data_7FC8 # _entry.id 7FC8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7FC8 pdb_00007fc8 10.2210/pdb7fc8/pdb WWPDB D_1300023094 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-20 2 'Structure model' 1 1 2023-11-29 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' citation 5 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_abbrev' 3 3 'Structure model' '_citation.journal_id_ASTM' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7FC8 _pdbx_database_status.recvd_initial_deposition_date 2021-07-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Katiki, M.' 1 ? 'Pratap, S.' 2 ? 'Kumar, P.' 3 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? FR ? ? primary Biochimie BICMBE 0466 0300-9084 ? ? 198 ? 8 22 ;Biochemical and structural basis for Moraxella catarrhalis enoyl-acyl carrier protein reductase (FabI) inhibition by triclosan and estradiol. ; 2022 ? 10.1016/j.biochi.2022.02.008 35276316 ? ? ? ? ? ? ? ? ? ? ? ? 1 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Crystal structure of Moraxella catarrhalis enoyl-ACP-reductase (FabI) in complex with the cofactor NAD' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Crystal structure of enoyl-ACP-reductase (FabI) from Moraxella catarrhalis, in complex with NAD and Triclosan' ? ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Katiki, M.' 1 ? primary 'Neetu, N.' 2 ? primary 'Pratap, S.' 3 ? primary 'Kumar, P.' 4 ? 1 'Katiki, M.' 5 ? 1 'Neetu, N.' 6 ? 1 'Pratap, S.' 7 ? 1 'Kumar, P.' 8 ? 2 'Katiki, M.' 9 ? 2 'Neetu, N.' 10 ? 2 'Pratap, S.' 11 ? 2 'Kumar, P.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Enoyl-[acyl-carrier-protein] reductase [NADH]' 30864.008 1 1.3.1.9 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 50 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHENLYFQSMLLKGQRFVVTGIASKLSIAWAIAESLHREGAQLILTYPNDKIKKRVDMAAEAFDAVAVIECDVGSD ESIQVCFDEIAKHWGVGDDKGIDGIVHAIGFAPADQLDGDFTQATTREGSQIAHDISSYSFVALAKAGRELLAARQGSLL TLTYEGSISVLPNYNVMGMAKASLEASVRYLASSLGGEGIRVNAISAGPIRTLAASGIKSFRRMLDVSEKIAPLQRNVSQ EEVGNAALFLLSPWASGITGEILFVDAGFNTVAISEKIMMMAGDGEQ ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHENLYFQSMLLKGQRFVVTGIASKLSIAWAIAESLHREGAQLILTYPNDKIKKRVDMAAEAFDAVAVIECDVGSD ESIQVCFDEIAKHWGVGDDKGIDGIVHAIGFAPADQLDGDFTQATTREGSQIAHDISSYSFVALAKAGRELLAARQGSLL TLTYEGSISVLPNYNVMGMAKASLEASVRYLASSLGGEGIRVNAISAGPIRTLAASGIKSFRRMLDVSEKIAPLQRNVSQ EEVGNAALFLLSPWASGITGEILFVDAGFNTVAISEKIMMMAGDGEQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 GLU n 1 8 ASN n 1 9 LEU n 1 10 TYR n 1 11 PHE n 1 12 GLN n 1 13 SER n 1 14 MET n 1 15 LEU n 1 16 LEU n 1 17 LYS n 1 18 GLY n 1 19 GLN n 1 20 ARG n 1 21 PHE n 1 22 VAL n 1 23 VAL n 1 24 THR n 1 25 GLY n 1 26 ILE n 1 27 ALA n 1 28 SER n 1 29 LYS n 1 30 LEU n 1 31 SER n 1 32 ILE n 1 33 ALA n 1 34 TRP n 1 35 ALA n 1 36 ILE n 1 37 ALA n 1 38 GLU n 1 39 SER n 1 40 LEU n 1 41 HIS n 1 42 ARG n 1 43 GLU n 1 44 GLY n 1 45 ALA n 1 46 GLN n 1 47 LEU n 1 48 ILE n 1 49 LEU n 1 50 THR n 1 51 TYR n 1 52 PRO n 1 53 ASN n 1 54 ASP n 1 55 LYS n 1 56 ILE n 1 57 LYS n 1 58 LYS n 1 59 ARG n 1 60 VAL n 1 61 ASP n 1 62 MET n 1 63 ALA n 1 64 ALA n 1 65 GLU n 1 66 ALA n 1 67 PHE n 1 68 ASP n 1 69 ALA n 1 70 VAL n 1 71 ALA n 1 72 VAL n 1 73 ILE n 1 74 GLU n 1 75 CYS n 1 76 ASP n 1 77 VAL n 1 78 GLY n 1 79 SER n 1 80 ASP n 1 81 GLU n 1 82 SER n 1 83 ILE n 1 84 GLN n 1 85 VAL n 1 86 CYS n 1 87 PHE n 1 88 ASP n 1 89 GLU n 1 90 ILE n 1 91 ALA n 1 92 LYS n 1 93 HIS n 1 94 TRP n 1 95 GLY n 1 96 VAL n 1 97 GLY n 1 98 ASP n 1 99 ASP n 1 100 LYS n 1 101 GLY n 1 102 ILE n 1 103 ASP n 1 104 GLY n 1 105 ILE n 1 106 VAL n 1 107 HIS n 1 108 ALA n 1 109 ILE n 1 110 GLY n 1 111 PHE n 1 112 ALA n 1 113 PRO n 1 114 ALA n 1 115 ASP n 1 116 GLN n 1 117 LEU n 1 118 ASP n 1 119 GLY n 1 120 ASP n 1 121 PHE n 1 122 THR n 1 123 GLN n 1 124 ALA n 1 125 THR n 1 126 THR n 1 127 ARG n 1 128 GLU n 1 129 GLY n 1 130 SER n 1 131 GLN n 1 132 ILE n 1 133 ALA n 1 134 HIS n 1 135 ASP n 1 136 ILE n 1 137 SER n 1 138 SER n 1 139 TYR n 1 140 SER n 1 141 PHE n 1 142 VAL n 1 143 ALA n 1 144 LEU n 1 145 ALA n 1 146 LYS n 1 147 ALA n 1 148 GLY n 1 149 ARG n 1 150 GLU n 1 151 LEU n 1 152 LEU n 1 153 ALA n 1 154 ALA n 1 155 ARG n 1 156 GLN n 1 157 GLY n 1 158 SER n 1 159 LEU n 1 160 LEU n 1 161 THR n 1 162 LEU n 1 163 THR n 1 164 TYR n 1 165 GLU n 1 166 GLY n 1 167 SER n 1 168 ILE n 1 169 SER n 1 170 VAL n 1 171 LEU n 1 172 PRO n 1 173 ASN n 1 174 TYR n 1 175 ASN n 1 176 VAL n 1 177 MET n 1 178 GLY n 1 179 MET n 1 180 ALA n 1 181 LYS n 1 182 ALA n 1 183 SER n 1 184 LEU n 1 185 GLU n 1 186 ALA n 1 187 SER n 1 188 VAL n 1 189 ARG n 1 190 TYR n 1 191 LEU n 1 192 ALA n 1 193 SER n 1 194 SER n 1 195 LEU n 1 196 GLY n 1 197 GLY n 1 198 GLU n 1 199 GLY n 1 200 ILE n 1 201 ARG n 1 202 VAL n 1 203 ASN n 1 204 ALA n 1 205 ILE n 1 206 SER n 1 207 ALA n 1 208 GLY n 1 209 PRO n 1 210 ILE n 1 211 ARG n 1 212 THR n 1 213 LEU n 1 214 ALA n 1 215 ALA n 1 216 SER n 1 217 GLY n 1 218 ILE n 1 219 LYS n 1 220 SER n 1 221 PHE n 1 222 ARG n 1 223 ARG n 1 224 MET n 1 225 LEU n 1 226 ASP n 1 227 VAL n 1 228 SER n 1 229 GLU n 1 230 LYS n 1 231 ILE n 1 232 ALA n 1 233 PRO n 1 234 LEU n 1 235 GLN n 1 236 ARG n 1 237 ASN n 1 238 VAL n 1 239 SER n 1 240 GLN n 1 241 GLU n 1 242 GLU n 1 243 VAL n 1 244 GLY n 1 245 ASN n 1 246 ALA n 1 247 ALA n 1 248 LEU n 1 249 PHE n 1 250 LEU n 1 251 LEU n 1 252 SER n 1 253 PRO n 1 254 TRP n 1 255 ALA n 1 256 SER n 1 257 GLY n 1 258 ILE n 1 259 THR n 1 260 GLY n 1 261 GLU n 1 262 ILE n 1 263 LEU n 1 264 PHE n 1 265 VAL n 1 266 ASP n 1 267 ALA n 1 268 GLY n 1 269 PHE n 1 270 ASN n 1 271 THR n 1 272 VAL n 1 273 ALA n 1 274 ILE n 1 275 SER n 1 276 GLU n 1 277 LYS n 1 278 ILE n 1 279 MET n 1 280 MET n 1 281 MET n 1 282 ALA n 1 283 GLY n 1 284 ASP n 1 285 GLY n 1 286 GLU n 1 287 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 287 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'fabI, MCR_1078' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Moraxella catarrhalis (strain BBH18)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1236608 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28C _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -12 ? ? ? A . n A 1 2 HIS 2 -11 ? ? ? A . n A 1 3 HIS 3 -10 ? ? ? A . n A 1 4 HIS 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 GLU 7 -6 ? ? ? A . n A 1 8 ASN 8 -5 ? ? ? A . n A 1 9 LEU 9 -4 ? ? ? A . n A 1 10 TYR 10 -3 ? ? ? A . n A 1 11 PHE 11 -2 ? ? ? A . n A 1 12 GLN 12 -1 ? ? ? A . n A 1 13 SER 13 0 ? ? ? A . n A 1 14 MET 14 1 1 MET MET A . n A 1 15 LEU 15 2 2 LEU LEU A . n A 1 16 LEU 16 3 3 LEU LEU A . n A 1 17 LYS 17 4 4 LYS LYS A . n A 1 18 GLY 18 5 5 GLY GLY A . n A 1 19 GLN 19 6 6 GLN GLN A . n A 1 20 ARG 20 7 7 ARG ARG A . n A 1 21 PHE 21 8 8 PHE PHE A . n A 1 22 VAL 22 9 9 VAL VAL A . n A 1 23 VAL 23 10 10 VAL VAL A . n A 1 24 THR 24 11 11 THR THR A . n A 1 25 GLY 25 12 12 GLY GLY A . n A 1 26 ILE 26 13 13 ILE ILE A . n A 1 27 ALA 27 14 14 ALA ALA A . n A 1 28 SER 28 15 15 SER SER A . n A 1 29 LYS 29 16 16 LYS LYS A . n A 1 30 LEU 30 17 17 LEU LEU A . n A 1 31 SER 31 18 18 SER SER A . n A 1 32 ILE 32 19 19 ILE ILE A . n A 1 33 ALA 33 20 20 ALA ALA A . n A 1 34 TRP 34 21 21 TRP TRP A . n A 1 35 ALA 35 22 22 ALA ALA A . n A 1 36 ILE 36 23 23 ILE ILE A . n A 1 37 ALA 37 24 24 ALA ALA A . n A 1 38 GLU 38 25 25 GLU GLU A . n A 1 39 SER 39 26 26 SER SER A . n A 1 40 LEU 40 27 27 LEU LEU A . n A 1 41 HIS 41 28 28 HIS HIS A . n A 1 42 ARG 42 29 29 ARG ARG A . n A 1 43 GLU 43 30 30 GLU GLU A . n A 1 44 GLY 44 31 31 GLY GLY A . n A 1 45 ALA 45 32 32 ALA ALA A . n A 1 46 GLN 46 33 33 GLN GLN A . n A 1 47 LEU 47 34 34 LEU LEU A . n A 1 48 ILE 48 35 35 ILE ILE A . n A 1 49 LEU 49 36 36 LEU LEU A . n A 1 50 THR 50 37 37 THR THR A . n A 1 51 TYR 51 38 38 TYR TYR A . n A 1 52 PRO 52 39 39 PRO PRO A . n A 1 53 ASN 53 40 40 ASN ASN A . n A 1 54 ASP 54 41 41 ASP ASP A . n A 1 55 LYS 55 42 42 LYS LYS A . n A 1 56 ILE 56 43 43 ILE ILE A . n A 1 57 LYS 57 44 44 LYS LYS A . n A 1 58 LYS 58 45 45 LYS LYS A . n A 1 59 ARG 59 46 46 ARG ARG A . n A 1 60 VAL 60 47 47 VAL VAL A . n A 1 61 ASP 61 48 48 ASP ASP A . n A 1 62 MET 62 49 49 MET MET A . n A 1 63 ALA 63 50 50 ALA ALA A . n A 1 64 ALA 64 51 51 ALA ALA A . n A 1 65 GLU 65 52 52 GLU GLU A . n A 1 66 ALA 66 53 53 ALA ALA A . n A 1 67 PHE 67 54 54 PHE PHE A . n A 1 68 ASP 68 55 55 ASP ASP A . n A 1 69 ALA 69 56 56 ALA ALA A . n A 1 70 VAL 70 57 57 VAL VAL A . n A 1 71 ALA 71 58 58 ALA ALA A . n A 1 72 VAL 72 59 59 VAL VAL A . n A 1 73 ILE 73 60 60 ILE ILE A . n A 1 74 GLU 74 61 61 GLU GLU A . n A 1 75 CYS 75 62 62 CYS CYS A . n A 1 76 ASP 76 63 63 ASP ASP A . n A 1 77 VAL 77 64 64 VAL VAL A . n A 1 78 GLY 78 65 65 GLY GLY A . n A 1 79 SER 79 66 66 SER SER A . n A 1 80 ASP 80 67 67 ASP ASP A . n A 1 81 GLU 81 68 68 GLU GLU A . n A 1 82 SER 82 69 69 SER SER A . n A 1 83 ILE 83 70 70 ILE ILE A . n A 1 84 GLN 84 71 71 GLN GLN A . n A 1 85 VAL 85 72 72 VAL VAL A . n A 1 86 CYS 86 73 73 CYS CYS A . n A 1 87 PHE 87 74 74 PHE PHE A . n A 1 88 ASP 88 75 75 ASP ASP A . n A 1 89 GLU 89 76 76 GLU GLU A . n A 1 90 ILE 90 77 77 ILE ILE A . n A 1 91 ALA 91 78 78 ALA ALA A . n A 1 92 LYS 92 79 79 LYS LYS A . n A 1 93 HIS 93 80 80 HIS HIS A . n A 1 94 TRP 94 81 81 TRP TRP A . n A 1 95 GLY 95 82 82 GLY GLY A . n A 1 96 VAL 96 83 83 VAL VAL A . n A 1 97 GLY 97 84 84 GLY GLY A . n A 1 98 ASP 98 85 85 ASP ASP A . n A 1 99 ASP 99 86 86 ASP ASP A . n A 1 100 LYS 100 87 87 LYS LYS A . n A 1 101 GLY 101 88 88 GLY GLY A . n A 1 102 ILE 102 89 89 ILE ILE A . n A 1 103 ASP 103 90 90 ASP ASP A . n A 1 104 GLY 104 91 91 GLY GLY A . n A 1 105 ILE 105 92 92 ILE ILE A . n A 1 106 VAL 106 93 93 VAL VAL A . n A 1 107 HIS 107 94 94 HIS HIS A . n A 1 108 ALA 108 95 95 ALA ALA A . n A 1 109 ILE 109 96 96 ILE ILE A . n A 1 110 GLY 110 97 97 GLY GLY A . n A 1 111 PHE 111 98 ? ? ? A . n A 1 112 ALA 112 99 ? ? ? A . n A 1 113 PRO 113 100 ? ? ? A . n A 1 114 ALA 114 101 ? ? ? A . n A 1 115 ASP 115 102 ? ? ? A . n A 1 116 GLN 116 103 ? ? ? A . n A 1 117 LEU 117 104 ? ? ? A . n A 1 118 ASP 118 105 ? ? ? A . n A 1 119 GLY 119 106 ? ? ? A . n A 1 120 ASP 120 107 ? ? ? A . n A 1 121 PHE 121 108 ? ? ? A . n A 1 122 THR 122 109 ? ? ? A . n A 1 123 GLN 123 110 ? ? ? A . n A 1 124 ALA 124 111 ? ? ? A . n A 1 125 THR 125 112 112 THR THR A . n A 1 126 THR 126 113 113 THR THR A . n A 1 127 ARG 127 114 114 ARG ARG A . n A 1 128 GLU 128 115 115 GLU GLU A . n A 1 129 GLY 129 116 116 GLY GLY A . n A 1 130 SER 130 117 117 SER SER A . n A 1 131 GLN 131 118 118 GLN GLN A . n A 1 132 ILE 132 119 119 ILE ILE A . n A 1 133 ALA 133 120 120 ALA ALA A . n A 1 134 HIS 134 121 121 HIS HIS A . n A 1 135 ASP 135 122 122 ASP ASP A . n A 1 136 ILE 136 123 123 ILE ILE A . n A 1 137 SER 137 124 124 SER SER A . n A 1 138 SER 138 125 125 SER SER A . n A 1 139 TYR 139 126 126 TYR TYR A . n A 1 140 SER 140 127 127 SER SER A . n A 1 141 PHE 141 128 128 PHE PHE A . n A 1 142 VAL 142 129 129 VAL VAL A . n A 1 143 ALA 143 130 130 ALA ALA A . n A 1 144 LEU 144 131 131 LEU LEU A . n A 1 145 ALA 145 132 132 ALA ALA A . n A 1 146 LYS 146 133 133 LYS LYS A . n A 1 147 ALA 147 134 134 ALA ALA A . n A 1 148 GLY 148 135 135 GLY GLY A . n A 1 149 ARG 149 136 136 ARG ARG A . n A 1 150 GLU 150 137 137 GLU GLU A . n A 1 151 LEU 151 138 138 LEU LEU A . n A 1 152 LEU 152 139 139 LEU LEU A . n A 1 153 ALA 153 140 140 ALA ALA A . n A 1 154 ALA 154 141 141 ALA ALA A . n A 1 155 ARG 155 142 142 ARG ARG A . n A 1 156 GLN 156 143 143 GLN GLN A . n A 1 157 GLY 157 144 144 GLY GLY A . n A 1 158 SER 158 145 145 SER SER A . n A 1 159 LEU 159 146 146 LEU LEU A . n A 1 160 LEU 160 147 147 LEU LEU A . n A 1 161 THR 161 148 148 THR THR A . n A 1 162 LEU 162 149 149 LEU LEU A . n A 1 163 THR 163 150 150 THR THR A . n A 1 164 TYR 164 151 151 TYR TYR A . n A 1 165 GLU 165 152 152 GLU GLU A . n A 1 166 GLY 166 153 ? ? ? A . n A 1 167 SER 167 154 ? ? ? A . n A 1 168 ILE 168 155 ? ? ? A . n A 1 169 SER 169 156 ? ? ? A . n A 1 170 VAL 170 157 ? ? ? A . n A 1 171 LEU 171 158 ? ? ? A . n A 1 172 PRO 172 159 ? ? ? A . n A 1 173 ASN 173 160 ? ? ? A . n A 1 174 TYR 174 161 161 TYR TYR A . n A 1 175 ASN 175 162 162 ASN ASN A . n A 1 176 VAL 176 163 163 VAL VAL A . n A 1 177 MET 177 164 164 MET MET A . n A 1 178 GLY 178 165 165 GLY GLY A . n A 1 179 MET 179 166 166 MET MET A . n A 1 180 ALA 180 167 167 ALA ALA A . n A 1 181 LYS 181 168 168 LYS LYS A . n A 1 182 ALA 182 169 169 ALA ALA A . n A 1 183 SER 183 170 170 SER SER A . n A 1 184 LEU 184 171 171 LEU LEU A . n A 1 185 GLU 185 172 172 GLU GLU A . n A 1 186 ALA 186 173 173 ALA ALA A . n A 1 187 SER 187 174 174 SER SER A . n A 1 188 VAL 188 175 175 VAL VAL A . n A 1 189 ARG 189 176 176 ARG ARG A . n A 1 190 TYR 190 177 177 TYR TYR A . n A 1 191 LEU 191 178 178 LEU LEU A . n A 1 192 ALA 192 179 179 ALA ALA A . n A 1 193 SER 193 180 180 SER SER A . n A 1 194 SER 194 181 181 SER SER A . n A 1 195 LEU 195 182 182 LEU LEU A . n A 1 196 GLY 196 183 183 GLY GLY A . n A 1 197 GLY 197 184 184 GLY GLY A . n A 1 198 GLU 198 185 185 GLU GLU A . n A 1 199 GLY 199 186 186 GLY GLY A . n A 1 200 ILE 200 187 187 ILE ILE A . n A 1 201 ARG 201 188 188 ARG ARG A . n A 1 202 VAL 202 189 189 VAL VAL A . n A 1 203 ASN 203 190 190 ASN ASN A . n A 1 204 ALA 204 191 191 ALA ALA A . n A 1 205 ILE 205 192 192 ILE ILE A . n A 1 206 SER 206 193 193 SER SER A . n A 1 207 ALA 207 194 194 ALA ALA A . n A 1 208 GLY 208 195 195 GLY GLY A . n A 1 209 PRO 209 196 196 PRO PRO A . n A 1 210 ILE 210 197 197 ILE ILE A . n A 1 211 ARG 211 198 198 ARG ARG A . n A 1 212 THR 212 199 199 THR THR A . n A 1 213 LEU 213 200 200 LEU LEU A . n A 1 214 ALA 214 201 201 ALA ALA A . n A 1 215 ALA 215 202 202 ALA ALA A . n A 1 216 SER 216 203 203 SER SER A . n A 1 217 GLY 217 204 204 GLY GLY A . n A 1 218 ILE 218 205 205 ILE ILE A . n A 1 219 LYS 219 206 206 LYS LYS A . n A 1 220 SER 220 207 207 SER SER A . n A 1 221 PHE 221 208 208 PHE PHE A . n A 1 222 ARG 222 209 209 ARG ARG A . n A 1 223 ARG 223 210 210 ARG ARG A . n A 1 224 MET 224 211 211 MET MET A . n A 1 225 LEU 225 212 212 LEU LEU A . n A 1 226 ASP 226 213 213 ASP ASP A . n A 1 227 VAL 227 214 214 VAL VAL A . n A 1 228 SER 228 215 215 SER SER A . n A 1 229 GLU 229 216 216 GLU GLU A . n A 1 230 LYS 230 217 217 LYS LYS A . n A 1 231 ILE 231 218 218 ILE ILE A . n A 1 232 ALA 232 219 219 ALA ALA A . n A 1 233 PRO 233 220 220 PRO PRO A . n A 1 234 LEU 234 221 221 LEU LEU A . n A 1 235 GLN 235 222 222 GLN GLN A . n A 1 236 ARG 236 223 223 ARG ARG A . n A 1 237 ASN 237 224 224 ASN ASN A . n A 1 238 VAL 238 225 225 VAL VAL A . n A 1 239 SER 239 226 226 SER SER A . n A 1 240 GLN 240 227 227 GLN GLN A . n A 1 241 GLU 241 228 228 GLU GLU A . n A 1 242 GLU 242 229 229 GLU GLU A . n A 1 243 VAL 243 230 230 VAL VAL A . n A 1 244 GLY 244 231 231 GLY GLY A . n A 1 245 ASN 245 232 232 ASN ASN A . n A 1 246 ALA 246 233 233 ALA ALA A . n A 1 247 ALA 247 234 234 ALA ALA A . n A 1 248 LEU 248 235 235 LEU LEU A . n A 1 249 PHE 249 236 236 PHE PHE A . n A 1 250 LEU 250 237 237 LEU LEU A . n A 1 251 LEU 251 238 238 LEU LEU A . n A 1 252 SER 252 239 239 SER SER A . n A 1 253 PRO 253 240 240 PRO PRO A . n A 1 254 TRP 254 241 241 TRP TRP A . n A 1 255 ALA 255 242 242 ALA ALA A . n A 1 256 SER 256 243 243 SER SER A . n A 1 257 GLY 257 244 244 GLY GLY A . n A 1 258 ILE 258 245 245 ILE ILE A . n A 1 259 THR 259 246 246 THR THR A . n A 1 260 GLY 260 247 247 GLY GLY A . n A 1 261 GLU 261 248 248 GLU GLU A . n A 1 262 ILE 262 249 249 ILE ILE A . n A 1 263 LEU 263 250 250 LEU LEU A . n A 1 264 PHE 264 251 251 PHE PHE A . n A 1 265 VAL 265 252 252 VAL VAL A . n A 1 266 ASP 266 253 253 ASP ASP A . n A 1 267 ALA 267 254 254 ALA ALA A . n A 1 268 GLY 268 255 255 GLY GLY A . n A 1 269 PHE 269 256 256 PHE PHE A . n A 1 270 ASN 270 257 257 ASN ASN A . n A 1 271 THR 271 258 258 THR THR A . n A 1 272 VAL 272 259 259 VAL VAL A . n A 1 273 ALA 273 260 260 ALA ALA A . n A 1 274 ILE 274 261 261 ILE ILE A . n A 1 275 SER 275 262 262 SER SER A . n A 1 276 GLU 276 263 263 GLU GLU A . n A 1 277 LYS 277 264 264 LYS LYS A . n A 1 278 ILE 278 265 265 ILE ILE A . n A 1 279 MET 279 266 ? ? ? A . n A 1 280 MET 280 267 ? ? ? A . n A 1 281 MET 281 268 ? ? ? A . n A 1 282 ALA 282 269 ? ? ? A . n A 1 283 GLY 283 270 ? ? ? A . n A 1 284 ASP 284 271 ? ? ? A . n A 1 285 GLY 285 272 ? ? ? A . n A 1 286 GLU 286 273 ? ? ? A . n A 1 287 GLN 287 274 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 301 1 CA CA A . C 3 HOH 1 401 419 HOH HOH A . C 3 HOH 2 402 407 HOH HOH A . C 3 HOH 3 403 402 HOH HOH A . C 3 HOH 4 404 406 HOH HOH A . C 3 HOH 5 405 405 HOH HOH A . C 3 HOH 6 406 422 HOH HOH A . C 3 HOH 7 407 401 HOH HOH A . C 3 HOH 8 408 403 HOH HOH A . C 3 HOH 9 409 449 HOH HOH A . C 3 HOH 10 410 420 HOH HOH A . C 3 HOH 11 411 413 HOH HOH A . C 3 HOH 12 412 408 HOH HOH A . C 3 HOH 13 413 404 HOH HOH A . C 3 HOH 14 414 415 HOH HOH A . C 3 HOH 15 415 409 HOH HOH A . C 3 HOH 16 416 426 HOH HOH A . C 3 HOH 17 417 410 HOH HOH A . C 3 HOH 18 418 427 HOH HOH A . C 3 HOH 19 419 412 HOH HOH A . C 3 HOH 20 420 416 HOH HOH A . C 3 HOH 21 421 428 HOH HOH A . C 3 HOH 22 422 424 HOH HOH A . C 3 HOH 23 423 425 HOH HOH A . C 3 HOH 24 424 417 HOH HOH A . C 3 HOH 25 425 411 HOH HOH A . C 3 HOH 26 426 432 HOH HOH A . C 3 HOH 27 427 414 HOH HOH A . C 3 HOH 28 428 418 HOH HOH A . C 3 HOH 29 429 429 HOH HOH A . C 3 HOH 30 430 444 HOH HOH A . C 3 HOH 31 431 435 HOH HOH A . C 3 HOH 32 432 434 HOH HOH A . C 3 HOH 33 433 1 HOH HOH A . C 3 HOH 34 434 430 HOH HOH A . C 3 HOH 35 435 433 HOH HOH A . C 3 HOH 36 436 431 HOH HOH A . C 3 HOH 37 437 447 HOH HOH A . C 3 HOH 38 438 421 HOH HOH A . C 3 HOH 39 439 423 HOH HOH A . C 3 HOH 40 440 446 HOH HOH A . C 3 HOH 41 441 436 HOH HOH A . C 3 HOH 42 442 452 HOH HOH A . C 3 HOH 43 443 443 HOH HOH A . C 3 HOH 44 444 438 HOH HOH A . C 3 HOH 45 445 439 HOH HOH A . C 3 HOH 46 446 440 HOH HOH A . C 3 HOH 47 447 442 HOH HOH A . C 3 HOH 48 448 445 HOH HOH A . C 3 HOH 49 449 450 HOH HOH A . C 3 HOH 50 450 2 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 2 ? 'data scaling' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 3 ? phasing ? ? 'Alexei Vaguine' alexei@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/molrep.html ? MOLREP ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Oct. 31, 2020' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7FC8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.982 _cell.length_a_esd ? _cell.length_b 74.982 _cell.length_b_esd ? _cell.length_c 101.461 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7FC8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7FC8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.76 _exptl_crystal.description 'Rod shaped crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M calcium chloride, 0.1M HEPES buffer, 22% PEG 400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-01-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'BRUKER AXS MICROSTAR-H' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 50.03 _reflns.entry_id 7FC8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.360 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12183 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.100 _reflns.pdbx_Rmerge_I_obs 0.065 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 46.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.532 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.360 2.400 ? ? ? ? ? ? 309 51.400 ? ? ? ? 0.528 ? ? ? ? ? ? ? ? 5.400 ? 1.578 ? ? ? ? ? 1 1 0.904 ? ? ? ? ? ? ? ? ? ? 2.400 2.440 ? ? ? ? ? ? 612 100.000 ? ? ? ? 0.470 ? ? ? ? ? ? ? ? 9.200 ? 1.339 ? ? ? ? ? 2 1 ? ? ? ? ? ? ? ? ? ? ? 2.440 2.490 ? ? ? ? ? ? 605 100.000 ? ? ? ? 0.553 ? ? ? ? ? ? ? ? 9.900 ? 1.131 ? ? ? ? ? 3 1 ? ? ? ? ? ? ? ? ? ? ? 2.490 2.540 ? ? ? ? ? ? 606 100.000 ? ? ? ? 0.544 ? ? ? ? ? ? ? ? 10.200 ? 1.026 ? ? ? ? ? 4 1 ? ? ? ? ? ? ? ? ? ? ? 2.540 2.600 ? ? ? ? ? ? 606 100.000 ? ? ? ? 0.500 ? ? ? ? ? ? ? ? 10.200 ? 1.030 ? ? ? ? ? 5 1 ? ? ? ? ? ? ? ? ? ? ? 2.600 2.660 ? ? ? ? ? ? 621 100.000 ? ? ? ? 0.349 ? ? ? ? ? ? ? ? 10.300 ? 1.032 ? ? ? ? ? 6 1 ? ? ? ? ? ? ? ? ? ? ? 2.660 2.720 ? ? ? ? ? ? 596 100.000 ? ? ? ? 0.325 ? ? ? ? ? ? ? ? 10.400 ? 1.046 ? ? ? ? ? 7 1 ? ? ? ? ? ? ? ? ? ? ? 2.720 2.800 ? ? ? ? ? ? 628 100.000 ? ? ? ? 0.282 ? ? ? ? ? ? ? ? 10.300 ? 1.097 ? ? ? ? ? 8 1 ? ? ? ? ? ? ? ? ? ? ? 2.800 2.880 ? ? ? ? ? ? 612 100.000 ? ? ? ? 0.231 ? ? ? ? ? ? ? ? 10.400 ? 1.169 ? ? ? ? ? 9 1 ? ? ? ? ? ? ? ? ? ? ? 2.880 2.970 ? ? ? ? ? ? 608 100.000 ? ? ? ? 0.183 ? ? ? ? ? ? ? ? 10.500 ? 1.280 ? ? ? ? ? 10 1 ? ? ? ? ? ? ? ? ? ? ? 2.970 3.080 ? ? ? ? ? ? 610 100.000 ? ? ? ? 0.154 ? ? ? ? ? ? ? ? 10.400 ? 1.367 ? ? ? ? ? 11 1 ? ? ? ? ? ? ? ? ? ? ? 3.080 3.200 ? ? ? ? ? ? 618 100.000 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 10.500 ? 1.403 ? ? ? ? ? 12 1 ? ? ? ? ? ? ? ? ? ? ? 3.200 3.350 ? ? ? ? ? ? 623 100.000 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 10.600 ? 1.637 ? ? ? ? ? 13 1 ? ? ? ? ? ? ? ? ? ? ? 3.350 3.530 ? ? ? ? ? ? 622 99.800 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 10.500 ? 1.861 ? ? ? ? ? 14 1 ? ? ? ? ? ? ? ? ? ? ? 3.530 3.750 ? ? ? ? ? ? 630 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 10.500 ? 2.092 ? ? ? ? ? 15 1 ? ? ? ? ? ? ? ? ? ? ? 3.750 4.030 ? ? ? ? ? ? 624 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 10.500 ? 2.273 ? ? ? ? ? 16 1 ? ? ? ? ? ? ? ? ? ? ? 4.030 4.440 ? ? ? ? ? ? 646 99.800 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 10.300 ? 2.337 ? ? ? ? ? 17 1 ? ? ? ? ? ? ? ? ? ? ? 4.440 5.080 ? ? ? ? ? ? 640 100.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 10.400 ? 2.215 ? ? ? ? ? 18 1 ? ? ? ? ? ? ? ? ? ? ? 5.080 6.400 ? ? ? ? ? ? 657 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 10.200 ? 1.776 ? ? ? ? ? 19 1 ? ? ? ? ? ? ? ? ? ? ? 6.400 50.000 ? ? ? ? ? ? 710 97.700 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 9.500 ? 1.768 ? ? ? ? ? 20 1 ? ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 1.1100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 1.1100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -2.2100 _refine.B_iso_max 167.640 _refine.B_iso_mean 61.7330 _refine.B_iso_min 27.930 _refine.correlation_coeff_Fo_to_Fc 0.9580 _refine.correlation_coeff_Fo_to_Fc_free 0.9250 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7FC8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.377 _refine.ls_d_res_low 31.8600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11554 _refine.ls_number_reflns_R_free 596 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4000 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2029 _refine.ls_R_factor_R_free 0.2574 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1999 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZJU _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3290 _refine.pdbx_overall_ESU_R_Free 0.2510 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.8210 _refine.overall_SU_ML 0.1980 _refine.overall_SU_R_Cruickshank_DPI 0.3288 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.377 _refine_hist.d_res_low 31.8600 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 1873 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 243 _refine_hist.pdbx_B_iso_mean_ligand 129.93 _refine_hist.pdbx_B_iso_mean_solvent 54.78 _refine_hist.pdbx_number_atoms_protein 1822 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.012 1846 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.496 1.613 2490 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.821 5.000 240 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.711 22.000 85 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.509 15.000 322 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 25.404 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.114 0.200 252 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1350 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.377 _refine_ls_shell.d_res_low 2.4380 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 43 _refine_ls_shell.number_reflns_R_work 784 _refine_ls_shell.percent_reflns_obs 93.8700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3470 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3270 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7FC8 _struct.title 'Crystal structure of the Apo enoyl-ACP-reductase (FabI) from Moraxella catarrhalis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7FC8 _struct_keywords.text 'FabI, NAD, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D5VCE0_MORCB _struct_ref.pdbx_db_accession D5VCE0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLLKGQRFVVTGIASKLSIAWAIAESLHREGAQLILTYPNDKIKKRVDMAAEAFDAVAVIECDVGSDESIQVCFDEIAKH WGVGDDKGIDGIVHAIGFAPADQLDGDFTQATTREGSQIAHDISSYSFVALAKAGRELLAARQGSLLTLTYEGSISVLPN YNVMGMAKASLEASVRYLASSLGGEGIRVNAISAGPIRTLAASGIKSFRRMLDVSEKIAPLGRNVSQEEVGNAALFLLSP WASGITGEILFVDAGFNTVAISEKIMMMAGDGEQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7FC8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 287 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D5VCE0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 274 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 274 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7FC8 HIS A 1 ? UNP D5VCE0 ? ? 'expression tag' -12 1 1 7FC8 HIS A 2 ? UNP D5VCE0 ? ? 'expression tag' -11 2 1 7FC8 HIS A 3 ? UNP D5VCE0 ? ? 'expression tag' -10 3 1 7FC8 HIS A 4 ? UNP D5VCE0 ? ? 'expression tag' -9 4 1 7FC8 HIS A 5 ? UNP D5VCE0 ? ? 'expression tag' -8 5 1 7FC8 HIS A 6 ? UNP D5VCE0 ? ? 'expression tag' -7 6 1 7FC8 GLU A 7 ? UNP D5VCE0 ? ? 'expression tag' -6 7 1 7FC8 ASN A 8 ? UNP D5VCE0 ? ? 'expression tag' -5 8 1 7FC8 LEU A 9 ? UNP D5VCE0 ? ? 'expression tag' -4 9 1 7FC8 TYR A 10 ? UNP D5VCE0 ? ? 'expression tag' -3 10 1 7FC8 PHE A 11 ? UNP D5VCE0 ? ? 'expression tag' -2 11 1 7FC8 GLN A 12 ? UNP D5VCE0 ? ? 'expression tag' -1 12 1 7FC8 SER A 13 ? UNP D5VCE0 ? ? 'expression tag' 0 13 1 7FC8 GLN A 235 ? UNP D5VCE0 GLY 222 variant 222 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11320 ? 1 MORE -135 ? 1 'SSA (A^2)' 36980 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 32 ? GLU A 43 ? ILE A 19 GLU A 30 1 ? 12 HELX_P HELX_P2 AA2 LYS A 57 ? ASP A 68 ? LYS A 44 ASP A 55 1 ? 12 HELX_P HELX_P3 AA3 SER A 79 ? GLY A 95 ? SER A 66 GLY A 82 1 ? 17 HELX_P HELX_P4 AA4 THR A 126 ? SER A 138 ? THR A 113 SER A 125 1 ? 13 HELX_P HELX_P5 AA5 SER A 138 ? ARG A 155 ? SER A 125 ARG A 142 1 ? 18 HELX_P HELX_P6 AA6 VAL A 176 ? GLY A 196 ? VAL A 163 GLY A 183 1 ? 21 HELX_P HELX_P7 AA7 GLY A 197 ? GLY A 199 ? GLY A 184 GLY A 186 5 ? 3 HELX_P HELX_P8 AA8 SER A 220 ? ALA A 232 ? SER A 207 ALA A 219 1 ? 13 HELX_P HELX_P9 AA9 SER A 239 ? SER A 252 ? SER A 226 SER A 239 1 ? 14 HELX_P HELX_P10 AB1 PRO A 253 ? SER A 256 ? PRO A 240 SER A 243 5 ? 4 HELX_P HELX_P11 AB2 GLY A 268 ? VAL A 272 ? GLY A 255 VAL A 259 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 261 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 248 A CA 301 1_555 ? ? ? ? ? ? ? 2.591 ? ? metalc2 metalc ? ? A GLU 261 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 248 A CA 301 2_555 ? ? ? ? ? ? ? 2.782 ? ? metalc3 metalc ? ? A ILE 262 O ? ? ? 1_555 B CA . CA ? ? A ILE 249 A CA 301 1_555 ? ? ? ? ? ? ? 2.835 ? ? metalc4 metalc ? ? A ILE 262 O ? ? ? 1_555 B CA . CA ? ? A ILE 249 A CA 301 2_555 ? ? ? ? ? ? ? 3.103 ? ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 301 A HOH 433 1_555 ? ? ? ? ? ? ? 2.541 ? ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 301 A HOH 433 2_555 ? ? ? ? ? ? ? 2.588 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 0.0 ? 2 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 262 ? A ILE 249 ? 1_555 105.9 ? 3 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 262 ? A ILE 249 ? 1_555 105.9 ? 4 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 262 ? A ILE 249 ? 1_555 105.9 ? 5 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 262 ? A ILE 249 ? 1_555 105.9 ? 6 O ? A ILE 262 ? A ILE 249 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ILE 262 ? A ILE 249 ? 1_555 0.0 ? 7 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 1_555 137.6 ? 8 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 1_555 137.6 ? 9 O ? A ILE 262 ? A ILE 249 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 1_555 65.8 ? 10 O ? A ILE 262 ? A ILE 249 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 1_555 65.8 ? 11 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 2_555 80.0 ? 12 OE2 ? A GLU 261 ? A GLU 248 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 2_555 80.0 ? 13 O ? A ILE 262 ? A ILE 249 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 2_555 130.1 ? 14 O ? A ILE 262 ? A ILE 249 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 2_555 130.1 ? 15 O ? C HOH . ? A HOH 433 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? C HOH . ? A HOH 433 ? 2_555 76.9 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 71 ? GLU A 74 ? ALA A 58 GLU A 61 AA1 2 GLN A 46 ? TYR A 51 ? GLN A 33 TYR A 38 AA1 3 ARG A 20 ? THR A 24 ? ARG A 7 THR A 11 AA1 4 GLY A 104 ? HIS A 107 ? GLY A 91 HIS A 94 AA1 5 SER A 158 ? TYR A 164 ? SER A 145 TYR A 151 AA1 6 ARG A 201 ? ALA A 207 ? ARG A 188 ALA A 194 AA1 7 ILE A 262 ? VAL A 265 ? ILE A 249 VAL A 252 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 73 ? O ILE A 60 N LEU A 49 ? N LEU A 36 AA1 2 3 O ILE A 48 ? O ILE A 35 N VAL A 23 ? N VAL A 10 AA1 3 4 N VAL A 22 ? N VAL A 9 O VAL A 106 ? O VAL A 93 AA1 4 5 N HIS A 107 ? N HIS A 94 O LEU A 160 ? O LEU A 147 AA1 5 6 N THR A 163 ? N THR A 150 O ALA A 207 ? O ALA A 194 AA1 6 7 N SER A 206 ? N SER A 193 O VAL A 265 ? O VAL A 252 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 43 ? ? -111.41 71.12 2 1 ASP A 55 ? ? 70.95 39.19 3 1 ASP A 86 ? ? -102.59 46.02 4 1 ILE A 96 ? ? -89.44 -78.30 5 1 SER A 125 ? ? -108.93 -61.26 6 1 ASN A 162 ? ? -136.77 -118.36 7 1 ALA A 201 ? ? 79.50 -66.27 8 1 LYS A 206 ? ? 81.45 -8.51 9 1 ASP A 253 ? ? -155.84 19.30 10 1 ILE A 261 ? ? 78.62 151.78 11 1 GLU A 263 ? ? 87.58 -56.72 12 1 LYS A 264 ? ? -156.62 40.36 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 301 ? B CA . 2 1 A HOH 449 ? C HOH . # _phasing.method MR # _pdbx_entry_details.entry_id 7FC8 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -12 ? A HIS 1 2 1 Y 1 A HIS -11 ? A HIS 2 3 1 Y 1 A HIS -10 ? A HIS 3 4 1 Y 1 A HIS -9 ? A HIS 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A GLU -6 ? A GLU 7 8 1 Y 1 A ASN -5 ? A ASN 8 9 1 Y 1 A LEU -4 ? A LEU 9 10 1 Y 1 A TYR -3 ? A TYR 10 11 1 Y 1 A PHE -2 ? A PHE 11 12 1 Y 1 A GLN -1 ? A GLN 12 13 1 Y 1 A SER 0 ? A SER 13 14 1 Y 1 A PHE 98 ? A PHE 111 15 1 Y 1 A ALA 99 ? A ALA 112 16 1 Y 1 A PRO 100 ? A PRO 113 17 1 Y 1 A ALA 101 ? A ALA 114 18 1 Y 1 A ASP 102 ? A ASP 115 19 1 Y 1 A GLN 103 ? A GLN 116 20 1 Y 1 A LEU 104 ? A LEU 117 21 1 Y 1 A ASP 105 ? A ASP 118 22 1 Y 1 A GLY 106 ? A GLY 119 23 1 Y 1 A ASP 107 ? A ASP 120 24 1 Y 1 A PHE 108 ? A PHE 121 25 1 Y 1 A THR 109 ? A THR 122 26 1 Y 1 A GLN 110 ? A GLN 123 27 1 Y 1 A ALA 111 ? A ALA 124 28 1 Y 1 A GLY 153 ? A GLY 166 29 1 Y 1 A SER 154 ? A SER 167 30 1 Y 1 A ILE 155 ? A ILE 168 31 1 Y 1 A SER 156 ? A SER 169 32 1 Y 1 A VAL 157 ? A VAL 170 33 1 Y 1 A LEU 158 ? A LEU 171 34 1 Y 1 A PRO 159 ? A PRO 172 35 1 Y 1 A ASN 160 ? A ASN 173 36 1 Y 1 A MET 266 ? A MET 279 37 1 Y 1 A MET 267 ? A MET 280 38 1 Y 1 A MET 268 ? A MET 281 39 1 Y 1 A ALA 269 ? A ALA 282 40 1 Y 1 A GLY 270 ? A GLY 283 41 1 Y 1 A ASP 271 ? A ASP 284 42 1 Y 1 A GLY 272 ? A GLY 285 43 1 Y 1 A GLU 273 ? A GLU 286 44 1 Y 1 A GLN 274 ? A GLN 287 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number 'BIC/12(29)/2013' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZJU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7FC8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013337 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013337 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009856 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_