data_7F9I # _entry.id 7F9I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7F9I pdb_00007f9i 10.2210/pdb7f9i/pdb WWPDB D_1300023129 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7F9I _pdbx_database_status.recvd_initial_deposition_date 2021-07-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gan, J.H.' 1 ? 'Wang, Q.Y.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 50 _citation.language ? _citation.page_first 3777 _citation.page_last 3798 _citation.title 'Xenogeneic nucleoid-associated EnrR thwarts H-NS silencing of bacterial virulence with unique DNA binding.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkac180 _citation.pdbx_database_id_PubMed 35325196 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, R.' 1 ? primary 'Liu, Y.' 2 ? primary 'Gan, J.' 3 0000-0002-8438-8852 primary 'Qiao, H.' 4 ? primary 'Ma, J.' 5 ? primary 'Zhang, Y.' 6 ? primary 'Bu, Y.' 7 ? primary 'Shao, S.' 8 ? primary 'Zhang, Y.' 9 ? primary 'Wang, Q.' 10 0000-0002-7494-0869 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7F9I _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.283 _cell.length_a_esd ? _cell.length_b 72.379 _cell.length_b_esd ? _cell.length_c 34.075 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7F9I _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'EnrR repressor' 10230.616 2 ? ? ? ? 2 water nat water 18.015 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTNSSASQKKRSKGSAQDWHRADIVAALHKRGITLAGLSRAHGLAARTLSNAMERHYPRAERLIAQALDMRPEDIWPQRY RNKKTDGEKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MTNSSASQKKRSKGSAQDWHRADIVAALHKRGITLAGLSRAHGLAARTLSNAMERHYPRAERLIAQALDMRPEDIWPQRY RNKKTDGEKE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ASN n 1 4 SER n 1 5 SER n 1 6 ALA n 1 7 SER n 1 8 GLN n 1 9 LYS n 1 10 LYS n 1 11 ARG n 1 12 SER n 1 13 LYS n 1 14 GLY n 1 15 SER n 1 16 ALA n 1 17 GLN n 1 18 ASP n 1 19 TRP n 1 20 HIS n 1 21 ARG n 1 22 ALA n 1 23 ASP n 1 24 ILE n 1 25 VAL n 1 26 ALA n 1 27 ALA n 1 28 LEU n 1 29 HIS n 1 30 LYS n 1 31 ARG n 1 32 GLY n 1 33 ILE n 1 34 THR n 1 35 LEU n 1 36 ALA n 1 37 GLY n 1 38 LEU n 1 39 SER n 1 40 ARG n 1 41 ALA n 1 42 HIS n 1 43 GLY n 1 44 LEU n 1 45 ALA n 1 46 ALA n 1 47 ARG n 1 48 THR n 1 49 LEU n 1 50 SER n 1 51 ASN n 1 52 ALA n 1 53 MET n 1 54 GLU n 1 55 ARG n 1 56 HIS n 1 57 TYR n 1 58 PRO n 1 59 ARG n 1 60 ALA n 1 61 GLU n 1 62 ARG n 1 63 LEU n 1 64 ILE n 1 65 ALA n 1 66 GLN n 1 67 ALA n 1 68 LEU n 1 69 ASP n 1 70 MET n 1 71 ARG n 1 72 PRO n 1 73 GLU n 1 74 ASP n 1 75 ILE n 1 76 TRP n 1 77 PRO n 1 78 GLN n 1 79 ARG n 1 80 TYR n 1 81 ARG n 1 82 ASN n 1 83 LYS n 1 84 LYS n 1 85 THR n 1 86 ASP n 1 87 GLY n 1 88 GLU n 1 89 LYS n 1 90 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 90 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Edwardsiella piscicida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1263550 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7F9I _struct_ref.pdbx_db_accession 7F9I _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7F9I A 1 ? 90 ? 7F9I 1 ? 90 ? 1 90 2 1 7F9I B 1 ? 90 ? 7F9I 1 ? 90 ? 1 90 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7F9I _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 27.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG3350 and sodium formate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-08-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97928 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97928 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 32.800 _reflns.entry_id 7F9I _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.48 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5129 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.100 _reflns.pdbx_Rmerge_I_obs 0.143 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.971 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.153 _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.500 2.590 ? ? ? ? ? ? 483 93.200 ? ? ? ? 0.382 ? ? ? ? ? ? ? ? 4.200 ? 0.943 ? ? 0.428 0.187 ? 1 1 0.821 ? ? ? ? ? ? ? ? ? ? 2.590 2.690 ? ? ? ? ? ? 473 94.200 ? ? ? ? 0.340 ? ? ? ? ? ? ? ? 4.300 ? 0.988 ? ? 0.378 0.160 ? 2 1 0.956 ? ? ? ? ? ? ? ? ? ? 2.690 2.820 ? ? ? ? ? ? 496 95.200 ? ? ? ? 0.302 ? ? ? ? ? ? ? ? 4.300 ? 0.888 ? ? 0.338 0.146 ? 3 1 0.908 ? ? ? ? ? ? ? ? ? ? 2.820 2.960 ? ? ? ? ? ? 493 96.700 ? ? ? ? 0.277 ? ? ? ? ? ? ? ? 5.100 ? 0.910 ? ? 0.306 0.126 ? 4 1 0.952 ? ? ? ? ? ? ? ? ? ? 2.960 3.150 ? ? ? ? ? ? 517 98.700 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 5.900 ? 0.919 ? ? 0.258 0.098 ? 5 1 0.972 ? ? ? ? ? ? ? ? ? ? 3.150 3.390 ? ? ? ? ? ? 506 98.800 ? ? ? ? 0.185 ? ? ? ? ? ? ? ? 6.300 ? 1.002 ? ? 0.199 0.072 ? 6 1 0.983 ? ? ? ? ? ? ? ? ? ? 3.390 3.730 ? ? ? ? ? ? 522 99.400 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 6.700 ? 1.141 ? ? 0.164 0.058 ? 7 1 0.989 ? ? ? ? ? ? ? ? ? ? 3.730 4.270 ? ? ? ? ? ? 522 97.900 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 6.700 ? 1.073 ? ? 0.134 0.047 ? 8 1 0.994 ? ? ? ? ? ? ? ? ? ? 4.270 5.380 ? ? ? ? ? ? 531 98.700 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 8.400 ? 0.895 ? ? 0.120 0.040 ? 9 1 0.988 ? ? ? ? ? ? ? ? ? ? 5.380 30.000 ? ? ? ? ? ? 586 98.800 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 8.200 ? 0.929 ? ? 0.123 0.040 ? 10 1 0.993 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 76.440 _refine.B_iso_mean 31.4399 _refine.B_iso_min 10.680 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7F9I _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5 _refine.ls_d_res_low 28.1400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4439 _refine.ls_number_reflns_R_free 215 _refine.ls_number_reflns_R_work 4224 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 83.6300 _refine.ls_percent_reflns_R_free 4.8400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2449 _refine.ls_R_factor_R_free 0.2894 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2424 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.460 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7F9H _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.0100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 28.1400 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 1063 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 137 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 17.15 _refine_hist.pdbx_number_atoms_protein 1061 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 414 0.963 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 414 0.963 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4800 3.1200 1793 . 79 1714 69.0000 . . . 0.3522 0.0000 0.2938 . . . . . . . 2 . . . 'X-RAY DIFFRACTION' 3.1200 28.1400 2646 . 136 2510 98.0000 . . . 0.2753 0.0000 0.2263 . . . . . . . 2 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 'chain A' 1 2 ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ALA 16 . A LYS 83 . A ALA 16 A LYS 83 ? 'chain A' 1 2 1 B ALA 16 . B HIS 29 . B ALA 16 B HIS 29 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; 1 2 2 B LYS 30 . B LYS 30 . B LYS 30 B LYS 30 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; 1 2 3 B ALA 16 . B LYS 84 . B ALA 16 B LYS 84 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; 1 2 4 B ALA 16 . B LYS 84 . B ALA 16 B LYS 84 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; 1 2 5 B ALA 16 . B LYS 84 . B ALA 16 B LYS 84 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; 1 2 6 B ALA 16 . B LYS 84 . B ALA 16 B LYS 84 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; 1 2 7 B ALA 16 . B LYS 84 . B ALA 16 B LYS 84 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; 1 2 8 B ALA 16 . B LYS 84 . B ALA 16 B LYS 84 ? ;(chain B and (resid 16 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 31 through 39 or (resid 40 through 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 through 58 or (resid 59 through 60 and (name N or name CA or name C or name O or name CB )) or resid 61 through 83)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7F9I _struct.title 'The apo-form structure of EnrR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7F9I _struct_keywords.text 'EnrR, Repressor, DNA binding, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 20 ? ARG A 31 ? HIS A 20 ARG A 31 1 ? 12 HELX_P HELX_P2 AA2 THR A 34 ? GLY A 43 ? THR A 34 GLY A 43 1 ? 10 HELX_P HELX_P3 AA3 ALA A 45 ? ARG A 55 ? ALA A 45 ARG A 55 1 ? 11 HELX_P HELX_P4 AA4 TYR A 57 ? LEU A 68 ? TYR A 57 LEU A 68 1 ? 12 HELX_P HELX_P5 AA5 ARG A 71 ? TRP A 76 ? ARG A 71 TRP A 76 1 ? 6 HELX_P HELX_P6 AA6 TRP A 76 ? ASN A 82 ? TRP A 76 ASN A 82 1 ? 7 HELX_P HELX_P7 AA7 HIS B 20 ? ARG B 31 ? HIS B 20 ARG B 31 1 ? 12 HELX_P HELX_P8 AA8 THR B 34 ? GLY B 43 ? THR B 34 GLY B 43 1 ? 10 HELX_P HELX_P9 AA9 ALA B 45 ? MET B 53 ? ALA B 45 MET B 53 1 ? 9 HELX_P HELX_P10 AB1 TYR B 57 ? LEU B 68 ? TYR B 57 LEU B 68 1 ? 12 HELX_P HELX_P11 AB2 ARG B 71 ? TRP B 76 ? ARG B 71 TRP B 76 1 ? 6 HELX_P HELX_P12 AB3 TRP B 76 ? ASN B 82 ? TRP B 76 ASN B 82 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7F9I _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017767 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013816 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029347 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 LYS 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 LYS 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LYS 84 84 ? ? ? A . n A 1 85 THR 85 85 ? ? ? A . n A 1 86 ASP 86 86 ? ? ? A . n A 1 87 GLY 87 87 ? ? ? A . n A 1 88 GLU 88 88 ? ? ? A . n A 1 89 LYS 89 89 ? ? ? A . n A 1 90 GLU 90 90 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 THR 2 2 ? ? ? B . n B 1 3 ASN 3 3 ? ? ? B . n B 1 4 SER 4 4 ? ? ? B . n B 1 5 SER 5 5 ? ? ? B . n B 1 6 ALA 6 6 ? ? ? B . n B 1 7 SER 7 7 ? ? ? B . n B 1 8 GLN 8 8 ? ? ? B . n B 1 9 LYS 9 9 ? ? ? B . n B 1 10 LYS 10 10 ? ? ? B . n B 1 11 ARG 11 11 ? ? ? B . n B 1 12 SER 12 12 ? ? ? B . n B 1 13 LYS 13 13 ? ? ? B . n B 1 14 GLY 14 14 ? ? ? B . n B 1 15 SER 15 15 ? ? ? B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 GLN 17 17 17 GLN GLN B . n B 1 18 ASP 18 18 18 ASP ASP B . n B 1 19 TRP 19 19 19 TRP TRP B . n B 1 20 HIS 20 20 20 HIS HIS B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 ALA 27 27 27 ALA ALA B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 HIS 29 29 29 HIS HIS B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 GLY 32 32 32 GLY GLY B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 THR 34 34 34 THR THR B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 LEU 38 38 38 LEU LEU B . n B 1 39 SER 39 39 39 SER SER B . n B 1 40 ARG 40 40 40 ARG ARG B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 HIS 42 42 42 HIS HIS B . n B 1 43 GLY 43 43 43 GLY GLY B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 ALA 45 45 45 ALA ALA B . n B 1 46 ALA 46 46 46 ALA ALA B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 THR 48 48 48 THR THR B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 SER 50 50 50 SER SER B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 MET 53 53 53 MET MET B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 ARG 55 55 55 ARG ARG B . n B 1 56 HIS 56 56 56 HIS HIS B . n B 1 57 TYR 57 57 57 TYR TYR B . n B 1 58 PRO 58 58 58 PRO PRO B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 ALA 60 60 60 ALA ALA B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 ARG 62 62 62 ARG ARG B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 GLN 66 66 66 GLN GLN B . n B 1 67 ALA 67 67 67 ALA ALA B . n B 1 68 LEU 68 68 68 LEU LEU B . n B 1 69 ASP 69 69 69 ASP ASP B . n B 1 70 MET 70 70 70 MET MET B . n B 1 71 ARG 71 71 71 ARG ARG B . n B 1 72 PRO 72 72 72 PRO PRO B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 ASP 74 74 74 ASP ASP B . n B 1 75 ILE 75 75 75 ILE ILE B . n B 1 76 TRP 76 76 76 TRP TRP B . n B 1 77 PRO 77 77 77 PRO PRO B . n B 1 78 GLN 78 78 78 GLN GLN B . n B 1 79 ARG 79 79 79 ARG ARG B . n B 1 80 TYR 80 80 80 TYR TYR B . n B 1 81 ARG 81 81 81 ARG ARG B . n B 1 82 ASN 82 82 82 ASN ASN B . n B 1 83 LYS 83 83 83 LYS LYS B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 THR 85 85 ? ? ? B . n B 1 86 ASP 86 86 ? ? ? B . n B 1 87 GLY 87 87 ? ? ? B . n B 1 88 GLU 88 88 ? ? ? B . n B 1 89 LYS 89 89 ? ? ? B . n B 1 90 GLU 90 90 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 2 HOH HOH A . D 2 HOH 1 101 1 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-11 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 11.4740 83.4162 18.8855 0.2046 ? -0.0845 ? -0.0468 ? 0.2743 ? -0.0086 ? 0.2614 ? 0.0310 ? -0.1440 ? 0.0043 ? 0.9075 ? 0.0268 ? 1.0863 ? 0.0189 ? 0.0180 ? -0.1188 ? 0.2815 ? -0.1437 ? -0.3107 ? -0.4003 ? 0.4481 ? 0.0096 ? 2 'X-RAY DIFFRACTION' ? refined 21.0467 81.2457 14.3897 0.3982 ? 0.0123 ? -0.0036 ? 0.2825 ? 0.0473 ? 0.3032 ? 2.5839 ? -1.6260 ? -0.7727 ? 5.9890 ? 2.6984 ? 2.7909 ? 0.1827 ? 0.0466 ? 0.1526 ? -0.4528 ? 0.4282 ? -0.5067 ? -0.1033 ? 0.7431 ? -0.0265 ? 3 'X-RAY DIFFRACTION' ? refined 17.4115 64.5156 1.8197 0.1845 ? 0.0410 ? -0.1014 ? 0.3107 ? -0.0249 ? 0.2213 ? 0.2446 ? -0.0421 ? 0.1310 ? 1.8917 ? 0.3113 ? 1.8600 ? 0.0461 ? 0.3351 ? -0.1596 ? 0.0556 ? -0.0859 ? -0.0039 ? 0.6974 ? 0.3415 ? -0.0279 ? 4 'X-RAY DIFFRACTION' ? refined 7.6136 67.1590 -3.0248 0.0885 ? -0.0587 ? -0.0530 ? 0.3091 ? 0.0499 ? 0.2007 ? 2.2102 ? -0.8083 ? 0.6432 ? 4.6851 ? -1.9399 ? 3.1843 ? -0.4125 ? -0.0989 ? 0.1606 ? -0.0881 ? 0.2452 ? 0.1602 ? 0.5266 ? 0.3048 ? 0.0029 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 16 ? ? ? A 55 ? ? '(chain A and resseq 16:55)' 2 'X-RAY DIFFRACTION' 2 ? ? A 56 ? ? ? A 83 ? ? '(chain A and resseq 56:83)' 3 'X-RAY DIFFRACTION' 3 ? ? B 16 ? ? ? B 55 ? ? '(chain B and resseq 16:55)' 4 'X-RAY DIFFRACTION' 4 ? ? B 56 ? ? ? B 84 ? ? '(chain B and resseq 56:84)' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 82 ? ? -87.98 31.27 2 1 ASN B 82 ? ? -88.01 40.12 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 17 ? CG ? A GLN 17 CG 2 1 Y 1 A GLN 17 ? CD ? A GLN 17 CD 3 1 Y 1 A GLN 17 ? OE1 ? A GLN 17 OE1 4 1 Y 1 A GLN 17 ? NE2 ? A GLN 17 NE2 5 1 Y 1 A LYS 30 ? CE ? A LYS 30 CE 6 1 Y 1 A LYS 30 ? NZ ? A LYS 30 NZ 7 1 Y 1 A ARG 40 ? CG ? A ARG 40 CG 8 1 Y 1 A ARG 40 ? CD ? A ARG 40 CD 9 1 Y 1 A ARG 40 ? NE ? A ARG 40 NE 10 1 Y 1 A ARG 40 ? CZ ? A ARG 40 CZ 11 1 Y 1 A ARG 40 ? NH1 ? A ARG 40 NH1 12 1 Y 1 A ARG 40 ? NH2 ? A ARG 40 NH2 13 1 Y 1 A ARG 47 ? CG ? A ARG 47 CG 14 1 Y 1 A ARG 47 ? CD ? A ARG 47 CD 15 1 Y 1 A ARG 47 ? NE ? A ARG 47 NE 16 1 Y 1 A ARG 47 ? CZ ? A ARG 47 CZ 17 1 Y 1 A ARG 47 ? NH1 ? A ARG 47 NH1 18 1 Y 1 A ARG 47 ? NH2 ? A ARG 47 NH2 19 1 Y 1 A ARG 59 ? CG ? A ARG 59 CG 20 1 Y 1 A ARG 59 ? CD ? A ARG 59 CD 21 1 Y 1 A ARG 59 ? NE ? A ARG 59 NE 22 1 Y 1 A ARG 59 ? CZ ? A ARG 59 CZ 23 1 Y 1 A ARG 59 ? NH1 ? A ARG 59 NH1 24 1 Y 1 A ARG 59 ? NH2 ? A ARG 59 NH2 25 1 Y 1 A ARG 81 ? CG ? A ARG 81 CG 26 1 Y 1 A ARG 81 ? CD ? A ARG 81 CD 27 1 Y 1 A ARG 81 ? NE ? A ARG 81 NE 28 1 Y 1 A ARG 81 ? CZ ? A ARG 81 CZ 29 1 Y 1 A ARG 81 ? NH1 ? A ARG 81 NH1 30 1 Y 1 A ARG 81 ? NH2 ? A ARG 81 NH2 31 1 Y 1 A LYS 83 ? CG ? A LYS 83 CG 32 1 Y 1 A LYS 83 ? CD ? A LYS 83 CD 33 1 Y 1 A LYS 83 ? CE ? A LYS 83 CE 34 1 Y 1 A LYS 83 ? NZ ? A LYS 83 NZ 35 1 Y 1 B GLN 17 ? CG ? B GLN 17 CG 36 1 Y 1 B GLN 17 ? CD ? B GLN 17 CD 37 1 Y 1 B GLN 17 ? OE1 ? B GLN 17 OE1 38 1 Y 1 B GLN 17 ? NE2 ? B GLN 17 NE2 39 1 Y 1 B ARG 81 ? CG ? B ARG 81 CG 40 1 Y 1 B ARG 81 ? CD ? B ARG 81 CD 41 1 Y 1 B ARG 81 ? NE ? B ARG 81 NE 42 1 Y 1 B ARG 81 ? CZ ? B ARG 81 CZ 43 1 Y 1 B ARG 81 ? NH1 ? B ARG 81 NH1 44 1 Y 1 B ARG 81 ? NH2 ? B ARG 81 NH2 45 1 Y 1 B LYS 83 ? CG ? B LYS 83 CG 46 1 Y 1 B LYS 83 ? CD ? B LYS 83 CD 47 1 Y 1 B LYS 83 ? CE ? B LYS 83 CE 48 1 Y 1 B LYS 83 ? NZ ? B LYS 83 NZ 49 1 Y 1 B LYS 84 ? CG ? B LYS 84 CG 50 1 Y 1 B LYS 84 ? CD ? B LYS 84 CD 51 1 Y 1 B LYS 84 ? CE ? B LYS 84 CE 52 1 Y 1 B LYS 84 ? NZ ? B LYS 84 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A LYS 9 ? A LYS 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A LYS 13 ? A LYS 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A LYS 84 ? A LYS 84 17 1 Y 1 A THR 85 ? A THR 85 18 1 Y 1 A ASP 86 ? A ASP 86 19 1 Y 1 A GLY 87 ? A GLY 87 20 1 Y 1 A GLU 88 ? A GLU 88 21 1 Y 1 A LYS 89 ? A LYS 89 22 1 Y 1 A GLU 90 ? A GLU 90 23 1 Y 1 B MET 1 ? B MET 1 24 1 Y 1 B THR 2 ? B THR 2 25 1 Y 1 B ASN 3 ? B ASN 3 26 1 Y 1 B SER 4 ? B SER 4 27 1 Y 1 B SER 5 ? B SER 5 28 1 Y 1 B ALA 6 ? B ALA 6 29 1 Y 1 B SER 7 ? B SER 7 30 1 Y 1 B GLN 8 ? B GLN 8 31 1 Y 1 B LYS 9 ? B LYS 9 32 1 Y 1 B LYS 10 ? B LYS 10 33 1 Y 1 B ARG 11 ? B ARG 11 34 1 Y 1 B SER 12 ? B SER 12 35 1 Y 1 B LYS 13 ? B LYS 13 36 1 Y 1 B GLY 14 ? B GLY 14 37 1 Y 1 B SER 15 ? B SER 15 38 1 Y 1 B THR 85 ? B THR 85 39 1 Y 1 B ASP 86 ? B ASP 86 40 1 Y 1 B GLY 87 ? B GLY 87 41 1 Y 1 B GLU 88 ? B GLU 88 42 1 Y 1 B LYS 89 ? B LYS 89 43 1 Y 1 B GLU 90 ? B GLU 90 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 TYR N CA sing N N 298 TYR N H sing N N 299 TYR N H2 sing N N 300 TYR CA C sing N N 301 TYR CA CB sing N N 302 TYR CA HA sing N N 303 TYR C O doub N N 304 TYR C OXT sing N N 305 TYR CB CG sing N N 306 TYR CB HB2 sing N N 307 TYR CB HB3 sing N N 308 TYR CG CD1 doub Y N 309 TYR CG CD2 sing Y N 310 TYR CD1 CE1 sing Y N 311 TYR CD1 HD1 sing N N 312 TYR CD2 CE2 doub Y N 313 TYR CD2 HD2 sing N N 314 TYR CE1 CZ doub Y N 315 TYR CE1 HE1 sing N N 316 TYR CE2 CZ sing Y N 317 TYR CE2 HE2 sing N N 318 TYR CZ OH sing N N 319 TYR OH HH sing N N 320 TYR OXT HXT sing N N 321 VAL N CA sing N N 322 VAL N H sing N N 323 VAL N H2 sing N N 324 VAL CA C sing N N 325 VAL CA CB sing N N 326 VAL CA HA sing N N 327 VAL C O doub N N 328 VAL C OXT sing N N 329 VAL CB CG1 sing N N 330 VAL CB CG2 sing N N 331 VAL CB HB sing N N 332 VAL CG1 HG11 sing N N 333 VAL CG1 HG12 sing N N 334 VAL CG1 HG13 sing N N 335 VAL CG2 HG21 sing N N 336 VAL CG2 HG22 sing N N 337 VAL CG2 HG23 sing N N 338 VAL OXT HXT sing N N 339 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7F9H _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #