data_7CZ6 # _entry.id 7CZ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CZ6 pdb_00007cz6 10.2210/pdb7cz6/pdb WWPDB D_1300017814 ? ? EMDB EMD-30507 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-03 2 'Structure model' 1 1 2021-03-31 3 'Structure model' 1 2 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_struct_oper_list.name' 15 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 16 3 'Structure model' '_pdbx_struct_oper_list.type' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CZ6 _pdbx_database_status.recvd_initial_deposition_date 2020-09-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'OmRV-LZ protrusion' _pdbx_database_related.db_id EMD-30507 _pdbx_database_related.content_type 'associated EM volume' # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shao, Q.' 1 0000-0001-9937-0631 'Jia, X.' 2 0000-0003-2546-2685 'Gao, Y.' 3 0000-0001-5593-0772 'Liu, Z.' 4 0000-0002-8658-0506 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first e1009396 _citation.page_last e1009396 _citation.title 'Cryo-EM reveals a previously unrecognized structural protein of a dsRNA virus implicated in its extracellular transmission.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1009396 _citation.pdbx_database_id_PubMed 33730056 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shao, Q.' 1 0000-0001-9937-0631 primary 'Jia, X.' 2 0000-0003-2546-2685 primary 'Gao, Y.' 3 0000-0001-5593-0772 primary 'Liu, Z.' 4 0000-0002-8658-0506 primary 'Zhang, H.' 5 ? primary 'Tan, Q.' 6 0000-0001-9071-5541 primary 'Zhang, X.' 7 0000-0001-9253-8729 primary 'Zhou, H.' 8 0000-0003-1424-5108 primary 'Li, Y.' 9 ? primary 'Zhang, Q.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Capsid protein' _entity.formula_weight 12917.530 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IDCDSSVFGNNFNITTSPQTLTMSGPLAPGKYQTTLTVQALIGGTGVVVGTVTFAGKTVAYQVFDDSFASFDLGTVTVSA STTPSVIWTGSTGATLTMAVNIICKPITPTSVAISGQPIWTTPYAP ; _entity_poly.pdbx_seq_one_letter_code_can ;IDCDSSVFGNNFNITTSPQTLTMSGPLAPGKYQTTLTVQALIGGTGVVVGTVTFAGKTVAYQVFDDSFASFDLGTVTVSA STTPSVIWTGSTGATLTMAVNIICKPITPTSVAISGQPIWTTPYAP ; _entity_poly.pdbx_strand_id C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ASP n 1 3 CYS n 1 4 ASP n 1 5 SER n 1 6 SER n 1 7 VAL n 1 8 PHE n 1 9 GLY n 1 10 ASN n 1 11 ASN n 1 12 PHE n 1 13 ASN n 1 14 ILE n 1 15 THR n 1 16 THR n 1 17 SER n 1 18 PRO n 1 19 GLN n 1 20 THR n 1 21 LEU n 1 22 THR n 1 23 MET n 1 24 SER n 1 25 GLY n 1 26 PRO n 1 27 LEU n 1 28 ALA n 1 29 PRO n 1 30 GLY n 1 31 LYS n 1 32 TYR n 1 33 GLN n 1 34 THR n 1 35 THR n 1 36 LEU n 1 37 THR n 1 38 VAL n 1 39 GLN n 1 40 ALA n 1 41 LEU n 1 42 ILE n 1 43 GLY n 1 44 GLY n 1 45 THR n 1 46 GLY n 1 47 VAL n 1 48 VAL n 1 49 VAL n 1 50 GLY n 1 51 THR n 1 52 VAL n 1 53 THR n 1 54 PHE n 1 55 ALA n 1 56 GLY n 1 57 LYS n 1 58 THR n 1 59 VAL n 1 60 ALA n 1 61 TYR n 1 62 GLN n 1 63 VAL n 1 64 PHE n 1 65 ASP n 1 66 ASP n 1 67 SER n 1 68 PHE n 1 69 ALA n 1 70 SER n 1 71 PHE n 1 72 ASP n 1 73 LEU n 1 74 GLY n 1 75 THR n 1 76 VAL n 1 77 THR n 1 78 VAL n 1 79 SER n 1 80 ALA n 1 81 SER n 1 82 THR n 1 83 THR n 1 84 PRO n 1 85 SER n 1 86 VAL n 1 87 ILE n 1 88 TRP n 1 89 THR n 1 90 GLY n 1 91 SER n 1 92 THR n 1 93 GLY n 1 94 ALA n 1 95 THR n 1 96 LEU n 1 97 THR n 1 98 MET n 1 99 ALA n 1 100 VAL n 1 101 ASN n 1 102 ILE n 1 103 ILE n 1 104 CYS n 1 105 LYS n 1 106 PRO n 1 107 ILE n 1 108 THR n 1 109 PRO n 1 110 THR n 1 111 SER n 1 112 VAL n 1 113 ALA n 1 114 ILE n 1 115 SER n 1 116 GLY n 1 117 GLN n 1 118 PRO n 1 119 ILE n 1 120 TRP n 1 121 THR n 1 122 THR n 1 123 PRO n 1 124 TYR n 1 125 ALA n 1 126 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 126 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Omono River virus' _entity_src_nat.pdbx_ncbi_taxonomy_id 753758 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain LZ _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line C6/36 _entity_src_nat.pdbx_atcc CRL-1660 _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 244 244 ILE ILE C . n A 1 2 ASP 2 245 245 ASP ASP C . n A 1 3 CYS 3 246 246 CYS CYS C . n A 1 4 ASP 4 247 247 ASP ASP C . n A 1 5 SER 5 248 248 SER SER C . n A 1 6 SER 6 249 249 SER SER C . n A 1 7 VAL 7 250 250 VAL VAL C . n A 1 8 PHE 8 251 251 PHE PHE C . n A 1 9 GLY 9 252 252 GLY GLY C . n A 1 10 ASN 10 253 253 ASN ASN C . n A 1 11 ASN 11 254 254 ASN ASN C . n A 1 12 PHE 12 255 255 PHE PHE C . n A 1 13 ASN 13 256 256 ASN ASN C . n A 1 14 ILE 14 257 257 ILE ILE C . n A 1 15 THR 15 258 258 THR THR C . n A 1 16 THR 16 259 259 THR THR C . n A 1 17 SER 17 260 260 SER SER C . n A 1 18 PRO 18 261 261 PRO PRO C . n A 1 19 GLN 19 262 262 GLN GLN C . n A 1 20 THR 20 263 263 THR THR C . n A 1 21 LEU 21 264 264 LEU LEU C . n A 1 22 THR 22 265 265 THR THR C . n A 1 23 MET 23 266 266 MET MET C . n A 1 24 SER 24 267 267 SER SER C . n A 1 25 GLY 25 268 268 GLY GLY C . n A 1 26 PRO 26 269 269 PRO PRO C . n A 1 27 LEU 27 270 270 LEU LEU C . n A 1 28 ALA 28 271 271 ALA ALA C . n A 1 29 PRO 29 272 272 PRO PRO C . n A 1 30 GLY 30 273 273 GLY GLY C . n A 1 31 LYS 31 274 274 LYS LYS C . n A 1 32 TYR 32 275 275 TYR TYR C . n A 1 33 GLN 33 276 276 GLN GLN C . n A 1 34 THR 34 277 277 THR THR C . n A 1 35 THR 35 278 278 THR THR C . n A 1 36 LEU 36 279 279 LEU LEU C . n A 1 37 THR 37 280 280 THR THR C . n A 1 38 VAL 38 281 281 VAL VAL C . n A 1 39 GLN 39 282 282 GLN GLN C . n A 1 40 ALA 40 283 283 ALA ALA C . n A 1 41 LEU 41 284 284 LEU LEU C . n A 1 42 ILE 42 285 285 ILE ILE C . n A 1 43 GLY 43 286 286 GLY GLY C . n A 1 44 GLY 44 287 287 GLY GLY C . n A 1 45 THR 45 288 288 THR THR C . n A 1 46 GLY 46 289 289 GLY GLY C . n A 1 47 VAL 47 290 290 VAL VAL C . n A 1 48 VAL 48 291 291 VAL VAL C . n A 1 49 VAL 49 292 292 VAL VAL C . n A 1 50 GLY 50 293 293 GLY GLY C . n A 1 51 THR 51 294 294 THR THR C . n A 1 52 VAL 52 295 295 VAL VAL C . n A 1 53 THR 53 296 296 THR THR C . n A 1 54 PHE 54 297 297 PHE PHE C . n A 1 55 ALA 55 298 298 ALA ALA C . n A 1 56 GLY 56 299 299 GLY GLY C . n A 1 57 LYS 57 300 300 LYS LYS C . n A 1 58 THR 58 301 301 THR THR C . n A 1 59 VAL 59 302 302 VAL VAL C . n A 1 60 ALA 60 303 303 ALA ALA C . n A 1 61 TYR 61 304 304 TYR TYR C . n A 1 62 GLN 62 305 305 GLN GLN C . n A 1 63 VAL 63 306 306 VAL VAL C . n A 1 64 PHE 64 307 307 PHE PHE C . n A 1 65 ASP 65 308 308 ASP ASP C . n A 1 66 ASP 66 309 309 ASP ASP C . n A 1 67 SER 67 310 310 SER SER C . n A 1 68 PHE 68 311 311 PHE PHE C . n A 1 69 ALA 69 312 312 ALA ALA C . n A 1 70 SER 70 313 313 SER SER C . n A 1 71 PHE 71 314 314 PHE PHE C . n A 1 72 ASP 72 315 315 ASP ASP C . n A 1 73 LEU 73 316 316 LEU LEU C . n A 1 74 GLY 74 317 317 GLY GLY C . n A 1 75 THR 75 318 318 THR THR C . n A 1 76 VAL 76 319 319 VAL VAL C . n A 1 77 THR 77 320 320 THR THR C . n A 1 78 VAL 78 321 321 VAL VAL C . n A 1 79 SER 79 322 322 SER SER C . n A 1 80 ALA 80 323 323 ALA ALA C . n A 1 81 SER 81 324 324 SER SER C . n A 1 82 THR 82 325 325 THR THR C . n A 1 83 THR 83 326 326 THR THR C . n A 1 84 PRO 84 327 327 PRO PRO C . n A 1 85 SER 85 328 328 SER SER C . n A 1 86 VAL 86 329 329 VAL VAL C . n A 1 87 ILE 87 330 330 ILE ILE C . n A 1 88 TRP 88 331 331 TRP TRP C . n A 1 89 THR 89 332 332 THR THR C . n A 1 90 GLY 90 333 333 GLY GLY C . n A 1 91 SER 91 334 334 SER SER C . n A 1 92 THR 92 335 335 THR THR C . n A 1 93 GLY 93 336 336 GLY GLY C . n A 1 94 ALA 94 337 337 ALA ALA C . n A 1 95 THR 95 338 338 THR THR C . n A 1 96 LEU 96 339 339 LEU LEU C . n A 1 97 THR 97 340 340 THR THR C . n A 1 98 MET 98 341 341 MET MET C . n A 1 99 ALA 99 342 342 ALA ALA C . n A 1 100 VAL 100 343 343 VAL VAL C . n A 1 101 ASN 101 344 344 ASN ASN C . n A 1 102 ILE 102 345 345 ILE ILE C . n A 1 103 ILE 103 346 346 ILE ILE C . n A 1 104 CYS 104 347 347 CYS CYS C . n A 1 105 LYS 105 348 348 LYS LYS C . n A 1 106 PRO 106 349 349 PRO PRO C . n A 1 107 ILE 107 350 350 ILE ILE C . n A 1 108 THR 108 351 351 THR THR C . n A 1 109 PRO 109 352 352 PRO PRO C . n A 1 110 THR 110 353 353 THR THR C . n A 1 111 SER 111 354 354 SER SER C . n A 1 112 VAL 112 355 355 VAL VAL C . n A 1 113 ALA 113 356 356 ALA ALA C . n A 1 114 ILE 114 357 357 ILE ILE C . n A 1 115 SER 115 358 358 SER SER C . n A 1 116 GLY 116 359 359 GLY GLY C . n A 1 117 GLN 117 360 360 GLN GLN C . n A 1 118 PRO 118 361 361 PRO PRO C . n A 1 119 ILE 119 362 362 ILE ILE C . n A 1 120 TRP 120 363 363 TRP TRP C . n A 1 121 THR 121 364 364 THR THR C . n A 1 122 THR 122 365 365 THR THR C . n A 1 123 PRO 123 366 366 PRO PRO C . n A 1 124 TYR 124 367 367 TYR TYR C . n A 1 125 ALA 125 368 368 ALA ALA C . n A 1 126 PRO 126 369 369 PRO PRO C . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CZ6 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7CZ6 _struct.title 'Protrusion structure of Omono River virus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CZ6 _struct_keywords.text 'Protrusion, Pentamer, five-fold vertex, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7CZ6 _struct_ref.pdbx_db_accession 7CZ6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CZ6 _struct_ref_seq.pdbx_strand_id C _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 126 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7CZ6 _struct_ref_seq.db_align_beg 244 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 369 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 244 _struct_ref_seq.pdbx_auth_seq_align_end 369 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete point assembly' ? pentameric 5 2 'point asymmetric unit' ? monomeric 1 3 'point asymmetric unit, std point frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-5)' A 2 1 A 3 P A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ;Reference-free 2-D data averaging. Local refinement with C1 asymmetry. ; # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] P 'transform to point frame' ? ? -0.99266359 0.12090896 -0.00011899 -0.00445 -0.12090894 -0.99266359 -0.00014160 0.00089 -0.00013524 -0.00012617 0.99999998 -249.02770 1 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.30901701 -0.95105649 -0.00021345 -0.00163 0.95105651 0.30901700 0.00004143 0.00508 0.00002655 -0.00021580 0.99999998 0.00000 3 'point symmetry operation' ? ? -0.80901696 -0.58778521 -0.00031881 -0.00696 0.58778527 -0.80901697 -0.00014876 0.00510 -0.00017049 -0.00030774 0.99999994 0.00000 4 'point symmetry operation' ? ? -0.80901696 0.58778527 -0.00017048 -0.00863 -0.58778521 -0.80901696 -0.00030774 0.00004 -0.00031881 -0.00014875 0.99999994 0.00000 5 'point symmetry operation' ? ? 0.30901700 0.95105651 0.00002655 -0.00433 -0.95105649 0.30901701 -0.00021580 -0.00312 -0.00021344 0.00004144 0.99999998 0.00000 # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 117 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 360 _struct_mon_prot_cis.auth_asym_id C _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 118 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 361 _struct_mon_prot_cis.pdbx_auth_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.84 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 5 ? ASN A 11 ? SER C 248 ASN C 254 AA1 2 MET A 98 ? PRO A 106 ? MET C 341 PRO C 349 AA1 3 TYR A 32 ? GLN A 39 ? TYR C 275 GLN C 282 AA1 4 ALA A 69 ? VAL A 76 ? ALA C 312 VAL C 319 AA2 1 GLN A 19 ? LEU A 21 ? GLN C 262 LEU C 264 AA2 2 SER A 85 ? GLY A 90 ? SER C 328 GLY C 333 AA2 3 GLY A 50 ? THR A 53 ? GLY C 293 THR C 296 AA2 4 THR A 58 ? ALA A 60 ? THR C 301 ALA C 303 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 11 ? N ASN C 254 O MET A 98 ? O MET C 341 AA1 2 3 O ASN A 101 ? O ASN C 344 N THR A 37 ? N THR C 280 AA1 3 4 N VAL A 38 ? N VAL C 281 O ALA A 69 ? O ALA C 312 AA2 1 2 N THR A 20 ? N THR C 263 O VAL A 86 ? O VAL C 329 AA2 2 3 O THR A 89 ? O THR C 332 N THR A 51 ? N THR C 294 AA2 3 4 N VAL A 52 ? N VAL C 295 O VAL A 59 ? O VAL C 302 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE C 257 ? ? -138.15 -71.55 2 1 PHE C 297 ? ? -110.22 -78.01 3 1 TYR C 304 ? ? -154.82 76.82 4 1 ASP C 308 ? ? 58.86 -127.46 5 1 PHE C 311 ? ? -163.16 113.72 6 1 LEU C 339 ? ? -156.63 79.69 # _pdbx_point_symmetry.entry_id 7CZ6 _pdbx_point_symmetry.Schoenflies_symbol C _pdbx_point_symmetry.circular_symmetry 5 # _em_3d_fitting.entry_id 7CZ6 _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol 'AB INITIO MODEL' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7CZ6 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 38935 _em_3d_reconstruction.resolution 4.10 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.4 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details 'Protrusion structure located upon the five-fold vertex of the major capsid.' _em_entity_assembly.name 'Omono River virus' _em_entity_assembly.source NATURAL _em_entity_assembly.type VIRUS _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 7CZ6 _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure NONE _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 2500.0 _em_imaging.nominal_defocus_min 1000.0 _em_imaging.nominal_magnification 75000 _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 300 _em_sample_support.grid_type 'Quantifoil R1.2/1.3' _em_sample_support.method ? _em_sample_support.film_material ? # _em_virus_entity.entity_assembly_id 1 _em_virus_entity.empty NO _em_virus_entity.enveloped NO _em_virus_entity.virus_isolate STRAIN _em_virus_entity.virus_type VIRION _em_virus_entity.id 1 _em_virus_entity.virus_host_category ? _em_virus_entity.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity 100 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.entry_id 7CZ6 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7CZ6 _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 7CZ6 _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry C5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLY N N N N 81 GLY CA C N N 82 GLY C C N N 83 GLY O O N N 84 GLY OXT O N N 85 GLY H H N N 86 GLY H2 H N N 87 GLY HA2 H N N 88 GLY HA3 H N N 89 GLY HXT H N N 90 ILE N N N N 91 ILE CA C N S 92 ILE C C N N 93 ILE O O N N 94 ILE CB C N S 95 ILE CG1 C N N 96 ILE CG2 C N N 97 ILE CD1 C N N 98 ILE OXT O N N 99 ILE H H N N 100 ILE H2 H N N 101 ILE HA H N N 102 ILE HB H N N 103 ILE HG12 H N N 104 ILE HG13 H N N 105 ILE HG21 H N N 106 ILE HG22 H N N 107 ILE HG23 H N N 108 ILE HD11 H N N 109 ILE HD12 H N N 110 ILE HD13 H N N 111 ILE HXT H N N 112 LEU N N N N 113 LEU CA C N S 114 LEU C C N N 115 LEU O O N N 116 LEU CB C N N 117 LEU CG C N N 118 LEU CD1 C N N 119 LEU CD2 C N N 120 LEU OXT O N N 121 LEU H H N N 122 LEU H2 H N N 123 LEU HA H N N 124 LEU HB2 H N N 125 LEU HB3 H N N 126 LEU HG H N N 127 LEU HD11 H N N 128 LEU HD12 H N N 129 LEU HD13 H N N 130 LEU HD21 H N N 131 LEU HD22 H N N 132 LEU HD23 H N N 133 LEU HXT H N N 134 LYS N N N N 135 LYS CA C N S 136 LYS C C N N 137 LYS O O N N 138 LYS CB C N N 139 LYS CG C N N 140 LYS CD C N N 141 LYS CE C N N 142 LYS NZ N N N 143 LYS OXT O N N 144 LYS H H N N 145 LYS H2 H N N 146 LYS HA H N N 147 LYS HB2 H N N 148 LYS HB3 H N N 149 LYS HG2 H N N 150 LYS HG3 H N N 151 LYS HD2 H N N 152 LYS HD3 H N N 153 LYS HE2 H N N 154 LYS HE3 H N N 155 LYS HZ1 H N N 156 LYS HZ2 H N N 157 LYS HZ3 H N N 158 LYS HXT H N N 159 MET N N N N 160 MET CA C N S 161 MET C C N N 162 MET O O N N 163 MET CB C N N 164 MET CG C N N 165 MET SD S N N 166 MET CE C N N 167 MET OXT O N N 168 MET H H N N 169 MET H2 H N N 170 MET HA H N N 171 MET HB2 H N N 172 MET HB3 H N N 173 MET HG2 H N N 174 MET HG3 H N N 175 MET HE1 H N N 176 MET HE2 H N N 177 MET HE3 H N N 178 MET HXT H N N 179 PHE N N N N 180 PHE CA C N S 181 PHE C C N N 182 PHE O O N N 183 PHE CB C N N 184 PHE CG C Y N 185 PHE CD1 C Y N 186 PHE CD2 C Y N 187 PHE CE1 C Y N 188 PHE CE2 C Y N 189 PHE CZ C Y N 190 PHE OXT O N N 191 PHE H H N N 192 PHE H2 H N N 193 PHE HA H N N 194 PHE HB2 H N N 195 PHE HB3 H N N 196 PHE HD1 H N N 197 PHE HD2 H N N 198 PHE HE1 H N N 199 PHE HE2 H N N 200 PHE HZ H N N 201 PHE HXT H N N 202 PRO N N N N 203 PRO CA C N S 204 PRO C C N N 205 PRO O O N N 206 PRO CB C N N 207 PRO CG C N N 208 PRO CD C N N 209 PRO OXT O N N 210 PRO H H N N 211 PRO HA H N N 212 PRO HB2 H N N 213 PRO HB3 H N N 214 PRO HG2 H N N 215 PRO HG3 H N N 216 PRO HD2 H N N 217 PRO HD3 H N N 218 PRO HXT H N N 219 SER N N N N 220 SER CA C N S 221 SER C C N N 222 SER O O N N 223 SER CB C N N 224 SER OG O N N 225 SER OXT O N N 226 SER H H N N 227 SER H2 H N N 228 SER HA H N N 229 SER HB2 H N N 230 SER HB3 H N N 231 SER HG H N N 232 SER HXT H N N 233 THR N N N N 234 THR CA C N S 235 THR C C N N 236 THR O O N N 237 THR CB C N R 238 THR OG1 O N N 239 THR CG2 C N N 240 THR OXT O N N 241 THR H H N N 242 THR H2 H N N 243 THR HA H N N 244 THR HB H N N 245 THR HG1 H N N 246 THR HG21 H N N 247 THR HG22 H N N 248 THR HG23 H N N 249 THR HXT H N N 250 TRP N N N N 251 TRP CA C N S 252 TRP C C N N 253 TRP O O N N 254 TRP CB C N N 255 TRP CG C Y N 256 TRP CD1 C Y N 257 TRP CD2 C Y N 258 TRP NE1 N Y N 259 TRP CE2 C Y N 260 TRP CE3 C Y N 261 TRP CZ2 C Y N 262 TRP CZ3 C Y N 263 TRP CH2 C Y N 264 TRP OXT O N N 265 TRP H H N N 266 TRP H2 H N N 267 TRP HA H N N 268 TRP HB2 H N N 269 TRP HB3 H N N 270 TRP HD1 H N N 271 TRP HE1 H N N 272 TRP HE3 H N N 273 TRP HZ2 H N N 274 TRP HZ3 H N N 275 TRP HH2 H N N 276 TRP HXT H N N 277 TYR N N N N 278 TYR CA C N S 279 TYR C C N N 280 TYR O O N N 281 TYR CB C N N 282 TYR CG C Y N 283 TYR CD1 C Y N 284 TYR CD2 C Y N 285 TYR CE1 C Y N 286 TYR CE2 C Y N 287 TYR CZ C Y N 288 TYR OH O N N 289 TYR OXT O N N 290 TYR H H N N 291 TYR H2 H N N 292 TYR HA H N N 293 TYR HB2 H N N 294 TYR HB3 H N N 295 TYR HD1 H N N 296 TYR HD2 H N N 297 TYR HE1 H N N 298 TYR HE2 H N N 299 TYR HH H N N 300 TYR HXT H N N 301 VAL N N N N 302 VAL CA C N S 303 VAL C C N N 304 VAL O O N N 305 VAL CB C N N 306 VAL CG1 C N N 307 VAL CG2 C N N 308 VAL OXT O N N 309 VAL H H N N 310 VAL H2 H N N 311 VAL HA H N N 312 VAL HB H N N 313 VAL HG11 H N N 314 VAL HG12 H N N 315 VAL HG13 H N N 316 VAL HG21 H N N 317 VAL HG22 H N N 318 VAL HG23 H N N 319 VAL HXT H N N 320 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 ILE N CA sing N N 85 ILE N H sing N N 86 ILE N H2 sing N N 87 ILE CA C sing N N 88 ILE CA CB sing N N 89 ILE CA HA sing N N 90 ILE C O doub N N 91 ILE C OXT sing N N 92 ILE CB CG1 sing N N 93 ILE CB CG2 sing N N 94 ILE CB HB sing N N 95 ILE CG1 CD1 sing N N 96 ILE CG1 HG12 sing N N 97 ILE CG1 HG13 sing N N 98 ILE CG2 HG21 sing N N 99 ILE CG2 HG22 sing N N 100 ILE CG2 HG23 sing N N 101 ILE CD1 HD11 sing N N 102 ILE CD1 HD12 sing N N 103 ILE CD1 HD13 sing N N 104 ILE OXT HXT sing N N 105 LEU N CA sing N N 106 LEU N H sing N N 107 LEU N H2 sing N N 108 LEU CA C sing N N 109 LEU CA CB sing N N 110 LEU CA HA sing N N 111 LEU C O doub N N 112 LEU C OXT sing N N 113 LEU CB CG sing N N 114 LEU CB HB2 sing N N 115 LEU CB HB3 sing N N 116 LEU CG CD1 sing N N 117 LEU CG CD2 sing N N 118 LEU CG HG sing N N 119 LEU CD1 HD11 sing N N 120 LEU CD1 HD12 sing N N 121 LEU CD1 HD13 sing N N 122 LEU CD2 HD21 sing N N 123 LEU CD2 HD22 sing N N 124 LEU CD2 HD23 sing N N 125 LEU OXT HXT sing N N 126 LYS N CA sing N N 127 LYS N H sing N N 128 LYS N H2 sing N N 129 LYS CA C sing N N 130 LYS CA CB sing N N 131 LYS CA HA sing N N 132 LYS C O doub N N 133 LYS C OXT sing N N 134 LYS CB CG sing N N 135 LYS CB HB2 sing N N 136 LYS CB HB3 sing N N 137 LYS CG CD sing N N 138 LYS CG HG2 sing N N 139 LYS CG HG3 sing N N 140 LYS CD CE sing N N 141 LYS CD HD2 sing N N 142 LYS CD HD3 sing N N 143 LYS CE NZ sing N N 144 LYS CE HE2 sing N N 145 LYS CE HE3 sing N N 146 LYS NZ HZ1 sing N N 147 LYS NZ HZ2 sing N N 148 LYS NZ HZ3 sing N N 149 LYS OXT HXT sing N N 150 MET N CA sing N N 151 MET N H sing N N 152 MET N H2 sing N N 153 MET CA C sing N N 154 MET CA CB sing N N 155 MET CA HA sing N N 156 MET C O doub N N 157 MET C OXT sing N N 158 MET CB CG sing N N 159 MET CB HB2 sing N N 160 MET CB HB3 sing N N 161 MET CG SD sing N N 162 MET CG HG2 sing N N 163 MET CG HG3 sing N N 164 MET SD CE sing N N 165 MET CE HE1 sing N N 166 MET CE HE2 sing N N 167 MET CE HE3 sing N N 168 MET OXT HXT sing N N 169 PHE N CA sing N N 170 PHE N H sing N N 171 PHE N H2 sing N N 172 PHE CA C sing N N 173 PHE CA CB sing N N 174 PHE CA HA sing N N 175 PHE C O doub N N 176 PHE C OXT sing N N 177 PHE CB CG sing N N 178 PHE CB HB2 sing N N 179 PHE CB HB3 sing N N 180 PHE CG CD1 doub Y N 181 PHE CG CD2 sing Y N 182 PHE CD1 CE1 sing Y N 183 PHE CD1 HD1 sing N N 184 PHE CD2 CE2 doub Y N 185 PHE CD2 HD2 sing N N 186 PHE CE1 CZ doub Y N 187 PHE CE1 HE1 sing N N 188 PHE CE2 CZ sing Y N 189 PHE CE2 HE2 sing N N 190 PHE CZ HZ sing N N 191 PHE OXT HXT sing N N 192 PRO N CA sing N N 193 PRO N CD sing N N 194 PRO N H sing N N 195 PRO CA C sing N N 196 PRO CA CB sing N N 197 PRO CA HA sing N N 198 PRO C O doub N N 199 PRO C OXT sing N N 200 PRO CB CG sing N N 201 PRO CB HB2 sing N N 202 PRO CB HB3 sing N N 203 PRO CG CD sing N N 204 PRO CG HG2 sing N N 205 PRO CG HG3 sing N N 206 PRO CD HD2 sing N N 207 PRO CD HD3 sing N N 208 PRO OXT HXT sing N N 209 SER N CA sing N N 210 SER N H sing N N 211 SER N H2 sing N N 212 SER CA C sing N N 213 SER CA CB sing N N 214 SER CA HA sing N N 215 SER C O doub N N 216 SER C OXT sing N N 217 SER CB OG sing N N 218 SER CB HB2 sing N N 219 SER CB HB3 sing N N 220 SER OG HG sing N N 221 SER OXT HXT sing N N 222 THR N CA sing N N 223 THR N H sing N N 224 THR N H2 sing N N 225 THR CA C sing N N 226 THR CA CB sing N N 227 THR CA HA sing N N 228 THR C O doub N N 229 THR C OXT sing N N 230 THR CB OG1 sing N N 231 THR CB CG2 sing N N 232 THR CB HB sing N N 233 THR OG1 HG1 sing N N 234 THR CG2 HG21 sing N N 235 THR CG2 HG22 sing N N 236 THR CG2 HG23 sing N N 237 THR OXT HXT sing N N 238 TRP N CA sing N N 239 TRP N H sing N N 240 TRP N H2 sing N N 241 TRP CA C sing N N 242 TRP CA CB sing N N 243 TRP CA HA sing N N 244 TRP C O doub N N 245 TRP C OXT sing N N 246 TRP CB CG sing N N 247 TRP CB HB2 sing N N 248 TRP CB HB3 sing N N 249 TRP CG CD1 doub Y N 250 TRP CG CD2 sing Y N 251 TRP CD1 NE1 sing Y N 252 TRP CD1 HD1 sing N N 253 TRP CD2 CE2 doub Y N 254 TRP CD2 CE3 sing Y N 255 TRP NE1 CE2 sing Y N 256 TRP NE1 HE1 sing N N 257 TRP CE2 CZ2 sing Y N 258 TRP CE3 CZ3 doub Y N 259 TRP CE3 HE3 sing N N 260 TRP CZ2 CH2 doub Y N 261 TRP CZ2 HZ2 sing N N 262 TRP CZ3 CH2 sing Y N 263 TRP CZ3 HZ3 sing N N 264 TRP CH2 HH2 sing N N 265 TRP OXT HXT sing N N 266 TYR N CA sing N N 267 TYR N H sing N N 268 TYR N H2 sing N N 269 TYR CA C sing N N 270 TYR CA CB sing N N 271 TYR CA HA sing N N 272 TYR C O doub N N 273 TYR C OXT sing N N 274 TYR CB CG sing N N 275 TYR CB HB2 sing N N 276 TYR CB HB3 sing N N 277 TYR CG CD1 doub Y N 278 TYR CG CD2 sing Y N 279 TYR CD1 CE1 sing Y N 280 TYR CD1 HD1 sing N N 281 TYR CD2 CE2 doub Y N 282 TYR CD2 HD2 sing N N 283 TYR CE1 CZ doub Y N 284 TYR CE1 HE1 sing N N 285 TYR CE2 CZ sing Y N 286 TYR CE2 HE2 sing N N 287 TYR CZ OH sing N N 288 TYR OH HH sing N N 289 TYR OXT HXT sing N N 290 VAL N CA sing N N 291 VAL N H sing N N 292 VAL N H2 sing N N 293 VAL CA C sing N N 294 VAL CA CB sing N N 295 VAL CA HA sing N N 296 VAL C O doub N N 297 VAL C OXT sing N N 298 VAL CB CG1 sing N N 299 VAL CB CG2 sing N N 300 VAL CB HB sing N N 301 VAL CG1 HG11 sing N N 302 VAL CG1 HG12 sing N N 303 VAL CG1 HG13 sing N N 304 VAL CG2 HG21 sing N N 305 VAL CG2 HG22 sing N N 306 VAL CG2 HG23 sing N N 307 VAL OXT HXT sing N N 308 # loop_ _em_buffer_component.buffer_id _em_buffer_component.id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.name 1 1 136.89 mM NaCl 'sodium choride' 1 2 2.67 mM KCl 'potassium chloride' 1 3 8.1 mM Na2HPO4 'disodium hydrogen phosphate' 1 4 1.76 mM KH2PO4 'potassium dihydrogen phosphate' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units ? _em_entity_assembly_molwt.value ? # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 753758 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Omono River virus' _em_entity_assembly_naturalsource.strain LZ _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 39 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode COUNTING _em_image_recording.film_or_detector_model 'FEI FALCON III (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.details 'Subtracted from every five-fold vertexes from 96668 virus particles. Each virus contains 12 five-fold vertexes. 96668x12=1160016.' _em_particle_selection.method ? _em_particle_selection.num_particles_selected 1160016 _em_particle_selection.reference_model ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 1 1 2 'PARTICLE SELECTION' ? ETHAN ? 1 ? ? 3 'IMAGE ACQUISITION' ? EPU ? ? ? 1 4 MASKING ? ? ? ? ? ? 5 'CTF CORRECTION' ? Gctf ? 1 ? ? 6 'LAYERLINE INDEXING' ? ? ? ? ? ? 7 'DIFFRACTION INDEXING' ? ? ? ? ? ? 8 'MODEL FITTING' ? ? ? ? 1 ? 9 OTHER ? ? ? ? ? ? 10 'MODEL REFINEMENT' ? PHENIX 1.17 ? 1 ? 11 'INITIAL EULER ASSIGNMENT' ? RELION ? 1 ? ? 12 'FINAL EULER ASSIGNMENT' ? jspr ? 1 ? ? 13 CLASSIFICATION ? RELION 3.1 1 ? ? 14 RECONSTRUCTION ? RELION 3.1 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_natural_host.id 1 _em_virus_natural_host.entity_assembly_id 1 _em_virus_natural_host.ncbi_tax_id 7176 _em_virus_natural_host.organism 'Culex quinquefasciatus' _em_virus_natural_host.strain ? # _em_virus_shell.id 1 _em_virus_shell.entity_assembly_id 1 _em_virus_shell.diameter 450 _em_virus_shell.name 'Major capsid' _em_virus_shell.triangulation 1 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31570736 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 7CZ6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_