTN C11 O11 doub N N 70 BTN C11 O12 sing N N 71 BTN C11 C10 sing N N 72 BTN O12 HO2 sing N N 73 BTN C10 C9 sing N N 74 BTN C10 H101 sing N N 75 BTN C10 H102 sing N N 76 BTN C9 C8 sing N N 77 BTN C9 H91 sing N N 78 BTN C9 H92 sing N N 79 BTN C8 C7 sing N N 80 BTN C8 H81 sing N N 81 BTN C8 H82 sing N N 82 BTN C7 C2 sing N N 83 BTN C7 H71 sing N N 84 BTN C7 H72 sing N N 85 BTN C2 S1 sing N N 86 BTN C2 C4 sing N N 87 BTN C2 H2 sing N N 88 BTN S1 C6 sing N N 89 BTN C6 C5 sing N N 90 BTN C6 H61 sing N N 91 BTN C6 H62 sing N N 92 BTN C5 N1 sing N N 93 BTN C5 C4 sing N N 94 BTN C5 H5 sing N N 95 BTN N1 C3 sing N N 96 BTN N1 HN1 sing N N 97 BTN C3 O3 doub N N 98 BTN C3 N2 sing N N 99 BTN N2 C4 sing N N 100 BTN N2 HN2 sing N N 101 BTN C4 H4 sing N N 102 CYS N CA sing N N 103 CYS N H sing N N 104 CYS N H2 sing N N 105 CYS CA C sing N N 106 CYS CA CB sing N N 107 CYS CA HA sing N N 108 CYS C O doub N N 109 CYS C OXT sing N N 110 CYS CB SG sing N N 111 CYS CB HB2 sing N N 112 CYS CB HB3 sing N N 113 CYS SG HG sing N N 114 CYS OXT HXT sing N N 115 GLN N CA sing N N 116 GLN N H sing N N 117 GLN N H2 sing N N 118 GLN CA C sing N N 119 GLN CA CB sing N N 120 GLN CA HA sing N N 121 GLN C O doub N N 122 GLN C OXT sing N N 123 GLN CB CG sing N N 124 GLN CB HB2 sing N N 125 GLN CB HB3 sing N N 126 GLN CG CD sing N N 127 GLN CG HG2 sing N N 128 GLN CG HG3 sing N N 129 GLN CD OE1 doub N N 130 GLN CD NE2 sing N N 131 GLN NE2 HE21 sing N N 132 GLN NE2 HE22 sing N N 133 GLN OXT HXT sing N N 134 GLU N CA sing N N 135 GLU N H sing N N 136 GLU N H2 sing N N 137 GLU CA C sing N N 138 GLU CA CB sing N N 139 GLU CA HA sing N N 140 GLU C O doub N N 141 GLU C OXT sing N N 142 GLU CB CG sing N N 143 GLU CB HB2 sing N N 144 GLU CB HB3 sing N N 145 GLU CG CD sing N N 146 GLU CG HG2 sing N N 147 GLU CG HG3 sing N N 148 GLU CD OE1 doub N N 149 GLU CD OE2 sing N N 150 GLU OE2 HE2 sing N N 151 GLU OXT HXT sing N N 152 GLY N CA sing N N 153 GLY N H sing N N 154 GLY N H2 sing N N 155 GLY CA C sing N N 156 GLY CA HA2 sing N N 157 GLY CA HA3 sing N N 158 GLY C O doub N N 159 GLY C OXT sing N N 160 GLY OXT HXT sing N N 161 HIS N CA sing N N 162 HIS N H sing N N 163 HIS N H2 sing N N 164 HIS CA C sing N N 165 HIS CA CB sing N N 166 HIS CA HA sing N N 167 HIS C O doub N N 168 HIS C OXT sing N N 169 HIS CB CG sing N N 170 HIS CB HB2 sing N N 171 HIS CB HB3 sing N N 172 HIS CG ND1 sing Y N 173 HIS CG CD2 doub Y N 174 HIS ND1 CE1 doub Y N 175 HIS ND1 HD1 sing N N 176 HIS CD2 NE2 sing Y N 177 HIS CD2 HD2 sing N N 178 HIS CE1 NE2 sing Y N 179 HIS CE1 HE1 sing N N 180 HIS NE2 HE2 sing N N 181 HIS OXT HXT sing N N 182 HOH O H1 sing N N 183 HOH O H2 sing N N 184 ILE N CA sing N N 185 ILE N H sing N N 186 ILE N H2 sing N N 187 ILE CA C sing N N 188 ILE CA CB sing N N 189 ILE CA HA sing N N 190 ILE C O doub N N 191 ILE C OXT sing N N 192 ILE CB CG1 sing N N 193 ILE CB CG2 sing N N 194 ILE CB HB sing N N 195 ILE CG1 CD1 sing N N 196 ILE CG1 HG12 sing N N 197 ILE CG1 HG13 sing N N 198 ILE CG2 HG21 sing N N 199 ILE CG2 HG22 sing N N 200 ILE CG2 HG23 sing N N 201 ILE CD1 HD11 sing N N 202 ILE CD1 HD12 sing N N 203 ILE CD1 HD13 sing N N 204 ILE OXT HXT sing N N 205 LEU N CA sing N N 206 LEU N H sing N N 207 LEU N H2 sing N N 208 LEU CA C sing N N 209 LEU CA CB sing N N 210 LEU CA HA sing N N 211 LEU C O doub N N 212 LEU C OXT sing N N 213 LEU CB CG sing N N 214 LEU CB HB2 sing N N 215 LEU CB HB3 sing N N 216 LEU CG CD1 sing N N 217 LEU CG CD2 sing N N 218 LEU CG HG sing N N 219 LEU CD1 HD11 sing N N 220 LEU CD1 HD12 sing N N 221 LEU CD1 HD13 sing N N 222 LEU CD2 HD21 sing N N 223 LEU CD2 HD22 sing N N 224 LEU CD2 HD23 sing N N 225 LEU OXT HXT sing N N 226 LYS N CA sing N N 227 LYS N H sing N N 228 LYS N H2 sing N N 229 LYS CA C sing N N 230 LYS CA CB sing N N 231 LYS CA HA sing N N 232 LYS C O doub N N 233 LYS C OXT sing N N 234 LYS CB CG sing N N 235 LYS CB HB2 sing N N 236 LYS CB HB3 sing N N 237 LYS CG CD sing N N 238 LYS CG HG2 sing N N 239 LYS CG HG3 sing N N 240 LYS CD CE sing N N 241 LYS CD HD2 sing N N 242 LYS CD HD3 sing N N 243 LYS CE NZ sing N N 244 LYS CE HE2 sing N N 245 LYS CE HE3 sing N N 246 LYS NZ HZ1 sing N N 247 LYS NZ HZ2 sing N N 248 LYS NZ HZ3 sing N N 249 LYS OXT HXT sing N N 250 MET N CA sing N N 251 MET N H sing N N 252 MET N H2 sing N N 253 MET CA C sing N N 254 MET CA CB sing N N 255 MET CA HA sing N N 256 MET C O doub N N 257 MET C OXT sing N N 258 MET CB CG sing N N 259 MET CB HB2 sing N N 260 MET CB HB3 sing N N 261 MET CG SD sing N N 262 MET CG HG2 sing N N 263 MET CG HG3 sing N N 264 MET SD CE sing N N 265 MET CE HE1 sing N N 266 MET CE HE2 sing N N 267 MET CE HE3 sing N N 268 MET OXT HXT sing N N 269 PHE N CA sing N N 270 PHE N H sing N N 271 PHE N H2 sing N N 272 PHE CA C sing N N 273 PHE CA CB sing N N 274 PHE CA HA sing N N 275 PHE C O doub N N 276 PHE C OXT sing N N 277 PHE CB CG sing N N 278 PHE CB HB2 sing N N 279 PHE CB HB3 sing N N 280 PHE CG CD1 doub Y N 281 PHE CG CD2 sing Y N 282 PHE CD1 CE1 sing Y N 283 PHE CD1 HD1 sing N N 284 PHE CD2 CE2 doub Y N 285 PHE CD2 HD2 sing N N 286 PHE CE1 CZ doub Y N 287 PHE CE1 HE1 sing N N 288 PHE CE2 CZ sing Y N 289 PHE CE2 HE2 sing N N 290 PHE CZ HZ sing N N 291 PHE OXT HXT sing N N 292 PRO N CA sing N N 293 PRO N CD sing N N 294 PRO N H sing N N 295 PRO CA C sing N N 296 PRO CA CB sing N N 297 PRO CA HA sing N N 298 PRO C O doub N N 299 PRO C OXT sing N N 300 PRO CB CG sing N N 301 PRO CB HB2 sing N N 302 PRO CB HB3 sing N N 303 PRO CG CD sing N N 304 PRO CG HG2 sing N N 305 PRO CG HG3 sing N N 306 PRO CD HD2 sing N N 307 PRO CD HD3 sing N N 308 PRO OXT HXT sing N N 309 SER N CA sing N N 310 SER N H sing N N 311 SER N H2 sing N N 312 SER CA C sing N N 313 SER CA CB sing N N 314 SER CA HA sing N N 315 SER C O doub N N 316 SER C OXT sing N N 317 SER CB OG sing N N 318 SER CB HB2 sing N N 319 SER CB HB3 sing N N 320 SER OG HG sing N N 321 SER OXT HXT sing N N 322 THR N CA sing N N 323 THR N H sing N N 324 THR N H2 sing N N 325 THR CA C sing N N 326 THR CA CB sing N N 327 THR CA HA sing N N 328 THR C O doub N N 329 THR C OXT sing N N 330 THR CB OG1 sing N N 331 THR CB CG2 sing N N 332 THR CB HB sing N N 333 THR OG1 HG1 sing N N 334 THR CG2 HG21 sing N N 335 THR CG2 HG22 sing N N 336 THR CG2 HG23 sing N N 337 THR OXT HXT sing N N 338 TRP N CA sing N N 339 TRP N H sing N N 340 TRP N H2 sing N N 341 TRP CA C sing N N 342 TRP CA CB sing N N 343 TRP CA HA sing N N 344 TRP C O doub N N 345 TRP C OXT sing N N 346 TRP CB CG sing N N 347 TRP CB HB2 sing N N 348 TRP CB HB3 sing N N 349 TRP CG CD1 doub Y N 350 TRP CG CD2 sing Y N 351 TRP CD1 NE1 sing Y N 352 TRP CD1 HD1 sing N N 353 TRP CD2 CE2 doub Y N 354 TRP CD2 CE3 sing Y N 355 TRP NE1 CE2 sing Y N 356 TRP NE1 HE1 sing N N 357 TRP CE2 CZ2 sing Y N 358 TRP CE3 CZ3 doub Y N 359 TRP CE3 HE3 sing N N 360 TRP CZ2 CH2 doub Y N 361 TRP CZ2 HZ2 sing N N 362 TRP CZ3 CH2 sing Y N 363 TRP CZ3 HZ3 sing N N 364 TRP CH2 HH2 sing N N 365 TRP OXT HXT sing N N 366 TYR N CA sing N N 367 TYR N H sing N N 368 TYR N H2 sing N N 369 TYR CA C sing N N 370 TYR CA CB sing N N 371 TYR CA HA sing N N 372 TYR C O doub N N 373 TYR C OXT sing N N 374 TYR CB CG sing N N 375 TYR CB HB2 sing N N 376 TYR CB HB3 sing N N 377 TYR CG CD1 doub Y N 378 TYR CG CD2 sing Y N 379 TYR CD1 CE1 sing Y N 380 TYR CD1 HD1 sing N N 381 TYR CD2 CE2 doub Y N 382 TYR CD2 HD2 sing N N 383 TYR CE1 CZ doub Y N 384 TYR CE1 HE1 sing N N 385 TYR CE2 CZ sing Y N 386 TYR CE2 HE2 sing N N 387 TYR CZ OH sing N N 388 TYR OH HH sing N N 389 TYR OXT HXT sing N N 390 VAL N CA sing N N 391 VAL N H sing N N 392 VAL N H2 sing N N 393 VAL CA C sing N N 394 VAL CA CB sing N N 395 VAL CA HA sing N N 396 VAL C O doub N N 397 VAL C OXT sing N N 398 VAL CB CG1 sing N N 399 VAL CB CG2 sing N N 400 VAL CB HB sing N N 401 VAL CG1 HG11 sing N N 402 VAL CG1 HG12 sing N N 403 VAL CG1 HG13 sing N N 404 VAL CG2 HG21 sing N N 405 VAL CG2 HG22 sing N N 406 VAL CG2 HG23 sing N N 407 VAL OXT HXT sing N N 408 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BTN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BTN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 BIOTIN BTN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2BC3 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.crystal_system tetragonal _space_group.name_H-M_alt 'P 42 21 2' _space_group.IT_number 94 _space_group.name_Hall 'P 4n 2n' _space_group.id 1 #