data_7E4M # _entry.id 7E4M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7E4M pdb_00007e4m 10.2210/pdb7e4m/pdb WWPDB D_1300020001 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7E4M _pdbx_database_status.recvd_initial_deposition_date 2021-02-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yu, J.H.' 1 ? 'Xing, B.Y.' 2 ? 'Ma, M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3669 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 140 _citation.page_last ? _citation.title 'Functional characterization and structural bases of two class I diterpene synthases in pimarane-type diterpene biosynthesis' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42004-021-00578-z _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xing, B.' 1 ? primary 'Yu, J.' 2 ? primary 'Chi, C.' 3 ? primary 'Ma, X.' 4 ? primary 'Xu, Q.' 5 ? primary 'Li, A.' 6 ? primary 'Ge, Y.' 7 ? primary 'Wang, Z.' 8 ? primary 'Liu, T.' 9 ? primary 'Jia, H.' 10 ? primary 'Yin, F.' 11 ? primary 'Guo, J.' 12 ? primary 'Huang, L.' 13 ? primary 'Yang, D.' 14 ? primary 'Ma, M.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 108.750 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7E4M _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.870 _cell.length_a_esd ? _cell.length_b 64.908 _cell.length_b_esd ? _cell.length_c 70.583 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7E4M _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Stt4548 33785.379 1 ? ? ? ? 2 water nat water 18.015 119 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMMTTDNADQLPDPEACAPVCAHAVHLISDLRSWNQRYGGVVSDVRLIGIGVFTAFIAPWL GPGQLVLPARTAAWCCALDDCADSKETSPEEVARLIDACRHVLTGEDPDTANPIACALAAVRADVAERRLSAAFAHAWNR SLDRVLSATLFECQARHDIAAGLPGPSIEDYLARSTGSILVEVFLLNLCVAEARQNAVSQLKALAPALSHAEYAVRLGND VASHRREQAAGDINVIMLGMAPEEARRRTADHARRCRDELRPFLDADPRGCAVMLDRATRLFVGIPPLLDTAG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMMTTDNADQLPDPEACAPVCAHAVHLISDLRSWNQRYGGVVSDVRLIGIGVFTAFIAPWL GPGQLVLPARTAAWCCALDDCADSKETSPEEVARLIDACRHVLTGEDPDTANPIACALAAVRADVAERRLSAAFAHAWNR SLDRVLSATLFECQARHDIAAGLPGPSIEDYLARSTGSILVEVFLLNLCVAEARQNAVSQLKALAPALSHAEYAVRLGND VASHRREQAAGDINVIMLGMAPEEARRRTADHARRCRDELRPFLDADPRGCAVMLDRATRLFVGIPPLLDTAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 MET n 1 23 THR n 1 24 THR n 1 25 ASP n 1 26 ASN n 1 27 ALA n 1 28 ASP n 1 29 GLN n 1 30 LEU n 1 31 PRO n 1 32 ASP n 1 33 PRO n 1 34 GLU n 1 35 ALA n 1 36 CYS n 1 37 ALA n 1 38 PRO n 1 39 VAL n 1 40 CYS n 1 41 ALA n 1 42 HIS n 1 43 ALA n 1 44 VAL n 1 45 HIS n 1 46 LEU n 1 47 ILE n 1 48 SER n 1 49 ASP n 1 50 LEU n 1 51 ARG n 1 52 SER n 1 53 TRP n 1 54 ASN n 1 55 GLN n 1 56 ARG n 1 57 TYR n 1 58 GLY n 1 59 GLY n 1 60 VAL n 1 61 VAL n 1 62 SER n 1 63 ASP n 1 64 VAL n 1 65 ARG n 1 66 LEU n 1 67 ILE n 1 68 GLY n 1 69 ILE n 1 70 GLY n 1 71 VAL n 1 72 PHE n 1 73 THR n 1 74 ALA n 1 75 PHE n 1 76 ILE n 1 77 ALA n 1 78 PRO n 1 79 TRP n 1 80 LEU n 1 81 GLY n 1 82 PRO n 1 83 GLY n 1 84 GLN n 1 85 LEU n 1 86 VAL n 1 87 LEU n 1 88 PRO n 1 89 ALA n 1 90 ARG n 1 91 THR n 1 92 ALA n 1 93 ALA n 1 94 TRP n 1 95 CYS n 1 96 CYS n 1 97 ALA n 1 98 LEU n 1 99 ASP n 1 100 ASP n 1 101 CYS n 1 102 ALA n 1 103 ASP n 1 104 SER n 1 105 LYS n 1 106 GLU n 1 107 THR n 1 108 SER n 1 109 PRO n 1 110 GLU n 1 111 GLU n 1 112 VAL n 1 113 ALA n 1 114 ARG n 1 115 LEU n 1 116 ILE n 1 117 ASP n 1 118 ALA n 1 119 CYS n 1 120 ARG n 1 121 HIS n 1 122 VAL n 1 123 LEU n 1 124 THR n 1 125 GLY n 1 126 GLU n 1 127 ASP n 1 128 PRO n 1 129 ASP n 1 130 THR n 1 131 ALA n 1 132 ASN n 1 133 PRO n 1 134 ILE n 1 135 ALA n 1 136 CYS n 1 137 ALA n 1 138 LEU n 1 139 ALA n 1 140 ALA n 1 141 VAL n 1 142 ARG n 1 143 ALA n 1 144 ASP n 1 145 VAL n 1 146 ALA n 1 147 GLU n 1 148 ARG n 1 149 ARG n 1 150 LEU n 1 151 SER n 1 152 ALA n 1 153 ALA n 1 154 PHE n 1 155 ALA n 1 156 HIS n 1 157 ALA n 1 158 TRP n 1 159 ASN n 1 160 ARG n 1 161 SER n 1 162 LEU n 1 163 ASP n 1 164 ARG n 1 165 VAL n 1 166 LEU n 1 167 SER n 1 168 ALA n 1 169 THR n 1 170 LEU n 1 171 PHE n 1 172 GLU n 1 173 CYS n 1 174 GLN n 1 175 ALA n 1 176 ARG n 1 177 HIS n 1 178 ASP n 1 179 ILE n 1 180 ALA n 1 181 ALA n 1 182 GLY n 1 183 LEU n 1 184 PRO n 1 185 GLY n 1 186 PRO n 1 187 SER n 1 188 ILE n 1 189 GLU n 1 190 ASP n 1 191 TYR n 1 192 LEU n 1 193 ALA n 1 194 ARG n 1 195 SER n 1 196 THR n 1 197 GLY n 1 198 SER n 1 199 ILE n 1 200 LEU n 1 201 VAL n 1 202 GLU n 1 203 VAL n 1 204 PHE n 1 205 LEU n 1 206 LEU n 1 207 ASN n 1 208 LEU n 1 209 CYS n 1 210 VAL n 1 211 ALA n 1 212 GLU n 1 213 ALA n 1 214 ARG n 1 215 GLN n 1 216 ASN n 1 217 ALA n 1 218 VAL n 1 219 SER n 1 220 GLN n 1 221 LEU n 1 222 LYS n 1 223 ALA n 1 224 LEU n 1 225 ALA n 1 226 PRO n 1 227 ALA n 1 228 LEU n 1 229 SER n 1 230 HIS n 1 231 ALA n 1 232 GLU n 1 233 TYR n 1 234 ALA n 1 235 VAL n 1 236 ARG n 1 237 LEU n 1 238 GLY n 1 239 ASN n 1 240 ASP n 1 241 VAL n 1 242 ALA n 1 243 SER n 1 244 HIS n 1 245 ARG n 1 246 ARG n 1 247 GLU n 1 248 GLN n 1 249 ALA n 1 250 ALA n 1 251 GLY n 1 252 ASP n 1 253 ILE n 1 254 ASN n 1 255 VAL n 1 256 ILE n 1 257 MET n 1 258 LEU n 1 259 GLY n 1 260 MET n 1 261 ALA n 1 262 PRO n 1 263 GLU n 1 264 GLU n 1 265 ALA n 1 266 ARG n 1 267 ARG n 1 268 ARG n 1 269 THR n 1 270 ALA n 1 271 ASP n 1 272 HIS n 1 273 ALA n 1 274 ARG n 1 275 ARG n 1 276 CYS n 1 277 ARG n 1 278 ASP n 1 279 GLU n 1 280 LEU n 1 281 ARG n 1 282 PRO n 1 283 PHE n 1 284 LEU n 1 285 ASP n 1 286 ALA n 1 287 ASP n 1 288 PRO n 1 289 ARG n 1 290 GLY n 1 291 CYS n 1 292 ALA n 1 293 VAL n 1 294 MET n 1 295 LEU n 1 296 ASP n 1 297 ARG n 1 298 ALA n 1 299 THR n 1 300 ARG n 1 301 LEU n 1 302 PHE n 1 303 VAL n 1 304 GLY n 1 305 ILE n 1 306 PRO n 1 307 PRO n 1 308 LEU n 1 309 LEU n 1 310 ASP n 1 311 THR n 1 312 ALA n 1 313 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 313 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1931 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7E4M _struct_ref.pdbx_db_accession 7E4M _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7E4M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 313 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7E4M _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 313 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 313 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7E4M _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Sodium chloride, 0.1M BIS-TRIS pH 6.5, 1.5M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7E4M _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.57 _reflns.d_resolution_low 66.84 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31104 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 90.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.58 _reflns_shell.d_res_low 1.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1555 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.468 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.0100 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0100 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.0000 _refine.B_iso_max 105.350 _refine.B_iso_mean 35.5700 _refine.B_iso_min 18.510 _refine.correlation_coeff_Fo_to_Fc 0.9680 _refine.correlation_coeff_Fo_to_Fc_free 0.9640 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7E4M _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5700 _refine.ls_d_res_low 66.8400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29525 _refine.ls_number_reflns_R_free 1583 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 77.3700 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1804 _refine.ls_R_factor_R_free 0.2089 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1788 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1020 _refine.pdbx_overall_ESU_R_Free 0.0990 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.3840 _refine.overall_SU_ML 0.0790 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5700 _refine_hist.d_res_low 66.8400 _refine_hist.number_atoms_solvent 119 _refine_hist.number_atoms_total 2158 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 270 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 42.41 _refine_hist.pdbx_number_atoms_protein 2039 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.5700 _refine_ls_shell.d_res_low 1.6080 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 3 _refine_ls_shell.number_reflns_R_work 117 _refine_ls_shell.percent_reflns_obs 4.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.1030 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3040 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7E4M _struct.title 'Class I Pimarane-Type Diterpene Synthases Stt4548' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7E4M _struct_keywords.text 'class I diterpene synthases, pimarane-type diterpenoids, biosynthetic protein' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 32 ? TYR A 57 ? ASP A 32 TYR A 57 1 ? 26 HELX_P HELX_P2 AA2 SER A 62 ? ALA A 77 ? SER A 62 ALA A 77 1 ? 16 HELX_P HELX_P3 AA3 GLY A 81 ? ASP A 103 ? GLY A 81 ASP A 103 1 ? 23 HELX_P HELX_P4 AA4 SER A 108 ? THR A 124 ? SER A 108 THR A 124 1 ? 17 HELX_P HELX_P5 AA5 ASN A 132 ? GLU A 147 ? ASN A 132 GLU A 147 1 ? 16 HELX_P HELX_P6 AA6 SER A 151 ? ALA A 181 ? SER A 151 ALA A 181 1 ? 31 HELX_P HELX_P7 AA7 SER A 187 ? THR A 196 ? SER A 187 THR A 196 1 ? 10 HELX_P HELX_P8 AA8 GLY A 197 ? ILE A 199 ? GLY A 197 ILE A 199 5 ? 3 HELX_P HELX_P9 AA9 LEU A 200 ? ARG A 214 ? LEU A 200 ARG A 214 1 ? 15 HELX_P HELX_P10 AB1 ASN A 216 ? LEU A 224 ? ASN A 216 LEU A 224 1 ? 9 HELX_P HELX_P11 AB2 LEU A 224 ? HIS A 244 ? LEU A 224 HIS A 244 1 ? 21 HELX_P HELX_P12 AB3 ALA A 261 ? ASP A 287 ? ALA A 261 ASP A 287 1 ? 27 HELX_P HELX_P13 AB4 GLY A 290 ? GLY A 304 ? GLY A 290 GLY A 304 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 209 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 291 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 209 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 291 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.013 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7E4M _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014954 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005077 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015406 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014962 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 MET 21 21 ? ? ? A . n A 1 22 MET 22 22 ? ? ? A . n A 1 23 THR 23 23 ? ? ? A . n A 1 24 THR 24 24 ? ? ? A . n A 1 25 ASP 25 25 ? ? ? A . n A 1 26 ASN 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 GLN 29 29 ? ? ? A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 CYS 173 173 173 CYS CYS A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 TYR 191 191 191 TYR TYR A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 CYS 209 209 209 CYS CYS A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 TYR 233 233 233 TYR TYR A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 ARG 236 236 236 ARG ARG A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 ASN 239 239 239 ASN ASN A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 ARG 245 245 ? ? ? A . n A 1 246 ARG 246 246 ? ? ? A . n A 1 247 GLU 247 247 ? ? ? A . n A 1 248 GLN 248 248 ? ? ? A . n A 1 249 ALA 249 249 ? ? ? A . n A 1 250 ALA 250 250 ? ? ? A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 VAL 255 255 255 VAL VAL A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 MET 257 257 257 MET MET A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 MET 260 260 260 MET MET A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 PRO 262 262 262 PRO PRO A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 ARG 266 266 266 ARG ARG A . n A 1 267 ARG 267 267 267 ARG ARG A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 THR 269 269 269 THR THR A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 ASP 271 271 271 ASP ASP A . n A 1 272 HIS 272 272 272 HIS HIS A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 CYS 276 276 276 CYS CYS A . n A 1 277 ARG 277 277 277 ARG ARG A . n A 1 278 ASP 278 278 278 ASP ASP A . n A 1 279 GLU 279 279 279 GLU GLU A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 ARG 281 281 281 ARG ARG A . n A 1 282 PRO 282 282 282 PRO PRO A . n A 1 283 PHE 283 283 283 PHE PHE A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 ASP 285 285 285 ASP ASP A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 PRO 288 288 288 PRO PRO A . n A 1 289 ARG 289 289 289 ARG ARG A . n A 1 290 GLY 290 290 290 GLY GLY A . n A 1 291 CYS 291 291 291 CYS CYS A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 VAL 293 293 293 VAL VAL A . n A 1 294 MET 294 294 294 MET MET A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 ASP 296 296 296 ASP ASP A . n A 1 297 ARG 297 297 297 ARG ARG A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 ARG 300 300 300 ARG ARG A . n A 1 301 LEU 301 301 301 LEU LEU A . n A 1 302 PHE 302 302 302 PHE PHE A . n A 1 303 VAL 303 303 303 VAL VAL A . n A 1 304 GLY 304 304 304 GLY GLY A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 PRO 306 306 ? ? ? A . n A 1 307 PRO 307 307 ? ? ? A . n A 1 308 LEU 308 308 ? ? ? A . n A 1 309 LEU 309 309 ? ? ? A . n A 1 310 ASP 310 310 ? ? ? A . n A 1 311 THR 311 311 ? ? ? A . n A 1 312 ALA 312 312 ? ? ? A . n A 1 313 GLY 313 313 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 128 HOH HOH A . B 2 HOH 2 402 90 HOH HOH A . B 2 HOH 3 403 131 HOH HOH A . B 2 HOH 4 404 107 HOH HOH A . B 2 HOH 5 405 145 HOH HOH A . B 2 HOH 6 406 174 HOH HOH A . B 2 HOH 7 407 134 HOH HOH A . B 2 HOH 8 408 173 HOH HOH A . B 2 HOH 9 409 148 HOH HOH A . B 2 HOH 10 410 176 HOH HOH A . B 2 HOH 11 411 81 HOH HOH A . B 2 HOH 12 412 53 HOH HOH A . B 2 HOH 13 413 167 HOH HOH A . B 2 HOH 14 414 63 HOH HOH A . B 2 HOH 15 415 92 HOH HOH A . B 2 HOH 16 416 160 HOH HOH A . B 2 HOH 17 417 101 HOH HOH A . B 2 HOH 18 418 40 HOH HOH A . B 2 HOH 19 419 36 HOH HOH A . B 2 HOH 20 420 85 HOH HOH A . B 2 HOH 21 421 95 HOH HOH A . B 2 HOH 22 422 194 HOH HOH A . B 2 HOH 23 423 183 HOH HOH A . B 2 HOH 24 424 193 HOH HOH A . B 2 HOH 25 425 76 HOH HOH A . B 2 HOH 26 426 162 HOH HOH A . B 2 HOH 27 427 82 HOH HOH A . B 2 HOH 28 428 59 HOH HOH A . B 2 HOH 29 429 74 HOH HOH A . B 2 HOH 30 430 39 HOH HOH A . B 2 HOH 31 431 86 HOH HOH A . B 2 HOH 32 432 64 HOH HOH A . B 2 HOH 33 433 207 HOH HOH A . B 2 HOH 34 434 47 HOH HOH A . B 2 HOH 35 435 99 HOH HOH A . B 2 HOH 36 436 165 HOH HOH A . B 2 HOH 37 437 93 HOH HOH A . B 2 HOH 38 438 62 HOH HOH A . B 2 HOH 39 439 65 HOH HOH A . B 2 HOH 40 440 66 HOH HOH A . B 2 HOH 41 441 120 HOH HOH A . B 2 HOH 42 442 56 HOH HOH A . B 2 HOH 43 443 72 HOH HOH A . B 2 HOH 44 444 44 HOH HOH A . B 2 HOH 45 445 51 HOH HOH A . B 2 HOH 46 446 122 HOH HOH A . B 2 HOH 47 447 216 HOH HOH A . B 2 HOH 48 448 45 HOH HOH A . B 2 HOH 49 449 35 HOH HOH A . B 2 HOH 50 450 41 HOH HOH A . B 2 HOH 51 451 38 HOH HOH A . B 2 HOH 52 452 61 HOH HOH A . B 2 HOH 53 453 32 HOH HOH A . B 2 HOH 54 454 68 HOH HOH A . B 2 HOH 55 455 54 HOH HOH A . B 2 HOH 56 456 80 HOH HOH A . B 2 HOH 57 457 211 HOH HOH A . B 2 HOH 58 458 189 HOH HOH A . B 2 HOH 59 459 118 HOH HOH A . B 2 HOH 60 460 55 HOH HOH A . B 2 HOH 61 461 88 HOH HOH A . B 2 HOH 62 462 103 HOH HOH A . B 2 HOH 63 463 52 HOH HOH A . B 2 HOH 64 464 192 HOH HOH A . B 2 HOH 65 465 42 HOH HOH A . B 2 HOH 66 466 135 HOH HOH A . B 2 HOH 67 467 140 HOH HOH A . B 2 HOH 68 468 34 HOH HOH A . B 2 HOH 69 469 169 HOH HOH A . B 2 HOH 70 470 149 HOH HOH A . B 2 HOH 71 471 186 HOH HOH A . B 2 HOH 72 472 50 HOH HOH A . B 2 HOH 73 473 98 HOH HOH A . B 2 HOH 74 474 43 HOH HOH A . B 2 HOH 75 475 57 HOH HOH A . B 2 HOH 76 476 79 HOH HOH A . B 2 HOH 77 477 31 HOH HOH A . B 2 HOH 78 478 196 HOH HOH A . B 2 HOH 79 479 179 HOH HOH A . B 2 HOH 80 480 109 HOH HOH A . B 2 HOH 81 481 113 HOH HOH A . B 2 HOH 82 482 159 HOH HOH A . B 2 HOH 83 483 46 HOH HOH A . B 2 HOH 84 484 70 HOH HOH A . B 2 HOH 85 485 166 HOH HOH A . B 2 HOH 86 486 91 HOH HOH A . B 2 HOH 87 487 67 HOH HOH A . B 2 HOH 88 488 114 HOH HOH A . B 2 HOH 89 489 100 HOH HOH A . B 2 HOH 90 490 133 HOH HOH A . B 2 HOH 91 491 144 HOH HOH A . B 2 HOH 92 492 83 HOH HOH A . B 2 HOH 93 493 161 HOH HOH A . B 2 HOH 94 494 69 HOH HOH A . B 2 HOH 95 495 108 HOH HOH A . B 2 HOH 96 496 150 HOH HOH A . B 2 HOH 97 497 104 HOH HOH A . B 2 HOH 98 498 146 HOH HOH A . B 2 HOH 99 499 184 HOH HOH A . B 2 HOH 100 500 171 HOH HOH A . B 2 HOH 101 501 110 HOH HOH A . B 2 HOH 102 502 71 HOH HOH A . B 2 HOH 103 503 137 HOH HOH A . B 2 HOH 104 504 163 HOH HOH A . B 2 HOH 105 505 143 HOH HOH A . B 2 HOH 106 506 201 HOH HOH A . B 2 HOH 107 507 87 HOH HOH A . B 2 HOH 108 508 175 HOH HOH A . B 2 HOH 109 509 170 HOH HOH A . B 2 HOH 110 510 58 HOH HOH A . B 2 HOH 111 511 89 HOH HOH A . B 2 HOH 112 512 132 HOH HOH A . B 2 HOH 113 513 191 HOH HOH A . B 2 HOH 114 514 77 HOH HOH A . B 2 HOH 115 515 94 HOH HOH A . B 2 HOH 116 516 172 HOH HOH A . B 2 HOH 117 517 121 HOH HOH A . B 2 HOH 118 518 73 HOH HOH A . B 2 HOH 119 519 187 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2920 ? 1 MORE -25 ? 1 'SSA (A^2)' 22800 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 66.8700000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-06 2 'Structure model' 1 1 2022-04-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 129 ? ? -99.89 45.67 2 1 LEU A 200 ? ? 77.41 -21.52 3 1 ARG A 214 ? ? 38.65 -101.43 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A MET 21 ? A MET 21 22 1 Y 1 A MET 22 ? A MET 22 23 1 Y 1 A THR 23 ? A THR 23 24 1 Y 1 A THR 24 ? A THR 24 25 1 Y 1 A ASP 25 ? A ASP 25 26 1 Y 1 A ASN 26 ? A ASN 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A GLN 29 ? A GLN 29 30 1 Y 1 A ARG 245 ? A ARG 245 31 1 Y 1 A ARG 246 ? A ARG 246 32 1 Y 1 A GLU 247 ? A GLU 247 33 1 Y 1 A GLN 248 ? A GLN 248 34 1 Y 1 A ALA 249 ? A ALA 249 35 1 Y 1 A ALA 250 ? A ALA 250 36 1 Y 1 A PRO 306 ? A PRO 306 37 1 Y 1 A PRO 307 ? A PRO 307 38 1 Y 1 A LEU 308 ? A LEU 308 39 1 Y 1 A LEU 309 ? A LEU 309 40 1 Y 1 A ASP 310 ? A ASP 310 41 1 Y 1 A THR 311 ? A THR 311 42 1 Y 1 A ALA 312 ? A ALA 312 43 1 Y 1 A GLY 313 ? A GLY 313 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number '21877002, 81673332, 81991525, 81573326' _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #