data_7CXK # _entry.id 7CXK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CXK pdb_00007cxk 10.2210/pdb7cxk/pdb WWPDB D_1300018396 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CXK _pdbx_database_status.recvd_initial_deposition_date 2020-09-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jang, D.M.' 1 0000-0003-0701-0503 'Han, B.W.' 2 0000-0001-7571-3791 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The ligand-free structure of human PPARgamma LBD' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jang, D.M.' 1 0000-0003-0701-0503 primary 'Han, B.W.' 2 0000-0001-7571-3791 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CXK _cell.details ? _cell.formula_units_Z ? _cell.length_a 130.396 _cell.length_a_esd ? _cell.length_b 51.997 _cell.length_b_esd ? _cell.length_c 54.052 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CXK _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peroxisome proliferator-activated receptor gamma' 32261.303 1 ? ? ? ? 2 polymer syn '16-mer peptide from Nuclear receptor coactivator 1' 1905.186 1 2.3.1.48 ? ? ? 3 non-polymer syn 'MALONATE ION' 102.046 1 ? ? ? ? 4 water nat water 18.015 77 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PPAR-gamma,Nuclear receptor subfamily 1 group C member 3' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQS KEVAIRIFQGCQFHSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLK SLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAK LLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; ;AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQS KEVAIRIFQGCQFHSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLK SLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAK LLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; A ? 2 'polypeptide(L)' no no ERHKILHRLLQEGSPS ERHKILHRLLQEGSPS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 ILE n 1 4 SER n 1 5 SER n 1 6 ASP n 1 7 ILE n 1 8 ASP n 1 9 GLN n 1 10 LEU n 1 11 ASN n 1 12 PRO n 1 13 GLU n 1 14 SER n 1 15 ALA n 1 16 ASP n 1 17 LEU n 1 18 ARG n 1 19 ALA n 1 20 LEU n 1 21 ALA n 1 22 LYS n 1 23 HIS n 1 24 LEU n 1 25 TYR n 1 26 ASP n 1 27 SER n 1 28 TYR n 1 29 ILE n 1 30 LYS n 1 31 SER n 1 32 PHE n 1 33 PRO n 1 34 LEU n 1 35 THR n 1 36 LYS n 1 37 ALA n 1 38 LYS n 1 39 ALA n 1 40 ARG n 1 41 ALA n 1 42 ILE n 1 43 LEU n 1 44 THR n 1 45 GLY n 1 46 LYS n 1 47 THR n 1 48 THR n 1 49 ASP n 1 50 LYS n 1 51 SER n 1 52 PRO n 1 53 PHE n 1 54 VAL n 1 55 ILE n 1 56 TYR n 1 57 ASP n 1 58 MET n 1 59 ASN n 1 60 SER n 1 61 LEU n 1 62 MET n 1 63 MET n 1 64 GLY n 1 65 GLU n 1 66 ASP n 1 67 LYS n 1 68 ILE n 1 69 LYS n 1 70 PHE n 1 71 LYS n 1 72 HIS n 1 73 ILE n 1 74 THR n 1 75 PRO n 1 76 LEU n 1 77 GLN n 1 78 GLU n 1 79 GLN n 1 80 SER n 1 81 LYS n 1 82 GLU n 1 83 VAL n 1 84 ALA n 1 85 ILE n 1 86 ARG n 1 87 ILE n 1 88 PHE n 1 89 GLN n 1 90 GLY n 1 91 CYS n 1 92 GLN n 1 93 PHE n 1 94 HIS n 1 95 SER n 1 96 VAL n 1 97 GLU n 1 98 ALA n 1 99 VAL n 1 100 GLN n 1 101 GLU n 1 102 ILE n 1 103 THR n 1 104 GLU n 1 105 TYR n 1 106 ALA n 1 107 LYS n 1 108 SER n 1 109 ILE n 1 110 PRO n 1 111 GLY n 1 112 PHE n 1 113 VAL n 1 114 ASN n 1 115 LEU n 1 116 ASP n 1 117 LEU n 1 118 ASN n 1 119 ASP n 1 120 GLN n 1 121 VAL n 1 122 THR n 1 123 LEU n 1 124 LEU n 1 125 LYS n 1 126 TYR n 1 127 GLY n 1 128 VAL n 1 129 HIS n 1 130 GLU n 1 131 ILE n 1 132 ILE n 1 133 TYR n 1 134 THR n 1 135 MET n 1 136 LEU n 1 137 ALA n 1 138 SER n 1 139 LEU n 1 140 MET n 1 141 ASN n 1 142 LYS n 1 143 ASP n 1 144 GLY n 1 145 VAL n 1 146 LEU n 1 147 ILE n 1 148 SER n 1 149 GLU n 1 150 GLY n 1 151 GLN n 1 152 GLY n 1 153 PHE n 1 154 MET n 1 155 THR n 1 156 ARG n 1 157 GLU n 1 158 PHE n 1 159 LEU n 1 160 LYS n 1 161 SER n 1 162 LEU n 1 163 ARG n 1 164 LYS n 1 165 PRO n 1 166 PHE n 1 167 GLY n 1 168 ASP n 1 169 PHE n 1 170 MET n 1 171 GLU n 1 172 PRO n 1 173 LYS n 1 174 PHE n 1 175 GLU n 1 176 PHE n 1 177 ALA n 1 178 VAL n 1 179 LYS n 1 180 PHE n 1 181 ASN n 1 182 ALA n 1 183 LEU n 1 184 GLU n 1 185 LEU n 1 186 ASP n 1 187 ASP n 1 188 SER n 1 189 ASP n 1 190 LEU n 1 191 ALA n 1 192 ILE n 1 193 PHE n 1 194 ILE n 1 195 ALA n 1 196 VAL n 1 197 ILE n 1 198 ILE n 1 199 LEU n 1 200 SER n 1 201 GLY n 1 202 ASP n 1 203 ARG n 1 204 PRO n 1 205 GLY n 1 206 LEU n 1 207 LEU n 1 208 ASN n 1 209 VAL n 1 210 LYS n 1 211 PRO n 1 212 ILE n 1 213 GLU n 1 214 ASP n 1 215 ILE n 1 216 GLN n 1 217 ASP n 1 218 ASN n 1 219 LEU n 1 220 LEU n 1 221 GLN n 1 222 ALA n 1 223 LEU n 1 224 GLU n 1 225 LEU n 1 226 GLN n 1 227 LEU n 1 228 LYS n 1 229 LEU n 1 230 ASN n 1 231 HIS n 1 232 PRO n 1 233 GLU n 1 234 SER n 1 235 SER n 1 236 GLN n 1 237 LEU n 1 238 PHE n 1 239 ALA n 1 240 LYS n 1 241 LEU n 1 242 LEU n 1 243 GLN n 1 244 LYS n 1 245 MET n 1 246 THR n 1 247 ASP n 1 248 LEU n 1 249 ARG n 1 250 GLN n 1 251 ILE n 1 252 VAL n 1 253 THR n 1 254 GLU n 1 255 HIS n 1 256 VAL n 1 257 GLN n 1 258 LEU n 1 259 LEU n 1 260 GLN n 1 261 VAL n 1 262 ILE n 1 263 LYS n 1 264 LYS n 1 265 THR n 1 266 GLU n 1 267 THR n 1 268 ASP n 1 269 MET n 1 270 SER n 1 271 LEU n 1 272 HIS n 1 273 PRO n 1 274 LEU n 1 275 LEU n 1 276 GLN n 1 277 GLU n 1 278 ILE n 1 279 TYR n 1 280 LYS n 1 281 ASP n 1 282 LEU n 1 283 TYR n 2 1 GLU n 2 2 ARG n 2 3 HIS n 2 4 LYS n 2 5 ILE n 2 6 LEU n 2 7 HIS n 2 8 ARG n 2 9 LEU n 2 10 LEU n 2 11 GLN n 2 12 GLU n 2 13 GLY n 2 14 SER n 2 15 PRO n 2 16 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 283 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PPARG, NR1C3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 16 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PPARG_HUMAN P37231 ? 1 ;AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQS KEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLK SLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAK LLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; 223 2 UNP NCOA1_HUMAN Q15788 ? 2 ERHKILHRLLQEGSPS 685 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7CXK A 1 ? 283 ? P37231 223 ? 505 ? 195 477 2 2 7CXK B 1 ? 16 ? Q15788 685 ? 700 ? 685 700 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7CXK _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 94 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P37231 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 316 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 288 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLI non-polymer . 'MALONATE ION' ? 'C3 H2 O4 -2' 102.046 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CXK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.2 M sodium malonate (pH 7.0)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7CXK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19382 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.8 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.63 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.24 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.31 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 963 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.646 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.92 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.259 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.132 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.390 _refine.B_iso_max ? _refine.B_iso_mean 38.160 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.925 _refine.correlation_coeff_Fo_to_Fc_free 0.912 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CXK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.200 _refine.ls_d_res_low 36.041 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19283 _refine.ls_number_reflns_R_free 945 _refine.ls_number_reflns_R_work 18338 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.530 _refine.ls_percent_reflns_R_free 4.901 _refine.ls_R_factor_all 0.238 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2636 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2369 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5GTP _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.267 _refine.pdbx_overall_ESU_R_Free 0.209 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.737 _refine.overall_SU_ML 0.165 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2219 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 77 _refine_hist.number_atoms_total 2303 _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 36.041 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 2263 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2206 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.365 1.636 3044 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.221 1.579 5135 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.976 5.000 272 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.780 23.909 110 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.829 15.000 444 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 25.997 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.067 0.200 297 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2437 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 430 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.212 0.200 538 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.182 0.200 1935 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.161 0.200 1104 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.083 0.200 914 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.178 0.200 62 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.230 0.200 11 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.237 0.200 60 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.169 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 3.018 3.848 1097 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.013 3.844 1096 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.967 5.739 1366 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.967 5.744 1367 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.135 4.301 1166 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.137 4.294 1164 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.270 6.250 1677 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.270 6.250 1677 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.101 45.150 2551 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 8.100 45.182 2552 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.200 2.257 . . 47 1365 98.4658 . . . 0.362 . 0.295 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.257 2.319 . . 63 1254 98.9482 . . . 0.289 . 0.296 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.319 2.386 . . 67 1262 99.8497 . . . 0.321 . 0.273 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.386 2.459 . . 58 1234 100.0000 . . . 0.385 . 0.297 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.459 2.540 . . 55 1197 100.0000 . . . 0.299 . 0.264 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.540 2.628 . . 71 1140 100.0000 . . . 0.320 . 0.288 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.628 2.727 . . 63 1136 100.0000 . . . 0.319 . 0.282 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.727 2.838 . . 70 1050 99.9108 . . . 0.349 . 0.263 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.838 2.964 . . 50 1043 100.0000 . . . 0.366 . 0.270 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.964 3.108 . . 45 1001 100.0000 . . . 0.332 . 0.258 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.108 3.276 . . 50 957 100.0000 . . . 0.231 . 0.240 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.276 3.473 . . 40 901 100.0000 . . . 0.252 . 0.234 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.473 3.712 . . 48 849 100.0000 . . . 0.216 . 0.222 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.712 4.008 . . 53 777 99.7596 . . . 0.209 . 0.206 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.008 4.387 . . 36 744 100.0000 . . . 0.213 . 0.185 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.387 4.900 . . 39 663 100.0000 . . . 0.181 . 0.182 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.900 5.649 . . 25 612 100.0000 . . . 0.198 . 0.217 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.649 6.897 . . 33 509 100.0000 . . . 0.282 . 0.228 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.897 9.663 . . 16 405 96.7816 . . . 0.164 . 0.164 . . . . . . . . . . . 'X-RAY DIFFRACTION' 9.663 36.041 . . 16 231 87.9004 . . . 0.293 . 0.263 . . . . . . . . . . . # _struct.entry_id 7CXK _struct.title 'The ligand-free structure of human PPARgamma LBD R288H mutant in the presence of the SRC-1 coactivator peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CXK _struct_keywords.text 'Nuclear receptor, ligand binding domain, TRANSCRIPTION, mutant' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 11 ? PHE A 32 ? ASN A 205 PHE A 226 1 ? 22 HELX_P HELX_P2 AA2 THR A 35 ? THR A 44 ? THR A 229 THR A 238 1 ? 10 HELX_P HELX_P3 AA3 ASP A 57 ? GLU A 65 ? ASP A 251 GLU A 259 1 ? 9 HELX_P HELX_P4 AA4 GLU A 82 ? SER A 108 ? GLU A 276 SER A 302 1 ? 27 HELX_P HELX_P5 AA5 ASP A 116 ? SER A 138 ? ASP A 310 SER A 332 1 ? 23 HELX_P HELX_P6 AA6 ARG A 156 ? LEU A 162 ? ARG A 350 LEU A 356 1 ? 7 HELX_P HELX_P7 AA7 PRO A 165 ? PHE A 169 ? PRO A 359 PHE A 363 5 ? 5 HELX_P HELX_P8 AA8 MET A 170 ? ASN A 181 ? MET A 364 ASN A 375 1 ? 12 HELX_P HELX_P9 AA9 ALA A 182 ? GLU A 184 ? ALA A 376 GLU A 378 5 ? 3 HELX_P HELX_P10 AB1 ASP A 186 ? LEU A 199 ? ASP A 380 LEU A 393 1 ? 14 HELX_P HELX_P11 AB2 ASN A 208 ? ASN A 230 ? ASN A 402 ASN A 424 1 ? 23 HELX_P HELX_P12 AB3 GLN A 236 ? GLU A 266 ? GLN A 430 GLU A 460 1 ? 31 HELX_P HELX_P13 AB4 HIS A 272 ? LYS A 280 ? HIS A 466 LYS A 474 1 ? 9 HELX_P HELX_P14 AB5 HIS B 3 ? GLU B 12 ? HIS B 687 GLU B 696 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 164 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 358 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 165 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 359 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.65 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 53 ? ILE A 55 ? PHE A 247 ILE A 249 AA1 2 GLY A 152 ? THR A 155 ? GLY A 346 THR A 349 AA1 3 GLY A 144 ? ILE A 147 ? GLY A 338 ILE A 341 AA1 4 MET A 140 ? ASN A 141 ? MET A 334 ASN A 335 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 55 ? N ILE A 249 O PHE A 153 ? O PHE A 347 AA1 2 3 O MET A 154 ? O MET A 348 N VAL A 145 ? N VAL A 339 AA1 3 4 O GLY A 144 ? O GLY A 338 N ASN A 141 ? N ASN A 335 # _atom_sites.entry_id 7CXK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007669 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019232 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018501 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 N+1 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 O-1 8 9 4.195 12.857 1.641 4.172 1.528 47.018 -20.325 -0.014 21.960 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 195 ? ? ? A . n A 1 2 GLU 2 196 ? ? ? A . n A 1 3 ILE 3 197 ? ? ? A . n A 1 4 SER 4 198 ? ? ? A . n A 1 5 SER 5 199 ? ? ? A . n A 1 6 ASP 6 200 ? ? ? A . n A 1 7 ILE 7 201 ? ? ? A . n A 1 8 ASP 8 202 ? ? ? A . n A 1 9 GLN 9 203 ? ? ? A . n A 1 10 LEU 10 204 ? ? ? A . n A 1 11 ASN 11 205 205 ASN ASN A . n A 1 12 PRO 12 206 206 PRO PRO A . n A 1 13 GLU 13 207 207 GLU GLU A . n A 1 14 SER 14 208 208 SER SER A . n A 1 15 ALA 15 209 209 ALA ALA A . n A 1 16 ASP 16 210 210 ASP ASP A . n A 1 17 LEU 17 211 211 LEU LEU A . n A 1 18 ARG 18 212 212 ARG ARG A . n A 1 19 ALA 19 213 213 ALA ALA A . n A 1 20 LEU 20 214 214 LEU LEU A . n A 1 21 ALA 21 215 215 ALA ALA A . n A 1 22 LYS 22 216 216 LYS LYS A . n A 1 23 HIS 23 217 217 HIS HIS A . n A 1 24 LEU 24 218 218 LEU LEU A . n A 1 25 TYR 25 219 219 TYR TYR A . n A 1 26 ASP 26 220 220 ASP ASP A . n A 1 27 SER 27 221 221 SER SER A . n A 1 28 TYR 28 222 222 TYR TYR A . n A 1 29 ILE 29 223 223 ILE ILE A . n A 1 30 LYS 30 224 224 LYS LYS A . n A 1 31 SER 31 225 225 SER SER A . n A 1 32 PHE 32 226 226 PHE PHE A . n A 1 33 PRO 33 227 227 PRO PRO A . n A 1 34 LEU 34 228 228 LEU LEU A . n A 1 35 THR 35 229 229 THR THR A . n A 1 36 LYS 36 230 230 LYS LYS A . n A 1 37 ALA 37 231 231 ALA ALA A . n A 1 38 LYS 38 232 232 LYS LYS A . n A 1 39 ALA 39 233 233 ALA ALA A . n A 1 40 ARG 40 234 234 ARG ARG A . n A 1 41 ALA 41 235 235 ALA ALA A . n A 1 42 ILE 42 236 236 ILE ILE A . n A 1 43 LEU 43 237 237 LEU LEU A . n A 1 44 THR 44 238 238 THR THR A . n A 1 45 GLY 45 239 239 GLY GLY A . n A 1 46 LYS 46 240 240 LYS LYS A . n A 1 47 THR 47 241 241 THR THR A . n A 1 48 THR 48 242 242 THR THR A . n A 1 49 ASP 49 243 243 ASP ASP A . n A 1 50 LYS 50 244 244 LYS LYS A . n A 1 51 SER 51 245 245 SER SER A . n A 1 52 PRO 52 246 246 PRO PRO A . n A 1 53 PHE 53 247 247 PHE PHE A . n A 1 54 VAL 54 248 248 VAL VAL A . n A 1 55 ILE 55 249 249 ILE ILE A . n A 1 56 TYR 56 250 250 TYR TYR A . n A 1 57 ASP 57 251 251 ASP ASP A . n A 1 58 MET 58 252 252 MET MET A . n A 1 59 ASN 59 253 253 ASN ASN A . n A 1 60 SER 60 254 254 SER SER A . n A 1 61 LEU 61 255 255 LEU LEU A . n A 1 62 MET 62 256 256 MET MET A . n A 1 63 MET 63 257 257 MET MET A . n A 1 64 GLY 64 258 258 GLY GLY A . n A 1 65 GLU 65 259 259 GLU GLU A . n A 1 66 ASP 66 260 260 ASP ASP A . n A 1 67 LYS 67 261 261 LYS LYS A . n A 1 68 ILE 68 262 262 ILE ILE A . n A 1 69 LYS 69 263 263 LYS LYS A . n A 1 70 PHE 70 264 264 PHE PHE A . n A 1 71 LYS 71 265 265 LYS LYS A . n A 1 72 HIS 72 266 ? ? ? A . n A 1 73 ILE 73 267 ? ? ? A . n A 1 74 THR 74 268 ? ? ? A . n A 1 75 PRO 75 269 ? ? ? A . n A 1 76 LEU 76 270 ? ? ? A . n A 1 77 GLN 77 271 ? ? ? A . n A 1 78 GLU 78 272 ? ? ? A . n A 1 79 GLN 79 273 ? ? ? A . n A 1 80 SER 80 274 ? ? ? A . n A 1 81 LYS 81 275 275 LYS LYS A . n A 1 82 GLU 82 276 276 GLU GLU A . n A 1 83 VAL 83 277 277 VAL VAL A . n A 1 84 ALA 84 278 278 ALA ALA A . n A 1 85 ILE 85 279 279 ILE ILE A . n A 1 86 ARG 86 280 280 ARG ARG A . n A 1 87 ILE 87 281 281 ILE ILE A . n A 1 88 PHE 88 282 282 PHE PHE A . n A 1 89 GLN 89 283 283 GLN GLN A . n A 1 90 GLY 90 284 284 GLY GLY A . n A 1 91 CYS 91 285 285 CYS CYS A . n A 1 92 GLN 92 286 286 GLN GLN A . n A 1 93 PHE 93 287 287 PHE PHE A . n A 1 94 HIS 94 288 288 HIS HIS A . n A 1 95 SER 95 289 289 SER SER A . n A 1 96 VAL 96 290 290 VAL VAL A . n A 1 97 GLU 97 291 291 GLU GLU A . n A 1 98 ALA 98 292 292 ALA ALA A . n A 1 99 VAL 99 293 293 VAL VAL A . n A 1 100 GLN 100 294 294 GLN GLN A . n A 1 101 GLU 101 295 295 GLU GLU A . n A 1 102 ILE 102 296 296 ILE ILE A . n A 1 103 THR 103 297 297 THR THR A . n A 1 104 GLU 104 298 298 GLU GLU A . n A 1 105 TYR 105 299 299 TYR TYR A . n A 1 106 ALA 106 300 300 ALA ALA A . n A 1 107 LYS 107 301 301 LYS LYS A . n A 1 108 SER 108 302 302 SER SER A . n A 1 109 ILE 109 303 303 ILE ILE A . n A 1 110 PRO 110 304 304 PRO PRO A . n A 1 111 GLY 111 305 305 GLY GLY A . n A 1 112 PHE 112 306 306 PHE PHE A . n A 1 113 VAL 113 307 307 VAL VAL A . n A 1 114 ASN 114 308 308 ASN ASN A . n A 1 115 LEU 115 309 309 LEU LEU A . n A 1 116 ASP 116 310 310 ASP ASP A . n A 1 117 LEU 117 311 311 LEU LEU A . n A 1 118 ASN 118 312 312 ASN ASN A . n A 1 119 ASP 119 313 313 ASP ASP A . n A 1 120 GLN 120 314 314 GLN GLN A . n A 1 121 VAL 121 315 315 VAL VAL A . n A 1 122 THR 122 316 316 THR THR A . n A 1 123 LEU 123 317 317 LEU LEU A . n A 1 124 LEU 124 318 318 LEU LEU A . n A 1 125 LYS 125 319 319 LYS LYS A . n A 1 126 TYR 126 320 320 TYR TYR A . n A 1 127 GLY 127 321 321 GLY GLY A . n A 1 128 VAL 128 322 322 VAL VAL A . n A 1 129 HIS 129 323 323 HIS HIS A . n A 1 130 GLU 130 324 324 GLU GLU A . n A 1 131 ILE 131 325 325 ILE ILE A . n A 1 132 ILE 132 326 326 ILE ILE A . n A 1 133 TYR 133 327 327 TYR TYR A . n A 1 134 THR 134 328 328 THR THR A . n A 1 135 MET 135 329 329 MET MET A . n A 1 136 LEU 136 330 330 LEU LEU A . n A 1 137 ALA 137 331 331 ALA ALA A . n A 1 138 SER 138 332 332 SER SER A . n A 1 139 LEU 139 333 333 LEU LEU A . n A 1 140 MET 140 334 334 MET MET A . n A 1 141 ASN 141 335 335 ASN ASN A . n A 1 142 LYS 142 336 336 LYS LYS A . n A 1 143 ASP 143 337 337 ASP ASP A . n A 1 144 GLY 144 338 338 GLY GLY A . n A 1 145 VAL 145 339 339 VAL VAL A . n A 1 146 LEU 146 340 340 LEU LEU A . n A 1 147 ILE 147 341 341 ILE ILE A . n A 1 148 SER 148 342 342 SER SER A . n A 1 149 GLU 149 343 343 GLU GLU A . n A 1 150 GLY 150 344 344 GLY GLY A . n A 1 151 GLN 151 345 345 GLN GLN A . n A 1 152 GLY 152 346 346 GLY GLY A . n A 1 153 PHE 153 347 347 PHE PHE A . n A 1 154 MET 154 348 348 MET MET A . n A 1 155 THR 155 349 349 THR THR A . n A 1 156 ARG 156 350 350 ARG ARG A . n A 1 157 GLU 157 351 351 GLU GLU A . n A 1 158 PHE 158 352 352 PHE PHE A . n A 1 159 LEU 159 353 353 LEU LEU A . n A 1 160 LYS 160 354 354 LYS LYS A . n A 1 161 SER 161 355 355 SER SER A . n A 1 162 LEU 162 356 356 LEU LEU A . n A 1 163 ARG 163 357 357 ARG ARG A . n A 1 164 LYS 164 358 358 LYS LYS A . n A 1 165 PRO 165 359 359 PRO PRO A . n A 1 166 PHE 166 360 360 PHE PHE A . n A 1 167 GLY 167 361 361 GLY GLY A . n A 1 168 ASP 168 362 362 ASP ASP A . n A 1 169 PHE 169 363 363 PHE PHE A . n A 1 170 MET 170 364 364 MET MET A . n A 1 171 GLU 171 365 365 GLU GLU A . n A 1 172 PRO 172 366 366 PRO PRO A . n A 1 173 LYS 173 367 367 LYS LYS A . n A 1 174 PHE 174 368 368 PHE PHE A . n A 1 175 GLU 175 369 369 GLU GLU A . n A 1 176 PHE 176 370 370 PHE PHE A . n A 1 177 ALA 177 371 371 ALA ALA A . n A 1 178 VAL 178 372 372 VAL VAL A . n A 1 179 LYS 179 373 373 LYS LYS A . n A 1 180 PHE 180 374 374 PHE PHE A . n A 1 181 ASN 181 375 375 ASN ASN A . n A 1 182 ALA 182 376 376 ALA ALA A . n A 1 183 LEU 183 377 377 LEU LEU A . n A 1 184 GLU 184 378 378 GLU GLU A . n A 1 185 LEU 185 379 379 LEU LEU A . n A 1 186 ASP 186 380 380 ASP ASP A . n A 1 187 ASP 187 381 381 ASP ASP A . n A 1 188 SER 188 382 382 SER SER A . n A 1 189 ASP 189 383 383 ASP ASP A . n A 1 190 LEU 190 384 384 LEU LEU A . n A 1 191 ALA 191 385 385 ALA ALA A . n A 1 192 ILE 192 386 386 ILE ILE A . n A 1 193 PHE 193 387 387 PHE PHE A . n A 1 194 ILE 194 388 388 ILE ILE A . n A 1 195 ALA 195 389 389 ALA ALA A . n A 1 196 VAL 196 390 390 VAL VAL A . n A 1 197 ILE 197 391 391 ILE ILE A . n A 1 198 ILE 198 392 392 ILE ILE A . n A 1 199 LEU 199 393 393 LEU LEU A . n A 1 200 SER 200 394 394 SER SER A . n A 1 201 GLY 201 395 395 GLY GLY A . n A 1 202 ASP 202 396 396 ASP ASP A . n A 1 203 ARG 203 397 397 ARG ARG A . n A 1 204 PRO 204 398 398 PRO PRO A . n A 1 205 GLY 205 399 399 GLY GLY A . n A 1 206 LEU 206 400 400 LEU LEU A . n A 1 207 LEU 207 401 401 LEU LEU A . n A 1 208 ASN 208 402 402 ASN ASN A . n A 1 209 VAL 209 403 403 VAL VAL A . n A 1 210 LYS 210 404 404 LYS LYS A . n A 1 211 PRO 211 405 405 PRO PRO A . n A 1 212 ILE 212 406 406 ILE ILE A . n A 1 213 GLU 213 407 407 GLU GLU A . n A 1 214 ASP 214 408 408 ASP ASP A . n A 1 215 ILE 215 409 409 ILE ILE A . n A 1 216 GLN 216 410 410 GLN GLN A . n A 1 217 ASP 217 411 411 ASP ASP A . n A 1 218 ASN 218 412 412 ASN ASN A . n A 1 219 LEU 219 413 413 LEU LEU A . n A 1 220 LEU 220 414 414 LEU LEU A . n A 1 221 GLN 221 415 415 GLN GLN A . n A 1 222 ALA 222 416 416 ALA ALA A . n A 1 223 LEU 223 417 417 LEU LEU A . n A 1 224 GLU 224 418 418 GLU GLU A . n A 1 225 LEU 225 419 419 LEU LEU A . n A 1 226 GLN 226 420 420 GLN GLN A . n A 1 227 LEU 227 421 421 LEU LEU A . n A 1 228 LYS 228 422 422 LYS LYS A . n A 1 229 LEU 229 423 423 LEU LEU A . n A 1 230 ASN 230 424 424 ASN ASN A . n A 1 231 HIS 231 425 425 HIS HIS A . n A 1 232 PRO 232 426 426 PRO PRO A . n A 1 233 GLU 233 427 427 GLU GLU A . n A 1 234 SER 234 428 428 SER SER A . n A 1 235 SER 235 429 429 SER SER A . n A 1 236 GLN 236 430 430 GLN GLN A . n A 1 237 LEU 237 431 431 LEU LEU A . n A 1 238 PHE 238 432 432 PHE PHE A . n A 1 239 ALA 239 433 433 ALA ALA A . n A 1 240 LYS 240 434 434 LYS LYS A . n A 1 241 LEU 241 435 435 LEU LEU A . n A 1 242 LEU 242 436 436 LEU LEU A . n A 1 243 GLN 243 437 437 GLN GLN A . n A 1 244 LYS 244 438 438 LYS LYS A . n A 1 245 MET 245 439 439 MET MET A . n A 1 246 THR 246 440 440 THR THR A . n A 1 247 ASP 247 441 441 ASP ASP A . n A 1 248 LEU 248 442 442 LEU LEU A . n A 1 249 ARG 249 443 443 ARG ARG A . n A 1 250 GLN 250 444 444 GLN GLN A . n A 1 251 ILE 251 445 445 ILE ILE A . n A 1 252 VAL 252 446 446 VAL VAL A . n A 1 253 THR 253 447 447 THR THR A . n A 1 254 GLU 254 448 448 GLU GLU A . n A 1 255 HIS 255 449 449 HIS HIS A . n A 1 256 VAL 256 450 450 VAL VAL A . n A 1 257 GLN 257 451 451 GLN GLN A . n A 1 258 LEU 258 452 452 LEU LEU A . n A 1 259 LEU 259 453 453 LEU LEU A . n A 1 260 GLN 260 454 454 GLN GLN A . n A 1 261 VAL 261 455 455 VAL VAL A . n A 1 262 ILE 262 456 456 ILE ILE A . n A 1 263 LYS 263 457 457 LYS LYS A . n A 1 264 LYS 264 458 458 LYS LYS A . n A 1 265 THR 265 459 459 THR THR A . n A 1 266 GLU 266 460 460 GLU GLU A . n A 1 267 THR 267 461 461 THR THR A . n A 1 268 ASP 268 462 462 ASP ASP A . n A 1 269 MET 269 463 463 MET MET A . n A 1 270 SER 270 464 464 SER SER A . n A 1 271 LEU 271 465 465 LEU LEU A . n A 1 272 HIS 272 466 466 HIS HIS A . n A 1 273 PRO 273 467 467 PRO PRO A . n A 1 274 LEU 274 468 468 LEU LEU A . n A 1 275 LEU 275 469 469 LEU LEU A . n A 1 276 GLN 276 470 470 GLN GLN A . n A 1 277 GLU 277 471 471 GLU GLU A . n A 1 278 ILE 278 472 472 ILE ILE A . n A 1 279 TYR 279 473 473 TYR TYR A . n A 1 280 LYS 280 474 474 LYS LYS A . n A 1 281 ASP 281 475 475 ASP ASP A . n A 1 282 LEU 282 476 476 LEU LEU A . n A 1 283 TYR 283 477 477 TYR TYR A . n B 2 1 GLU 1 685 ? ? ? B . n B 2 2 ARG 2 686 686 ARG ARG B . n B 2 3 HIS 3 687 687 HIS HIS B . n B 2 4 LYS 4 688 688 LYS LYS B . n B 2 5 ILE 5 689 689 ILE ILE B . n B 2 6 LEU 6 690 690 LEU LEU B . n B 2 7 HIS 7 691 691 HIS HIS B . n B 2 8 ARG 8 692 692 ARG ARG B . n B 2 9 LEU 9 693 693 LEU LEU B . n B 2 10 LEU 10 694 694 LEU LEU B . n B 2 11 GLN 11 695 695 GLN GLN B . n B 2 12 GLU 12 696 696 GLU GLU B . n B 2 13 GLY 13 697 ? ? ? B . n B 2 14 SER 14 698 ? ? ? B . n B 2 15 PRO 15 699 ? ? ? B . n B 2 16 SER 16 700 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MLI 1 501 501 MLI MLI A . D 4 HOH 1 601 30 HOH HOH A . D 4 HOH 2 602 75 HOH HOH A . D 4 HOH 3 603 38 HOH HOH A . D 4 HOH 4 604 5 HOH HOH A . D 4 HOH 5 605 28 HOH HOH A . D 4 HOH 6 606 51 HOH HOH A . D 4 HOH 7 607 43 HOH HOH A . D 4 HOH 8 608 6 HOH HOH A . D 4 HOH 9 609 2 HOH HOH A . D 4 HOH 10 610 32 HOH HOH A . D 4 HOH 11 611 12 HOH HOH A . D 4 HOH 12 612 69 HOH HOH A . D 4 HOH 13 613 67 HOH HOH A . D 4 HOH 14 614 19 HOH HOH A . D 4 HOH 15 615 50 HOH HOH A . D 4 HOH 16 616 29 HOH HOH A . D 4 HOH 17 617 14 HOH HOH A . D 4 HOH 18 618 4 HOH HOH A . D 4 HOH 19 619 59 HOH HOH A . D 4 HOH 20 620 13 HOH HOH A . D 4 HOH 21 621 11 HOH HOH A . D 4 HOH 22 622 53 HOH HOH A . D 4 HOH 23 623 26 HOH HOH A . D 4 HOH 24 624 21 HOH HOH A . D 4 HOH 25 625 15 HOH HOH A . D 4 HOH 26 626 18 HOH HOH A . D 4 HOH 27 627 58 HOH HOH A . D 4 HOH 28 628 3 HOH HOH A . D 4 HOH 29 629 1 HOH HOH A . D 4 HOH 30 630 41 HOH HOH A . D 4 HOH 31 631 22 HOH HOH A . D 4 HOH 32 632 8 HOH HOH A . D 4 HOH 33 633 44 HOH HOH A . D 4 HOH 34 634 77 HOH HOH A . D 4 HOH 35 635 20 HOH HOH A . D 4 HOH 36 636 76 HOH HOH A . D 4 HOH 37 637 10 HOH HOH A . D 4 HOH 38 638 17 HOH HOH A . D 4 HOH 39 639 9 HOH HOH A . D 4 HOH 40 640 54 HOH HOH A . D 4 HOH 41 641 68 HOH HOH A . D 4 HOH 42 642 40 HOH HOH A . D 4 HOH 43 643 48 HOH HOH A . D 4 HOH 44 644 27 HOH HOH A . D 4 HOH 45 645 24 HOH HOH A . D 4 HOH 46 646 7 HOH HOH A . D 4 HOH 47 647 35 HOH HOH A . D 4 HOH 48 648 37 HOH HOH A . D 4 HOH 49 649 39 HOH HOH A . D 4 HOH 50 650 63 HOH HOH A . D 4 HOH 51 651 16 HOH HOH A . D 4 HOH 52 652 55 HOH HOH A . D 4 HOH 53 653 46 HOH HOH A . D 4 HOH 54 654 74 HOH HOH A . D 4 HOH 55 655 57 HOH HOH A . D 4 HOH 56 656 25 HOH HOH A . D 4 HOH 57 657 70 HOH HOH A . D 4 HOH 58 658 64 HOH HOH A . D 4 HOH 59 659 31 HOH HOH A . D 4 HOH 60 660 33 HOH HOH A . D 4 HOH 61 661 71 HOH HOH A . D 4 HOH 62 662 52 HOH HOH A . D 4 HOH 63 663 23 HOH HOH A . D 4 HOH 64 664 45 HOH HOH A . D 4 HOH 65 665 34 HOH HOH A . D 4 HOH 66 666 62 HOH HOH A . D 4 HOH 67 667 66 HOH HOH A . D 4 HOH 68 668 65 HOH HOH A . D 4 HOH 69 669 61 HOH HOH A . D 4 HOH 70 670 73 HOH HOH A . D 4 HOH 71 671 36 HOH HOH A . D 4 HOH 72 672 56 HOH HOH A . D 4 HOH 73 673 49 HOH HOH A . D 4 HOH 74 674 72 HOH HOH A . E 4 HOH 1 801 42 HOH HOH B . E 4 HOH 2 802 60 HOH HOH B . E 4 HOH 3 803 47 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1500 ? 1 MORE -6 ? 1 'SSA (A^2)' 13680 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-01 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_type 2 2 'Structure model' chem_comp_atom 3 2 'Structure model' chem_comp_bond 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_type.pdbx_N_electrons' 2 2 'Structure model' '_atom_type.pdbx_scat_Z' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7CXK _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 462 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -91.10 _pdbx_validate_torsion.psi 39.79 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 671 ? 7.06 . 2 1 O ? A HOH 672 ? 7.25 . 3 1 O ? A HOH 673 ? 8.05 . 4 1 O ? A HOH 674 ? 8.93 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 195 ? A ALA 1 2 1 Y 1 A GLU 196 ? A GLU 2 3 1 Y 1 A ILE 197 ? A ILE 3 4 1 Y 1 A SER 198 ? A SER 4 5 1 Y 1 A SER 199 ? A SER 5 6 1 Y 1 A ASP 200 ? A ASP 6 7 1 Y 1 A ILE 201 ? A ILE 7 8 1 Y 1 A ASP 202 ? A ASP 8 9 1 Y 1 A GLN 203 ? A GLN 9 10 1 Y 1 A LEU 204 ? A LEU 10 11 1 Y 1 A HIS 266 ? A HIS 72 12 1 Y 1 A ILE 267 ? A ILE 73 13 1 Y 1 A THR 268 ? A THR 74 14 1 Y 1 A PRO 269 ? A PRO 75 15 1 Y 1 A LEU 270 ? A LEU 76 16 1 Y 1 A GLN 271 ? A GLN 77 17 1 Y 1 A GLU 272 ? A GLU 78 18 1 Y 1 A GLN 273 ? A GLN 79 19 1 Y 1 A SER 274 ? A SER 80 20 1 Y 1 B GLU 685 ? B GLU 1 21 1 Y 1 B GLY 697 ? B GLY 13 22 1 Y 1 B SER 698 ? B SER 14 23 1 Y 1 B PRO 699 ? B PRO 15 24 1 Y 1 B SER 700 ? B SER 16 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MLI C1 C N N 250 MLI C2 C N N 251 MLI C3 C N N 252 MLI O6 O N N 253 MLI O7 O N N 254 MLI O8 O N N 255 MLI O9 O N N 256 MLI H11 H N N 257 MLI H12 H N N 258 PHE N N N N 259 PHE CA C N S 260 PHE C C N N 261 PHE O O N N 262 PHE CB C N N 263 PHE CG C Y N 264 PHE CD1 C Y N 265 PHE CD2 C Y N 266 PHE CE1 C Y N 267 PHE CE2 C Y N 268 PHE CZ C Y N 269 PHE OXT O N N 270 PHE H H N N 271 PHE H2 H N N 272 PHE HA H N N 273 PHE HB2 H N N 274 PHE HB3 H N N 275 PHE HD1 H N N 276 PHE HD2 H N N 277 PHE HE1 H N N 278 PHE HE2 H N N 279 PHE HZ H N N 280 PHE HXT H N N 281 PRO N N N N 282 PRO CA C N S 283 PRO C C N N 284 PRO O O N N 285 PRO CB C N N 286 PRO CG C N N 287 PRO CD C N N 288 PRO OXT O N N 289 PRO H H N N 290 PRO HA H N N 291 PRO HB2 H N N 292 PRO HB3 H N N 293 PRO HG2 H N N 294 PRO HG3 H N N 295 PRO HD2 H N N 296 PRO HD3 H N N 297 PRO HXT H N N 298 SER N N N N 299 SER CA C N S 300 SER C C N N 301 SER O O N N 302 SER CB C N N 303 SER OG O N N 304 SER OXT O N N 305 SER H H N N 306 SER H2 H N N 307 SER HA H N N 308 SER HB2 H N N 309 SER HB3 H N N 310 SER HG H N N 311 SER HXT H N N 312 THR N N N N 313 THR CA C N S 314 THR C C N N 315 THR O O N N 316 THR CB C N R 317 THR OG1 O N N 318 THR CG2 C N N 319 THR OXT O N N 320 THR H H N N 321 THR H2 H N N 322 THR HA H N N 323 THR HB H N N 324 THR HG1 H N N 325 THR HG21 H N N 326 THR HG22 H N N 327 THR HG23 H N N 328 THR HXT H N N 329 TYR N N N N 330 TYR CA C N S 331 TYR C C N N 332 TYR O O N N 333 TYR CB C N N 334 TYR CG C Y N 335 TYR CD1 C Y N 336 TYR CD2 C Y N 337 TYR CE1 C Y N 338 TYR CE2 C Y N 339 TYR CZ C Y N 340 TYR OH O N N 341 TYR OXT O N N 342 TYR H H N N 343 TYR H2 H N N 344 TYR HA H N N 345 TYR HB2 H N N 346 TYR HB3 H N N 347 TYR HD1 H N N 348 TYR HD2 H N N 349 TYR HE1 H N N 350 TYR HE2 H N N 351 TYR HH H N N 352 TYR HXT H N N 353 VAL N N N N 354 VAL CA C N S 355 VAL C C N N 356 VAL O O N N 357 VAL CB C N N 358 VAL CG1 C N N 359 VAL CG2 C N N 360 VAL OXT O N N 361 VAL H H N N 362 VAL H2 H N N 363 VAL HA H N N 364 VAL HB H N N 365 VAL HG11 H N N 366 VAL HG12 H N N 367 VAL HG13 H N N 368 VAL HG21 H N N 369 VAL HG22 H N N 370 VAL HG23 H N N 371 VAL HXT H N N 372 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MLI C1 C2 sing N N 237 MLI C1 C3 sing N N 238 MLI C1 H11 sing N N 239 MLI C1 H12 sing N N 240 MLI C2 O6 doub N N 241 MLI C2 O7 sing N N 242 MLI C3 O8 doub N N 243 MLI C3 O9 sing N N 244 PHE N CA sing N N 245 PHE N H sing N N 246 PHE N H2 sing N N 247 PHE CA C sing N N 248 PHE CA CB sing N N 249 PHE CA HA sing N N 250 PHE C O doub N N 251 PHE C OXT sing N N 252 PHE CB CG sing N N 253 PHE CB HB2 sing N N 254 PHE CB HB3 sing N N 255 PHE CG CD1 doub Y N 256 PHE CG CD2 sing Y N 257 PHE CD1 CE1 sing Y N 258 PHE CD1 HD1 sing N N 259 PHE CD2 CE2 doub Y N 260 PHE CD2 HD2 sing N N 261 PHE CE1 CZ doub Y N 262 PHE CE1 HE1 sing N N 263 PHE CE2 CZ sing Y N 264 PHE CE2 HE2 sing N N 265 PHE CZ HZ sing N N 266 PHE OXT HXT sing N N 267 PRO N CA sing N N 268 PRO N CD sing N N 269 PRO N H sing N N 270 PRO CA C sing N N 271 PRO CA CB sing N N 272 PRO CA HA sing N N 273 PRO C O doub N N 274 PRO C OXT sing N N 275 PRO CB CG sing N N 276 PRO CB HB2 sing N N 277 PRO CB HB3 sing N N 278 PRO CG CD sing N N 279 PRO CG HG2 sing N N 280 PRO CG HG3 sing N N 281 PRO CD HD2 sing N N 282 PRO CD HD3 sing N N 283 PRO OXT HXT sing N N 284 SER N CA sing N N 285 SER N H sing N N 286 SER N H2 sing N N 287 SER CA C sing N N 288 SER CA CB sing N N 289 SER CA HA sing N N 290 SER C O doub N N 291 SER C OXT sing N N 292 SER CB OG sing N N 293 SER CB HB2 sing N N 294 SER CB HB3 sing N N 295 SER OG HG sing N N 296 SER OXT HXT sing N N 297 THR N CA sing N N 298 THR N H sing N N 299 THR N H2 sing N N 300 THR CA C sing N N 301 THR CA CB sing N N 302 THR CA HA sing N N 303 THR C O doub N N 304 THR C OXT sing N N 305 THR CB OG1 sing N N 306 THR CB CG2 sing N N 307 THR CB HB sing N N 308 THR OG1 HG1 sing N N 309 THR CG2 HG21 sing N N 310 THR CG2 HG22 sing N N 311 THR CG2 HG23 sing N N 312 THR OXT HXT sing N N 313 TYR N CA sing N N 314 TYR N H sing N N 315 TYR N H2 sing N N 316 TYR CA C sing N N 317 TYR CA CB sing N N 318 TYR CA HA sing N N 319 TYR C O doub N N 320 TYR C OXT sing N N 321 TYR CB CG sing N N 322 TYR CB HB2 sing N N 323 TYR CB HB3 sing N N 324 TYR CG CD1 doub Y N 325 TYR CG CD2 sing Y N 326 TYR CD1 CE1 sing Y N 327 TYR CD1 HD1 sing N N 328 TYR CD2 CE2 doub Y N 329 TYR CD2 HD2 sing N N 330 TYR CE1 CZ doub Y N 331 TYR CE1 HE1 sing N N 332 TYR CE2 CZ sing Y N 333 TYR CE2 HE2 sing N N 334 TYR CZ OH sing N N 335 TYR OH HH sing N N 336 TYR OXT HXT sing N N 337 VAL N CA sing N N 338 VAL N H sing N N 339 VAL N H2 sing N N 340 VAL CA C sing N N 341 VAL CA CB sing N N 342 VAL CA HA sing N N 343 VAL C O doub N N 344 VAL C OXT sing N N 345 VAL CB CG1 sing N N 346 VAL CB CG2 sing N N 347 VAL CB HB sing N N 348 VAL CG1 HG11 sing N N 349 VAL CG1 HG12 sing N N 350 VAL CG1 HG13 sing N N 351 VAL CG2 HG21 sing N N 352 VAL CG2 HG22 sing N N 353 VAL CG2 HG23 sing N N 354 VAL OXT HXT sing N N 355 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number 2011-0030001 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MLI _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MLI _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MALONATE ION' MLI 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5GTP _pdbx_initial_refinement_model.details ? #