data_7JIW # _entry.id 7JIW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7JIW pdb_00007jiw 10.2210/pdb7jiw/pdb WWPDB D_1000250866 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2' 6WZU unspecified PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2, C111S mutant' 6WRH unspecified PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2 , C111S mutant, in complex with PLP_Snyder457' 7JIR unspecified PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2 , C111S mutant, in complex with PLP_Snyder495' 7JIT unspecified PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2 , C111S mutant, in complex with PLP_Snyder530' 7JIV unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JIW _pdbx_database_status.recvd_initial_deposition_date 2020-07-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Osipiuk, J.' 1 ? 'Tesar, C.' 2 ? 'Endres, M.' 3 ? 'Lisnyak, V.' 4 ? 'Maki, S.' 5 ? 'Taylor, C.' 6 ? 'Zhang, Y.' 7 ? 'Zhou, Z.' 8 ? 'Azizi, S.A.' 9 ? 'Jones, K.' 10 ? 'Kathayat, R.' 11 ? 'Snyder, S.A.' 12 ? 'Dickinson, B.C.' 13 ? 'Joachimiak, A.' 14 ? 'Center for Structural Genomics of Infectious Diseases (CSGID)' 15 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 743 _citation.page_last 743 _citation.title 'Structure of papain-like protease from SARS-CoV-2 and its complexes with non-covalent inhibitors.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-21060-3 _citation.pdbx_database_id_PubMed 33531496 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Osipiuk, J.' 1 ? primary 'Azizi, S.A.' 2 0000-0002-9226-9917 primary 'Dvorkin, S.' 3 ? primary 'Endres, M.' 4 ? primary 'Jedrzejczak, R.' 5 ? primary 'Jones, K.A.' 6 0000-0003-0711-5516 primary 'Kang, S.' 7 ? primary 'Kathayat, R.S.' 8 0000-0002-9159-2413 primary 'Kim, Y.' 9 ? primary 'Lisnyak, V.G.' 10 0000-0002-4406-8440 primary 'Maki, S.L.' 11 0000-0001-6917-3602 primary 'Nicolaescu, V.' 12 ? primary 'Taylor, C.A.' 13 ? primary 'Tesar, C.' 14 ? primary 'Zhang, Y.A.' 15 ? primary 'Zhou, Z.' 16 0000-0002-2792-8429 primary 'Randall, G.' 17 ? primary 'Michalska, K.' 18 ? primary 'Snyder, S.A.' 19 0000-0003-3594-8769 primary 'Dickinson, B.C.' 20 0000-0002-9616-1911 primary 'Joachimiak, A.' 21 0000-0003-2535-6209 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7JIW _cell.details ? _cell.formula_units_Z ? _cell.length_a 113.648 _cell.length_a_esd ? _cell.length_b 113.648 _cell.length_b_esd ? _cell.length_c 220.574 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JIW _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Papain-like protease' 35943.762 1 3.4.22.- ? ? '3 N-terminal residues (SNA) are from expression tag' 2 non-polymer syn '5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]benzamide' 358.433 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 4 ? ? ? ? 5 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 6 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Non-structural protein 3,nsp3,PL2-PRO,Papain-like proteinase,PL-PRO' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDP SFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNK TVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDP SFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNK TVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 GLU n 1 5 VAL n 1 6 ARG n 1 7 THR n 1 8 ILE n 1 9 LYS n 1 10 VAL n 1 11 PHE n 1 12 THR n 1 13 THR n 1 14 VAL n 1 15 ASP n 1 16 ASN n 1 17 ILE n 1 18 ASN n 1 19 LEU n 1 20 HIS n 1 21 THR n 1 22 GLN n 1 23 VAL n 1 24 VAL n 1 25 ASP n 1 26 MET n 1 27 SER n 1 28 MET n 1 29 THR n 1 30 TYR n 1 31 GLY n 1 32 GLN n 1 33 GLN n 1 34 PHE n 1 35 GLY n 1 36 PRO n 1 37 THR n 1 38 TYR n 1 39 LEU n 1 40 ASP n 1 41 GLY n 1 42 ALA n 1 43 ASP n 1 44 VAL n 1 45 THR n 1 46 LYS n 1 47 ILE n 1 48 LYS n 1 49 PRO n 1 50 HIS n 1 51 ASN n 1 52 SER n 1 53 HIS n 1 54 GLU n 1 55 GLY n 1 56 LYS n 1 57 THR n 1 58 PHE n 1 59 TYR n 1 60 VAL n 1 61 LEU n 1 62 PRO n 1 63 ASN n 1 64 ASP n 1 65 ASP n 1 66 THR n 1 67 LEU n 1 68 ARG n 1 69 VAL n 1 70 GLU n 1 71 ALA n 1 72 PHE n 1 73 GLU n 1 74 TYR n 1 75 TYR n 1 76 HIS n 1 77 THR n 1 78 THR n 1 79 ASP n 1 80 PRO n 1 81 SER n 1 82 PHE n 1 83 LEU n 1 84 GLY n 1 85 ARG n 1 86 TYR n 1 87 MET n 1 88 SER n 1 89 ALA n 1 90 LEU n 1 91 ASN n 1 92 HIS n 1 93 THR n 1 94 LYS n 1 95 LYS n 1 96 TRP n 1 97 LYS n 1 98 TYR n 1 99 PRO n 1 100 GLN n 1 101 VAL n 1 102 ASN n 1 103 GLY n 1 104 LEU n 1 105 THR n 1 106 SER n 1 107 ILE n 1 108 LYS n 1 109 TRP n 1 110 ALA n 1 111 ASP n 1 112 ASN n 1 113 ASN n 1 114 CYS n 1 115 TYR n 1 116 LEU n 1 117 ALA n 1 118 THR n 1 119 ALA n 1 120 LEU n 1 121 LEU n 1 122 THR n 1 123 LEU n 1 124 GLN n 1 125 GLN n 1 126 ILE n 1 127 GLU n 1 128 LEU n 1 129 LYS n 1 130 PHE n 1 131 ASN n 1 132 PRO n 1 133 PRO n 1 134 ALA n 1 135 LEU n 1 136 GLN n 1 137 ASP n 1 138 ALA n 1 139 TYR n 1 140 TYR n 1 141 ARG n 1 142 ALA n 1 143 ARG n 1 144 ALA n 1 145 GLY n 1 146 GLU n 1 147 ALA n 1 148 ALA n 1 149 ASN n 1 150 PHE n 1 151 CYS n 1 152 ALA n 1 153 LEU n 1 154 ILE n 1 155 LEU n 1 156 ALA n 1 157 TYR n 1 158 CYS n 1 159 ASN n 1 160 LYS n 1 161 THR n 1 162 VAL n 1 163 GLY n 1 164 GLU n 1 165 LEU n 1 166 GLY n 1 167 ASP n 1 168 VAL n 1 169 ARG n 1 170 GLU n 1 171 THR n 1 172 MET n 1 173 SER n 1 174 TYR n 1 175 LEU n 1 176 PHE n 1 177 GLN n 1 178 HIS n 1 179 ALA n 1 180 ASN n 1 181 LEU n 1 182 ASP n 1 183 SER n 1 184 CYS n 1 185 LYS n 1 186 ARG n 1 187 VAL n 1 188 LEU n 1 189 ASN n 1 190 VAL n 1 191 VAL n 1 192 CYS n 1 193 LYS n 1 194 THR n 1 195 CYS n 1 196 GLY n 1 197 GLN n 1 198 GLN n 1 199 GLN n 1 200 THR n 1 201 THR n 1 202 LEU n 1 203 LYS n 1 204 GLY n 1 205 VAL n 1 206 GLU n 1 207 ALA n 1 208 VAL n 1 209 MET n 1 210 TYR n 1 211 MET n 1 212 GLY n 1 213 THR n 1 214 LEU n 1 215 SER n 1 216 TYR n 1 217 GLU n 1 218 GLN n 1 219 PHE n 1 220 LYS n 1 221 LYS n 1 222 GLY n 1 223 VAL n 1 224 GLN n 1 225 ILE n 1 226 PRO n 1 227 CYS n 1 228 THR n 1 229 CYS n 1 230 GLY n 1 231 LYS n 1 232 GLN n 1 233 ALA n 1 234 THR n 1 235 LYS n 1 236 TYR n 1 237 LEU n 1 238 VAL n 1 239 GLN n 1 240 GLN n 1 241 GLU n 1 242 SER n 1 243 PRO n 1 244 PHE n 1 245 VAL n 1 246 MET n 1 247 MET n 1 248 SER n 1 249 ALA n 1 250 PRO n 1 251 PRO n 1 252 ALA n 1 253 GLN n 1 254 TYR n 1 255 GLU n 1 256 LEU n 1 257 LYS n 1 258 HIS n 1 259 GLY n 1 260 THR n 1 261 PHE n 1 262 THR n 1 263 CYS n 1 264 ALA n 1 265 SER n 1 266 GLU n 1 267 TYR n 1 268 THR n 1 269 GLY n 1 270 ASN n 1 271 TYR n 1 272 GLN n 1 273 CYS n 1 274 GLY n 1 275 HIS n 1 276 TYR n 1 277 LYS n 1 278 HIS n 1 279 ILE n 1 280 THR n 1 281 SER n 1 282 LYS n 1 283 GLU n 1 284 THR n 1 285 LEU n 1 286 TYR n 1 287 CYS n 1 288 ILE n 1 289 ASP n 1 290 GLY n 1 291 ALA n 1 292 LEU n 1 293 LEU n 1 294 THR n 1 295 LYS n 1 296 SER n 1 297 SER n 1 298 GLU n 1 299 TYR n 1 300 LYS n 1 301 GLY n 1 302 PRO n 1 303 ILE n 1 304 THR n 1 305 ASP n 1 306 VAL n 1 307 PHE n 1 308 TYR n 1 309 LYS n 1 310 GLU n 1 311 ASN n 1 312 SER n 1 313 TYR n 1 314 THR n 1 315 THR n 1 316 THR n 1 317 ILE n 1 318 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 318 _entity_src_gen.gene_src_common_name 2019-nCoV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Severe acute respiratory syndrome coronavirus 2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2697049 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG53 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R1A_SARS2 _struct_ref.pdbx_db_accession P0DTC1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFL GRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVG ELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK ; _struct_ref.pdbx_align_begin 1564 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7JIW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 318 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DTC1 _struct_ref_seq.db_align_beg 1564 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1878 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 315 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7JIW SER A 1 ? UNP P0DTC1 ? ? 'expression tag' -2 1 1 7JIW ASN A 2 ? UNP P0DTC1 ? ? 'expression tag' -1 2 1 7JIW ALA A 3 ? UNP P0DTC1 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VBY non-polymer . '5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]benzamide' ? 'C23 H22 N2 O2' 358.433 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JIW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 75.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES buffer, 0.2 M zinc acetate, 10% PEG 8000, 4 mM PLP_Snyder530' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-06-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 66.3 _reflns.entry_id 7JIW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 45.51 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 32308 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.900 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 44.3 _reflns.pdbx_netI_over_sigmaI 6.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.280 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.097 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.300 2.340 ? 0.97 ? ? ? ? 1576 99.000 ? ? ? ? 1.731 ? ? ? ? ? ? ? ? 14.600 ? 0.890 ? ? 1.788 0.428 ? 1 1 0.605 ? ? 2.340 2.380 ? ? ? ? ? ? 1585 99.900 ? ? ? ? 1.629 ? ? ? ? ? ? ? ? 16.800 ? 0.886 ? ? 1.678 0.390 ? 2 1 0.806 ? ? 2.380 2.430 ? ? ? ? ? ? 1589 100.000 ? ? ? ? 1.434 ? ? ? ? ? ? ? ? 19.400 ? 0.903 ? ? 1.472 0.327 ? 3 1 0.821 ? ? 2.430 2.480 ? ? ? ? ? ? 1598 100.000 ? ? ? ? 1.486 ? ? ? ? ? ? ? ? 20.700 ? 0.893 ? ? 1.523 0.330 ? 4 1 0.877 ? ? 2.480 2.530 ? ? ? ? ? ? 1575 100.000 ? ? ? ? 1.105 ? ? ? ? ? ? ? ? 19.800 ? 0.917 ? ? 1.134 0.251 ? 5 1 0.923 ? ? 2.530 2.590 ? ? ? ? ? ? 1594 100.000 ? ? ? ? 0.995 ? ? ? ? ? ? ? ? 21.400 ? 0.934 ? ? 1.019 0.217 ? 6 1 0.949 ? ? 2.590 2.660 ? ? ? ? ? ? 1590 100.000 ? ? ? ? 0.756 ? ? ? ? ? ? ? ? 22.900 ? 0.968 ? ? 0.773 0.160 ? 7 1 0.962 ? ? 2.660 2.730 ? ? ? ? ? ? 1615 100.000 ? ? ? ? 0.559 ? ? ? ? ? ? ? ? 22.700 ? 1.070 ? ? 0.571 0.118 ? 8 1 0.980 ? ? 2.730 2.810 ? ? ? ? ? ? 1581 100.000 ? ? ? ? 0.465 ? ? ? ? ? ? ? ? 22.500 ? 1.120 ? ? 0.476 0.099 ? 9 1 0.985 ? ? 2.810 2.900 ? ? ? ? ? ? 1600 100.000 ? ? ? ? 0.395 ? ? ? ? ? ? ? ? 22.000 ? 1.201 ? ? 0.404 0.085 ? 10 1 0.987 ? ? 2.900 3.000 ? ? ? ? ? ? 1606 100.000 ? ? ? ? 0.296 ? ? ? ? ? ? ? ? 21.600 ? 1.332 ? ? 0.303 0.064 ? 11 1 0.991 ? ? 3.000 3.120 ? ? ? ? ? ? 1591 100.000 ? ? ? ? 0.237 ? ? ? ? ? ? ? ? 19.700 ? 1.435 ? ? 0.243 0.054 ? 12 1 0.994 ? ? 3.120 3.260 ? ? ? ? ? ? 1624 100.000 ? ? ? ? 0.184 ? ? ? ? ? ? ? ? 22.400 ? 1.531 ? ? 0.188 0.039 ? 13 1 0.995 ? ? 3.260 3.440 ? ? ? ? ? ? 1624 100.000 ? ? ? ? 0.156 ? ? ? ? ? ? ? ? 22.600 ? 1.626 ? ? 0.160 0.033 ? 14 1 0.997 ? ? 3.440 3.650 ? ? ? ? ? ? 1607 100.000 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 22.400 ? 1.632 ? ? 0.140 0.029 ? 15 1 0.997 ? ? 3.650 3.930 ? ? ? ? ? ? 1618 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 21.700 ? 1.635 ? ? 0.120 0.025 ? 16 1 0.997 ? ? 3.930 4.330 ? ? ? ? ? ? 1631 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 20.800 ? 1.595 ? ? 0.094 0.020 ? 17 1 0.998 ? ? 4.330 4.950 ? ? ? ? ? ? 1652 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 22.400 ? 1.576 ? ? 0.081 0.017 ? 18 1 0.998 ? ? 4.950 6.240 ? ? ? ? ? ? 1671 100.000 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 20.300 ? 1.543 ? ? 0.066 0.014 ? 19 1 0.999 ? ? 6.240 45.51 ? ? ? ? ? ? 1781 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 20.300 ? 1.559 ? ? 0.039 0.009 ? 20 1 1.000 ? ? # _refine.aniso_B[1][1] 2.8700 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 2.8700 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -5.7400 _refine.B_iso_max 174.600 _refine.B_iso_mean 82.6340 _refine.B_iso_min 58.460 _refine.correlation_coeff_Fo_to_Fc 0.9520 _refine.correlation_coeff_Fo_to_Fc_free 0.9450 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JIW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 45.5100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30715 _refine.ls_number_reflns_R_free 1564 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8500 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2135 _refine.ls_R_factor_R_free 0.2395 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2121 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6WZU _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1730 _refine.pdbx_overall_ESU_R_Free 0.1600 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.9340 _refine.overall_SU_ML 0.1580 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 45.5100 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 2501 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 305 _refine_hist.pdbx_B_iso_mean_ligand 85.86 _refine_hist.pdbx_B_iso_mean_solvent 71.70 _refine_hist.pdbx_number_atoms_protein 2422 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 2527 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 2252 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.489 1.674 3431 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.214 1.583 5253 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.843 5.000 305 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.544 24.068 118 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.408 15.000 418 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.762 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.059 0.200 331 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2803 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 523 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.3040 _refine_ls_shell.d_res_low 2.3640 _refine_ls_shell.number_reflns_all 2336 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 111 _refine_ls_shell.number_reflns_R_work 2225 _refine_ls_shell.percent_reflns_obs 98.5700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3950 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3890 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7JIW _struct.title 'The crystal structure of Papain-Like Protease of SARS CoV-2 in complex with PLP_Snyder530 inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JIW _struct_keywords.text ;covid-19, coronavirus, SARS, CoV-2, papain-like protease, IDP51000, Center for Structural Genomics of Infectious Diseases, CSGID, HYDROLASE, HYDROLASE-HYDROLASE inhibitor complex ; _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 4 ? K N N 5 ? L N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 29 ? GLY A 35 ? THR A 26 GLY A 32 1 ? 7 HELX_P HELX_P2 AA2 ASP A 64 ? HIS A 76 ? ASP A 61 HIS A 73 1 ? 13 HELX_P HELX_P3 AA3 SER A 81 ? LYS A 94 ? SER A 78 LYS A 91 1 ? 14 HELX_P HELX_P4 AA4 ASN A 113 ? GLN A 124 ? ASN A 110 GLN A 121 1 ? 12 HELX_P HELX_P5 AA5 PRO A 132 ? ALA A 144 ? PRO A 129 ALA A 141 1 ? 13 HELX_P HELX_P6 AA6 ALA A 147 ? CYS A 158 ? ALA A 144 CYS A 155 1 ? 12 HELX_P HELX_P7 AA7 ASP A 167 ? GLN A 177 ? ASP A 164 GLN A 174 1 ? 11 HELX_P HELX_P8 AA8 GLY A 204 ? VAL A 208 ? GLY A 201 VAL A 205 1 ? 5 HELX_P HELX_P9 AA9 SER A 215 ? GLY A 222 ? SER A 212 GLY A 219 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 65 OD1 ? ? ? 1_555 E ZN . ZN ? ? A ASP 62 A ZN 504 10_665 ? ? ? ? ? ? ? 1.860 ? ? metalc2 metalc ? ? A HIS 76 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 73 A ZN 504 1_555 ? ? ? ? ? ? ? 2.093 ? ? metalc3 metalc ? ? A HIS 92 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 89 A ZN 503 1_555 ? ? ? ? ? ? ? 2.092 ? ? metalc4 metalc ? ? A ASP 111 OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 108 A ZN 503 1_555 ? ? ? ? ? ? ? 2.145 ? ? metalc5 metalc ? ? A CYS 114 SG ? ? ? 1_555 F ZN . ZN ? ? A CYS 111 A ZN 505 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc6 metalc ? ? A CYS 192 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 189 A ZN 502 1_555 ? ? ? ? ? ? ? 2.779 ? ? metalc7 metalc ? ? A CYS 195 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 192 A ZN 502 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc8 metalc ? ? A CYS 227 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 224 A ZN 502 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc9 metalc ? ? A CYS 229 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 226 A ZN 502 1_555 ? ? ? ? ? ? ? 2.549 ? ? metalc10 metalc ? ? A CYS 273 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 270 A ZN 503 15_555 ? ? ? ? ? ? ? 2.400 ? ? metalc11 metalc ? ? A HIS 275 ND1 ? ? ? 1_555 F ZN . ZN ? ? A HIS 272 A ZN 505 1_555 ? ? ? ? ? ? ? 2.044 ? ? metalc12 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 505 A HOH 621 1_555 ? ? ? ? ? ? ? 2.147 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA5 5 6 ? anti-parallel AA5 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 20 ? THR A 21 ? HIS A 17 THR A 18 AA1 2 PHE A 11 ? THR A 13 ? PHE A 8 THR A 10 AA1 3 THR A 57 ? VAL A 60 ? THR A 54 VAL A 57 AA1 4 THR A 37 ? LEU A 39 ? THR A 34 LEU A 36 AA1 5 ALA A 42 ? ASP A 43 ? ALA A 39 ASP A 40 AA2 1 GLN A 100 ? VAL A 101 ? GLN A 97 VAL A 98 AA2 2 LEU A 104 ? THR A 105 ? LEU A 101 THR A 102 AA3 1 GLY A 196 ? LYS A 203 ? GLY A 193 LYS A 200 AA3 2 LYS A 185 ? CYS A 192 ? LYS A 182 CYS A 189 AA3 3 GLN A 232 ? GLU A 241 ? GLN A 229 GLU A 238 AA3 4 VAL A 223 ? PRO A 226 ? VAL A 220 PRO A 223 AA4 1 GLY A 196 ? LYS A 203 ? GLY A 193 LYS A 200 AA4 2 LYS A 185 ? CYS A 192 ? LYS A 182 CYS A 189 AA4 3 GLN A 232 ? GLU A 241 ? GLN A 229 GLU A 238 AA4 4 SER A 312 ? THR A 314 ? SER A 309 THR A 311 AA5 1 MET A 209 ? MET A 211 ? MET A 206 MET A 208 AA5 2 PHE A 244 ? LYS A 257 ? PHE A 241 LYS A 254 AA5 3 GLU A 298 ? LYS A 309 ? GLU A 295 LYS A 306 AA5 4 CYS A 263 ? THR A 268 ? CYS A 260 THR A 265 AA5 5 HIS A 275 ? SER A 281 ? HIS A 272 SER A 278 AA5 6 LEU A 285 ? ASP A 289 ? LEU A 282 ASP A 286 AA5 7 LEU A 292 ? SER A 296 ? LEU A 289 SER A 293 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 20 ? O HIS A 17 N THR A 12 ? N THR A 9 AA1 2 3 N PHE A 11 ? N PHE A 8 O PHE A 58 ? O PHE A 55 AA1 3 4 O TYR A 59 ? O TYR A 56 N TYR A 38 ? N TYR A 35 AA1 4 5 N LEU A 39 ? N LEU A 36 O ALA A 42 ? O ALA A 39 AA2 1 2 N VAL A 101 ? N VAL A 98 O LEU A 104 ? O LEU A 101 AA3 1 2 O LEU A 202 ? O LEU A 199 N ARG A 186 ? N ARG A 183 AA3 2 3 N VAL A 187 ? N VAL A 184 O VAL A 238 ? O VAL A 235 AA3 3 4 O ALA A 233 ? O ALA A 230 N ILE A 225 ? N ILE A 222 AA4 1 2 O LEU A 202 ? O LEU A 199 N ARG A 186 ? N ARG A 183 AA4 2 3 N VAL A 187 ? N VAL A 184 O VAL A 238 ? O VAL A 235 AA4 3 4 N GLN A 240 ? N GLN A 237 O TYR A 313 ? O TYR A 310 AA5 1 2 N TYR A 210 ? N TYR A 207 O SER A 248 ? O SER A 245 AA5 2 3 N MET A 247 ? N MET A 244 O VAL A 306 ? O VAL A 303 AA5 3 4 O PHE A 307 ? O PHE A 304 N CYS A 263 ? N CYS A 260 AA5 4 5 N GLU A 266 ? N GLU A 263 O LYS A 277 ? O LYS A 274 AA5 5 6 N HIS A 278 ? N HIS A 275 O ILE A 288 ? O ILE A 285 AA5 6 7 N ASP A 289 ? N ASP A 286 O LEU A 292 ? O LEU A 289 # _atom_sites.entry_id 7JIW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008799 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008799 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004534 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S ZN # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 GLU 4 1 ? ? ? A . n A 1 5 VAL 5 2 ? ? ? A . n A 1 6 ARG 6 3 ? ? ? A . n A 1 7 THR 7 4 ? ? ? A . n A 1 8 ILE 8 5 ? ? ? A . n A 1 9 LYS 9 6 ? ? ? A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 PHE 11 8 8 PHE PHE A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 THR 13 10 10 THR THR A . n A 1 14 VAL 14 11 11 VAL VAL A . n A 1 15 ASP 15 12 12 ASP ASP A . n A 1 16 ASN 16 13 13 ASN ASN A . n A 1 17 ILE 17 14 14 ILE ILE A . n A 1 18 ASN 18 15 15 ASN ASN A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 HIS 20 17 17 HIS HIS A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 GLN 22 19 19 GLN GLN A . n A 1 23 VAL 23 20 20 VAL VAL A . n A 1 24 VAL 24 21 ? ? ? A . n A 1 25 ASP 25 22 ? ? ? A . n A 1 26 MET 26 23 ? ? ? A . n A 1 27 SER 27 24 ? ? ? A . n A 1 28 MET 28 25 25 MET MET A . n A 1 29 THR 29 26 26 THR THR A . n A 1 30 TYR 30 27 27 TYR TYR A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 GLN 32 29 29 GLN GLN A . n A 1 33 GLN 33 30 30 GLN GLN A . n A 1 34 PHE 34 31 31 PHE PHE A . n A 1 35 GLY 35 32 32 GLY GLY A . n A 1 36 PRO 36 33 33 PRO PRO A . n A 1 37 THR 37 34 34 THR THR A . n A 1 38 TYR 38 35 35 TYR TYR A . n A 1 39 LEU 39 36 36 LEU LEU A . n A 1 40 ASP 40 37 37 ASP ASP A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 ALA 42 39 39 ALA ALA A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 VAL 44 41 41 VAL VAL A . n A 1 45 THR 45 42 42 THR THR A . n A 1 46 LYS 46 43 43 LYS LYS A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 LYS 48 45 45 LYS LYS A . n A 1 49 PRO 49 46 46 PRO PRO A . n A 1 50 HIS 50 47 47 HIS HIS A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 SER 52 49 49 SER SER A . n A 1 53 HIS 53 50 50 HIS HIS A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 LYS 56 53 53 LYS LYS A . n A 1 57 THR 57 54 54 THR THR A . n A 1 58 PHE 58 55 55 PHE PHE A . n A 1 59 TYR 59 56 56 TYR TYR A . n A 1 60 VAL 60 57 57 VAL VAL A . n A 1 61 LEU 61 58 58 LEU LEU A . n A 1 62 PRO 62 59 59 PRO PRO A . n A 1 63 ASN 63 60 60 ASN ASN A . n A 1 64 ASP 64 61 61 ASP ASP A . n A 1 65 ASP 65 62 62 ASP ASP A . n A 1 66 THR 66 63 63 THR THR A . n A 1 67 LEU 67 64 64 LEU LEU A . n A 1 68 ARG 68 65 65 ARG ARG A . n A 1 69 VAL 69 66 66 VAL VAL A . n A 1 70 GLU 70 67 67 GLU GLU A . n A 1 71 ALA 71 68 68 ALA ALA A . n A 1 72 PHE 72 69 69 PHE PHE A . n A 1 73 GLU 73 70 70 GLU GLU A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 TYR 75 72 72 TYR TYR A . n A 1 76 HIS 76 73 73 HIS HIS A . n A 1 77 THR 77 74 74 THR THR A . n A 1 78 THR 78 75 75 THR THR A . n A 1 79 ASP 79 76 76 ASP ASP A . n A 1 80 PRO 80 77 77 PRO PRO A . n A 1 81 SER 81 78 78 SER SER A . n A 1 82 PHE 82 79 79 PHE PHE A . n A 1 83 LEU 83 80 80 LEU LEU A . n A 1 84 GLY 84 81 81 GLY GLY A . n A 1 85 ARG 85 82 82 ARG ARG A . n A 1 86 TYR 86 83 83 TYR TYR A . n A 1 87 MET 87 84 84 MET MET A . n A 1 88 SER 88 85 85 SER SER A . n A 1 89 ALA 89 86 86 ALA ALA A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 ASN 91 88 88 ASN ASN A . n A 1 92 HIS 92 89 89 HIS HIS A . n A 1 93 THR 93 90 90 THR THR A . n A 1 94 LYS 94 91 91 LYS LYS A . n A 1 95 LYS 95 92 92 LYS LYS A . n A 1 96 TRP 96 93 93 TRP TRP A . n A 1 97 LYS 97 94 94 LYS LYS A . n A 1 98 TYR 98 95 95 TYR TYR A . n A 1 99 PRO 99 96 96 PRO PRO A . n A 1 100 GLN 100 97 97 GLN GLN A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 ASN 102 99 99 ASN ASN A . n A 1 103 GLY 103 100 100 GLY GLY A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 THR 105 102 102 THR THR A . n A 1 106 SER 106 103 103 SER SER A . n A 1 107 ILE 107 104 104 ILE ILE A . n A 1 108 LYS 108 105 105 LYS LYS A . n A 1 109 TRP 109 106 106 TRP TRP A . n A 1 110 ALA 110 107 107 ALA ALA A . n A 1 111 ASP 111 108 108 ASP ASP A . n A 1 112 ASN 112 109 109 ASN ASN A . n A 1 113 ASN 113 110 110 ASN ASN A . n A 1 114 CYS 114 111 111 CYS CYS A . n A 1 115 TYR 115 112 112 TYR TYR A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 ALA 117 114 114 ALA ALA A . n A 1 118 THR 118 115 115 THR THR A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 LEU 121 118 118 LEU LEU A . n A 1 122 THR 122 119 119 THR THR A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 GLN 124 121 121 GLN GLN A . n A 1 125 GLN 125 122 122 GLN GLN A . n A 1 126 ILE 126 123 123 ILE ILE A . n A 1 127 GLU 127 124 124 GLU GLU A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 LYS 129 126 126 LYS LYS A . n A 1 130 PHE 130 127 127 PHE PHE A . n A 1 131 ASN 131 128 128 ASN ASN A . n A 1 132 PRO 132 129 129 PRO PRO A . n A 1 133 PRO 133 130 130 PRO PRO A . n A 1 134 ALA 134 131 131 ALA ALA A . n A 1 135 LEU 135 132 132 LEU LEU A . n A 1 136 GLN 136 133 133 GLN GLN A . n A 1 137 ASP 137 134 134 ASP ASP A . n A 1 138 ALA 138 135 135 ALA ALA A . n A 1 139 TYR 139 136 136 TYR TYR A . n A 1 140 TYR 140 137 137 TYR TYR A . n A 1 141 ARG 141 138 138 ARG ARG A . n A 1 142 ALA 142 139 139 ALA ALA A . n A 1 143 ARG 143 140 140 ARG ARG A . n A 1 144 ALA 144 141 141 ALA ALA A . n A 1 145 GLY 145 142 142 GLY GLY A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 ALA 147 144 144 ALA ALA A . n A 1 148 ALA 148 145 145 ALA ALA A . n A 1 149 ASN 149 146 146 ASN ASN A . n A 1 150 PHE 150 147 147 PHE PHE A . n A 1 151 CYS 151 148 148 CYS CYS A . n A 1 152 ALA 152 149 149 ALA ALA A . n A 1 153 LEU 153 150 150 LEU LEU A . n A 1 154 ILE 154 151 151 ILE ILE A . n A 1 155 LEU 155 152 152 LEU LEU A . n A 1 156 ALA 156 153 153 ALA ALA A . n A 1 157 TYR 157 154 154 TYR TYR A . n A 1 158 CYS 158 155 155 CYS CYS A . n A 1 159 ASN 159 156 156 ASN ASN A . n A 1 160 LYS 160 157 157 LYS LYS A . n A 1 161 THR 161 158 158 THR THR A . n A 1 162 VAL 162 159 159 VAL VAL A . n A 1 163 GLY 163 160 160 GLY GLY A . n A 1 164 GLU 164 161 161 GLU GLU A . n A 1 165 LEU 165 162 162 LEU LEU A . n A 1 166 GLY 166 163 163 GLY GLY A . n A 1 167 ASP 167 164 164 ASP ASP A . n A 1 168 VAL 168 165 165 VAL VAL A . n A 1 169 ARG 169 166 166 ARG ARG A . n A 1 170 GLU 170 167 167 GLU GLU A . n A 1 171 THR 171 168 168 THR THR A . n A 1 172 MET 172 169 169 MET MET A . n A 1 173 SER 173 170 170 SER SER A . n A 1 174 TYR 174 171 171 TYR TYR A . n A 1 175 LEU 175 172 172 LEU LEU A . n A 1 176 PHE 176 173 173 PHE PHE A . n A 1 177 GLN 177 174 174 GLN GLN A . n A 1 178 HIS 178 175 175 HIS HIS A . n A 1 179 ALA 179 176 176 ALA ALA A . n A 1 180 ASN 180 177 177 ASN ASN A . n A 1 181 LEU 181 178 178 LEU LEU A . n A 1 182 ASP 182 179 179 ASP ASP A . n A 1 183 SER 183 180 180 SER SER A . n A 1 184 CYS 184 181 181 CYS CYS A . n A 1 185 LYS 185 182 182 LYS LYS A . n A 1 186 ARG 186 183 183 ARG ARG A . n A 1 187 VAL 187 184 184 VAL VAL A . n A 1 188 LEU 188 185 185 LEU LEU A . n A 1 189 ASN 189 186 186 ASN ASN A . n A 1 190 VAL 190 187 187 VAL VAL A . n A 1 191 VAL 191 188 188 VAL VAL A . n A 1 192 CYS 192 189 189 CYS CYS A . n A 1 193 LYS 193 190 190 LYS LYS A . n A 1 194 THR 194 191 191 THR THR A . n A 1 195 CYS 195 192 192 CYS CYS A . n A 1 196 GLY 196 193 193 GLY GLY A . n A 1 197 GLN 197 194 194 GLN GLN A . n A 1 198 GLN 198 195 195 GLN GLN A . n A 1 199 GLN 199 196 196 GLN GLN A . n A 1 200 THR 200 197 197 THR THR A . n A 1 201 THR 201 198 198 THR THR A . n A 1 202 LEU 202 199 199 LEU LEU A . n A 1 203 LYS 203 200 200 LYS LYS A . n A 1 204 GLY 204 201 201 GLY GLY A . n A 1 205 VAL 205 202 202 VAL VAL A . n A 1 206 GLU 206 203 203 GLU GLU A . n A 1 207 ALA 207 204 204 ALA ALA A . n A 1 208 VAL 208 205 205 VAL VAL A . n A 1 209 MET 209 206 206 MET MET A . n A 1 210 TYR 210 207 207 TYR TYR A . n A 1 211 MET 211 208 208 MET MET A . n A 1 212 GLY 212 209 209 GLY GLY A . n A 1 213 THR 213 210 210 THR THR A . n A 1 214 LEU 214 211 211 LEU LEU A . n A 1 215 SER 215 212 212 SER SER A . n A 1 216 TYR 216 213 213 TYR TYR A . n A 1 217 GLU 217 214 214 GLU GLU A . n A 1 218 GLN 218 215 215 GLN GLN A . n A 1 219 PHE 219 216 216 PHE PHE A . n A 1 220 LYS 220 217 217 LYS LYS A . n A 1 221 LYS 221 218 218 LYS LYS A . n A 1 222 GLY 222 219 219 GLY GLY A . n A 1 223 VAL 223 220 220 VAL VAL A . n A 1 224 GLN 224 221 221 GLN GLN A . n A 1 225 ILE 225 222 222 ILE ILE A . n A 1 226 PRO 226 223 223 PRO PRO A . n A 1 227 CYS 227 224 224 CYS CYS A . n A 1 228 THR 228 225 225 THR THR A . n A 1 229 CYS 229 226 226 CYS CYS A . n A 1 230 GLY 230 227 227 GLY GLY A . n A 1 231 LYS 231 228 228 LYS LYS A . n A 1 232 GLN 232 229 229 GLN GLN A . n A 1 233 ALA 233 230 230 ALA ALA A . n A 1 234 THR 234 231 231 THR THR A . n A 1 235 LYS 235 232 232 LYS LYS A . n A 1 236 TYR 236 233 233 TYR TYR A . n A 1 237 LEU 237 234 234 LEU LEU A . n A 1 238 VAL 238 235 235 VAL VAL A . n A 1 239 GLN 239 236 236 GLN GLN A . n A 1 240 GLN 240 237 237 GLN GLN A . n A 1 241 GLU 241 238 238 GLU GLU A . n A 1 242 SER 242 239 239 SER SER A . n A 1 243 PRO 243 240 240 PRO PRO A . n A 1 244 PHE 244 241 241 PHE PHE A . n A 1 245 VAL 245 242 242 VAL VAL A . n A 1 246 MET 246 243 243 MET MET A . n A 1 247 MET 247 244 244 MET MET A . n A 1 248 SER 248 245 245 SER SER A . n A 1 249 ALA 249 246 246 ALA ALA A . n A 1 250 PRO 250 247 247 PRO PRO A . n A 1 251 PRO 251 248 248 PRO PRO A . n A 1 252 ALA 252 249 249 ALA ALA A . n A 1 253 GLN 253 250 250 GLN GLN A . n A 1 254 TYR 254 251 251 TYR TYR A . n A 1 255 GLU 255 252 252 GLU GLU A . n A 1 256 LEU 256 253 253 LEU LEU A . n A 1 257 LYS 257 254 254 LYS LYS A . n A 1 258 HIS 258 255 255 HIS HIS A . n A 1 259 GLY 259 256 256 GLY GLY A . n A 1 260 THR 260 257 257 THR THR A . n A 1 261 PHE 261 258 258 PHE PHE A . n A 1 262 THR 262 259 259 THR THR A . n A 1 263 CYS 263 260 260 CYS CYS A . n A 1 264 ALA 264 261 261 ALA ALA A . n A 1 265 SER 265 262 262 SER SER A . n A 1 266 GLU 266 263 263 GLU GLU A . n A 1 267 TYR 267 264 264 TYR TYR A . n A 1 268 THR 268 265 265 THR THR A . n A 1 269 GLY 269 266 266 GLY GLY A . n A 1 270 ASN 270 267 267 ASN ASN A . n A 1 271 TYR 271 268 268 TYR TYR A . n A 1 272 GLN 272 269 269 GLN GLN A . n A 1 273 CYS 273 270 270 CYS CYS A . n A 1 274 GLY 274 271 271 GLY GLY A . n A 1 275 HIS 275 272 272 HIS HIS A . n A 1 276 TYR 276 273 273 TYR TYR A . n A 1 277 LYS 277 274 274 LYS LYS A . n A 1 278 HIS 278 275 275 HIS HIS A . n A 1 279 ILE 279 276 276 ILE ILE A . n A 1 280 THR 280 277 277 THR THR A . n A 1 281 SER 281 278 278 SER SER A . n A 1 282 LYS 282 279 279 LYS LYS A . n A 1 283 GLU 283 280 280 GLU GLU A . n A 1 284 THR 284 281 281 THR THR A . n A 1 285 LEU 285 282 282 LEU LEU A . n A 1 286 TYR 286 283 283 TYR TYR A . n A 1 287 CYS 287 284 284 CYS CYS A . n A 1 288 ILE 288 285 285 ILE ILE A . n A 1 289 ASP 289 286 286 ASP ASP A . n A 1 290 GLY 290 287 287 GLY GLY A . n A 1 291 ALA 291 288 288 ALA ALA A . n A 1 292 LEU 292 289 289 LEU LEU A . n A 1 293 LEU 293 290 290 LEU LEU A . n A 1 294 THR 294 291 291 THR THR A . n A 1 295 LYS 295 292 292 LYS LYS A . n A 1 296 SER 296 293 293 SER SER A . n A 1 297 SER 297 294 294 SER SER A . n A 1 298 GLU 298 295 295 GLU GLU A . n A 1 299 TYR 299 296 296 TYR TYR A . n A 1 300 LYS 300 297 297 LYS LYS A . n A 1 301 GLY 301 298 298 GLY GLY A . n A 1 302 PRO 302 299 299 PRO PRO A . n A 1 303 ILE 303 300 300 ILE ILE A . n A 1 304 THR 304 301 301 THR THR A . n A 1 305 ASP 305 302 302 ASP ASP A . n A 1 306 VAL 306 303 303 VAL VAL A . n A 1 307 PHE 307 304 304 PHE PHE A . n A 1 308 TYR 308 305 305 TYR TYR A . n A 1 309 LYS 309 306 306 LYS LYS A . n A 1 310 GLU 310 307 307 GLU GLU A . n A 1 311 ASN 311 308 308 ASN ASN A . n A 1 312 SER 312 309 309 SER SER A . n A 1 313 TYR 313 310 310 TYR TYR A . n A 1 314 THR 314 311 311 THR THR A . n A 1 315 THR 315 312 312 THR THR A . n A 1 316 THR 316 313 313 THR THR A . n A 1 317 ILE 317 314 314 ILE ILE A . n A 1 318 LYS 318 315 315 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 VBY 1 501 501 VBY X30 A . C 3 ZN 1 502 502 ZN ZN A . D 3 ZN 1 503 504 ZN ZN A . E 3 ZN 1 504 505 ZN ZN A . F 3 ZN 1 505 506 ZN ZN A . G 4 CL 1 506 508 CL CL A . H 4 CL 1 507 509 CL CL A . I 4 CL 1 508 511 CL CL A . J 4 CL 1 509 512 CL CL A . K 5 MES 1 510 520 MES MES A . L 6 HOH 1 601 10 HOH HOH A . L 6 HOH 2 602 6 HOH HOH A . L 6 HOH 3 603 31 HOH HOH A . L 6 HOH 4 604 25 HOH HOH A . L 6 HOH 5 605 13 HOH HOH A . L 6 HOH 6 606 22 HOH HOH A . L 6 HOH 7 607 24 HOH HOH A . L 6 HOH 8 608 5 HOH HOH A . L 6 HOH 9 609 2 HOH HOH A . L 6 HOH 10 610 23 HOH HOH A . L 6 HOH 11 611 32 HOH HOH A . L 6 HOH 12 612 7 HOH HOH A . L 6 HOH 13 613 12 HOH HOH A . L 6 HOH 14 614 3 HOH HOH A . L 6 HOH 15 615 1 HOH HOH A . L 6 HOH 16 616 17 HOH HOH A . L 6 HOH 17 617 4 HOH HOH A . L 6 HOH 18 618 21 HOH HOH A . L 6 HOH 19 619 9 HOH HOH A . L 6 HOH 20 620 18 HOH HOH A . L 6 HOH 21 621 28 HOH HOH A . L 6 HOH 22 622 16 HOH HOH A . L 6 HOH 23 623 20 HOH HOH A . L 6 HOH 24 624 29 HOH HOH A . L 6 HOH 25 625 15 HOH HOH A . L 6 HOH 26 626 11 HOH HOH A . L 6 HOH 27 627 14 HOH HOH A . L 6 HOH 28 628 26 HOH HOH A . L 6 HOH 29 629 27 HOH HOH A . L 6 HOH 30 630 30 HOH HOH A . L 6 HOH 31 631 19 HOH HOH A . L 6 HOH 32 632 8 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 65 ? A ASP 62 ? 1_555 ZN ? E ZN . ? A ZN 504 ? 10_665 ND1 ? A HIS 76 ? A HIS 73 ? 1_555 111.1 ? 2 ND1 ? A HIS 92 ? A HIS 89 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 OD2 ? A ASP 111 ? A ASP 108 ? 1_555 113.3 ? 3 ND1 ? A HIS 92 ? A HIS 89 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 273 ? A CYS 270 ? 1_555 111.6 ? 4 OD2 ? A ASP 111 ? A ASP 108 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 273 ? A CYS 270 ? 1_555 37.4 ? 5 SG ? A CYS 114 ? A CYS 111 ? 1_555 ZN ? F ZN . ? A ZN 505 ? 1_555 ND1 ? A HIS 275 ? A HIS 272 ? 1_555 112.4 ? 6 SG ? A CYS 114 ? A CYS 111 ? 1_555 ZN ? F ZN . ? A ZN 505 ? 1_555 O ? L HOH . ? A HOH 621 ? 1_555 103.7 ? 7 ND1 ? A HIS 275 ? A HIS 272 ? 1_555 ZN ? F ZN . ? A ZN 505 ? 1_555 O ? L HOH . ? A HOH 621 ? 1_555 99.6 ? 8 SG ? A CYS 192 ? A CYS 189 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 195 ? A CYS 192 ? 1_555 142.0 ? 9 SG ? A CYS 192 ? A CYS 189 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 227 ? A CYS 224 ? 1_555 95.4 ? 10 SG ? A CYS 195 ? A CYS 192 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 227 ? A CYS 224 ? 1_555 105.8 ? 11 SG ? A CYS 192 ? A CYS 189 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 229 ? A CYS 226 ? 1_555 94.5 ? 12 SG ? A CYS 195 ? A CYS 192 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 229 ? A CYS 226 ? 1_555 113.5 ? 13 SG ? A CYS 227 ? A CYS 224 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 229 ? A CYS 226 ? 1_555 96.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-05 2 'Structure model' 1 1 2021-01-27 3 'Structure model' 1 2 2021-02-10 4 'Structure model' 1 3 2021-03-31 5 'Structure model' 1 4 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity 2 2 'Structure model' entity_name_com 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' entity 6 4 'Structure model' entity_name_com 7 4 'Structure model' struct 8 4 'Structure model' struct_keywords 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond 11 5 'Structure model' database_2 12 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity.pdbx_description' 2 2 'Structure model' '_entity.pdbx_ec' 3 3 'Structure model' '_citation.country' 4 3 'Structure model' '_citation.journal_abbrev' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.pdbx_database_id_DOI' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation.year' 14 4 'Structure model' '_entity.pdbx_description' 15 4 'Structure model' '_entity.pdbx_ec' 16 4 'Structure model' '_entity_name_com.name' 17 4 'Structure model' '_struct.title' 18 4 'Structure model' '_struct_keywords.pdbx_keywords' 19 4 'Structure model' '_struct_keywords.text' 20 5 'Structure model' '_database_2.pdbx_DOI' 21 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 50.052 _pdbx_refine_tls.origin_y 36.701 _pdbx_refine_tls.origin_z 14.440 _pdbx_refine_tls.T[1][1] 0.1786 _pdbx_refine_tls.T[2][2] 0.0986 _pdbx_refine_tls.T[3][3] 0.1351 _pdbx_refine_tls.T[1][2] -0.0098 _pdbx_refine_tls.T[1][3] -0.0495 _pdbx_refine_tls.T[2][3] 0.0768 _pdbx_refine_tls.L[1][1] 0.1821 _pdbx_refine_tls.L[2][2] 0.7360 _pdbx_refine_tls.L[3][3] 1.1556 _pdbx_refine_tls.L[1][2] -0.0725 _pdbx_refine_tls.L[1][3] -0.3353 _pdbx_refine_tls.L[2][3] -0.3861 _pdbx_refine_tls.S[1][1] -0.0057 _pdbx_refine_tls.S[2][2] -0.1176 _pdbx_refine_tls.S[3][3] 0.1233 _pdbx_refine_tls.S[1][2] 0.0158 _pdbx_refine_tls.S[1][3] -0.0287 _pdbx_refine_tls.S[2][3] 0.1057 _pdbx_refine_tls.S[2][1] -0.1050 _pdbx_refine_tls.S[3][1] 0.1028 _pdbx_refine_tls.S[3][2] 0.1654 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 7 A 315 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 501 A 510 ? ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 5 # _pdbx_entry_details.entry_id 7JIW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 263 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OH _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TYR _pdbx_validate_close_contact.auth_seq_id_2 296 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 136 ? ? CG A TYR 136 ? ? CD2 A TYR 136 ? ? 117.23 121.00 -3.77 0.60 N 2 1 CB A TYR 136 ? ? CG A TYR 136 ? ? CD1 A TYR 136 ? ? 124.88 121.00 3.88 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 47 ? ? -62.97 -171.98 2 1 SER A 103 ? ? -100.18 -168.79 3 1 THR A 191 ? ? -90.84 -64.96 4 1 THR A 191 ? ? -90.59 -65.17 5 1 HIS A 255 ? ? -36.05 128.53 6 1 TYR A 268 ? ? -33.99 125.80 7 1 GLN A 269 ? ? 76.96 -49.56 8 1 LYS A 279 ? ? -108.28 -129.10 9 1 ASN A 308 ? ? -136.61 -65.85 10 1 THR A 313 ? ? -105.12 61.72 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A GLU 1 ? A GLU 4 5 1 Y 1 A VAL 2 ? A VAL 5 6 1 Y 1 A ARG 3 ? A ARG 6 7 1 Y 1 A THR 4 ? A THR 7 8 1 Y 1 A ILE 5 ? A ILE 8 9 1 Y 1 A LYS 6 ? A LYS 9 10 1 Y 1 A VAL 21 ? A VAL 24 11 1 Y 1 A ASP 22 ? A ASP 25 12 1 Y 1 A MET 23 ? A MET 26 13 1 Y 1 A SER 24 ? A SER 27 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MES O1 O N N 231 MES C2 C N N 232 MES C3 C N N 233 MES N4 N N N 234 MES C5 C N N 235 MES C6 C N N 236 MES C7 C N N 237 MES C8 C N N 238 MES S S N N 239 MES O1S O N N 240 MES O2S O N N 241 MES O3S O N N 242 MES H21 H N N 243 MES H22 H N N 244 MES H31 H N N 245 MES H32 H N N 246 MES HN4 H N N 247 MES H51 H N N 248 MES H52 H N N 249 MES H61 H N N 250 MES H62 H N N 251 MES H71 H N N 252 MES H72 H N N 253 MES H81 H N N 254 MES H82 H N N 255 MET N N N N 256 MET CA C N S 257 MET C C N N 258 MET O O N N 259 MET CB C N N 260 MET CG C N N 261 MET SD S N N 262 MET CE C N N 263 MET OXT O N N 264 MET H H N N 265 MET H2 H N N 266 MET HA H N N 267 MET HB2 H N N 268 MET HB3 H N N 269 MET HG2 H N N 270 MET HG3 H N N 271 MET HE1 H N N 272 MET HE2 H N N 273 MET HE3 H N N 274 MET HXT H N N 275 PHE N N N N 276 PHE CA C N S 277 PHE C C N N 278 PHE O O N N 279 PHE CB C N N 280 PHE CG C Y N 281 PHE CD1 C Y N 282 PHE CD2 C Y N 283 PHE CE1 C Y N 284 PHE CE2 C Y N 285 PHE CZ C Y N 286 PHE OXT O N N 287 PHE H H N N 288 PHE H2 H N N 289 PHE HA H N N 290 PHE HB2 H N N 291 PHE HB3 H N N 292 PHE HD1 H N N 293 PHE HD2 H N N 294 PHE HE1 H N N 295 PHE HE2 H N N 296 PHE HZ H N N 297 PHE HXT H N N 298 PRO N N N N 299 PRO CA C N S 300 PRO C C N N 301 PRO O O N N 302 PRO CB C N N 303 PRO CG C N N 304 PRO CD C N N 305 PRO OXT O N N 306 PRO H H N N 307 PRO HA H N N 308 PRO HB2 H N N 309 PRO HB3 H N N 310 PRO HG2 H N N 311 PRO HG3 H N N 312 PRO HD2 H N N 313 PRO HD3 H N N 314 PRO HXT H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 TRP N N N N 347 TRP CA C N S 348 TRP C C N N 349 TRP O O N N 350 TRP CB C N N 351 TRP CG C Y N 352 TRP CD1 C Y N 353 TRP CD2 C Y N 354 TRP NE1 N Y N 355 TRP CE2 C Y N 356 TRP CE3 C Y N 357 TRP CZ2 C Y N 358 TRP CZ3 C Y N 359 TRP CH2 C Y N 360 TRP OXT O N N 361 TRP H H N N 362 TRP H2 H N N 363 TRP HA H N N 364 TRP HB2 H N N 365 TRP HB3 H N N 366 TRP HD1 H N N 367 TRP HE1 H N N 368 TRP HE3 H N N 369 TRP HZ2 H N N 370 TRP HZ3 H N N 371 TRP HH2 H N N 372 TRP HXT H N N 373 TYR N N N N 374 TYR CA C N S 375 TYR C C N N 376 TYR O O N N 377 TYR CB C N N 378 TYR CG C Y N 379 TYR CD1 C Y N 380 TYR CD2 C Y N 381 TYR CE1 C Y N 382 TYR CE2 C Y N 383 TYR CZ C Y N 384 TYR OH O N N 385 TYR OXT O N N 386 TYR H H N N 387 TYR H2 H N N 388 TYR HA H N N 389 TYR HB2 H N N 390 TYR HB3 H N N 391 TYR HD1 H N N 392 TYR HD2 H N N 393 TYR HE1 H N N 394 TYR HE2 H N N 395 TYR HH H N N 396 TYR HXT H N N 397 VAL N N N N 398 VAL CA C N S 399 VAL C C N N 400 VAL O O N N 401 VAL CB C N N 402 VAL CG1 C N N 403 VAL CG2 C N N 404 VAL OXT O N N 405 VAL H H N N 406 VAL H2 H N N 407 VAL HA H N N 408 VAL HB H N N 409 VAL HG11 H N N 410 VAL HG12 H N N 411 VAL HG13 H N N 412 VAL HG21 H N N 413 VAL HG22 H N N 414 VAL HG23 H N N 415 VAL HXT H N N 416 VBY C1 C N N 417 VBY C10 C Y N 418 VBY C11 C Y N 419 VBY C12 C Y N 420 VBY C13 C Y N 421 VBY C14 C Y N 422 VBY C16 C N N 423 VBY C17 C Y N 424 VBY C18 C Y N 425 VBY C19 C Y N 426 VBY C20 C Y N 427 VBY C21 C Y N 428 VBY C22 C Y N 429 VBY C24 C N N 430 VBY C25 C N N 431 VBY C27 C N N 432 VBY C3 C Y N 433 VBY C4 C Y N 434 VBY C5 C Y N 435 VBY C6 C N R 436 VBY C8 C Y N 437 VBY C9 C Y N 438 VBY N2 N N N 439 VBY O7 O N N 440 VBY N01 N N N 441 VBY O26 O N N 442 VBY C01 C N N 443 VBY H1 H N N 444 VBY H2 H N N 445 VBY H3 H N N 446 VBY H4 H N N 447 VBY H5 H N N 448 VBY H6 H N N 449 VBY H7 H N N 450 VBY H8 H N N 451 VBY H9 H N N 452 VBY H10 H N N 453 VBY H11 H N N 454 VBY H12 H N N 455 VBY H13 H N N 456 VBY H14 H N N 457 VBY H15 H N N 458 VBY H16 H N N 459 VBY H17 H N N 460 VBY H18 H N N 461 VBY H19 H N N 462 VBY H20 H N N 463 VBY H21 H N N 464 VBY H22 H N N 465 ZN ZN ZN N N 466 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MES O1 C2 sing N N 218 MES O1 C6 sing N N 219 MES C2 C3 sing N N 220 MES C2 H21 sing N N 221 MES C2 H22 sing N N 222 MES C3 N4 sing N N 223 MES C3 H31 sing N N 224 MES C3 H32 sing N N 225 MES N4 C5 sing N N 226 MES N4 C7 sing N N 227 MES N4 HN4 sing N N 228 MES C5 C6 sing N N 229 MES C5 H51 sing N N 230 MES C5 H52 sing N N 231 MES C6 H61 sing N N 232 MES C6 H62 sing N N 233 MES C7 C8 sing N N 234 MES C7 H71 sing N N 235 MES C7 H72 sing N N 236 MES C8 S sing N N 237 MES C8 H81 sing N N 238 MES C8 H82 sing N N 239 MES S O1S doub N N 240 MES S O2S doub N N 241 MES S O3S sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 TRP N CA sing N N 331 TRP N H sing N N 332 TRP N H2 sing N N 333 TRP CA C sing N N 334 TRP CA CB sing N N 335 TRP CA HA sing N N 336 TRP C O doub N N 337 TRP C OXT sing N N 338 TRP CB CG sing N N 339 TRP CB HB2 sing N N 340 TRP CB HB3 sing N N 341 TRP CG CD1 doub Y N 342 TRP CG CD2 sing Y N 343 TRP CD1 NE1 sing Y N 344 TRP CD1 HD1 sing N N 345 TRP CD2 CE2 doub Y N 346 TRP CD2 CE3 sing Y N 347 TRP NE1 CE2 sing Y N 348 TRP NE1 HE1 sing N N 349 TRP CE2 CZ2 sing Y N 350 TRP CE3 CZ3 doub Y N 351 TRP CE3 HE3 sing N N 352 TRP CZ2 CH2 doub Y N 353 TRP CZ2 HZ2 sing N N 354 TRP CZ3 CH2 sing Y N 355 TRP CZ3 HZ3 sing N N 356 TRP CH2 HH2 sing N N 357 TRP OXT HXT sing N N 358 TYR N CA sing N N 359 TYR N H sing N N 360 TYR N H2 sing N N 361 TYR CA C sing N N 362 TYR CA CB sing N N 363 TYR CA HA sing N N 364 TYR C O doub N N 365 TYR C OXT sing N N 366 TYR CB CG sing N N 367 TYR CB HB2 sing N N 368 TYR CB HB3 sing N N 369 TYR CG CD1 doub Y N 370 TYR CG CD2 sing Y N 371 TYR CD1 CE1 sing Y N 372 TYR CD1 HD1 sing N N 373 TYR CD2 CE2 doub Y N 374 TYR CD2 HD2 sing N N 375 TYR CE1 CZ doub Y N 376 TYR CE1 HE1 sing N N 377 TYR CE2 CZ sing Y N 378 TYR CE2 HE2 sing N N 379 TYR CZ OH sing N N 380 TYR OH HH sing N N 381 TYR OXT HXT sing N N 382 VAL N CA sing N N 383 VAL N H sing N N 384 VAL N H2 sing N N 385 VAL CA C sing N N 386 VAL CA CB sing N N 387 VAL CA HA sing N N 388 VAL C O doub N N 389 VAL C OXT sing N N 390 VAL CB CG1 sing N N 391 VAL CB CG2 sing N N 392 VAL CB HB sing N N 393 VAL CG1 HG11 sing N N 394 VAL CG1 HG12 sing N N 395 VAL CG1 HG13 sing N N 396 VAL CG2 HG21 sing N N 397 VAL CG2 HG22 sing N N 398 VAL CG2 HG23 sing N N 399 VAL OXT HXT sing N N 400 VBY C22 C18 doub Y N 401 VBY C22 C20 sing Y N 402 VBY C18 C11 sing Y N 403 VBY C20 C14 doub Y N 404 VBY C11 C12 doub Y N 405 VBY C11 C8 sing Y N 406 VBY C14 C8 sing Y N 407 VBY C25 C27 doub N N 408 VBY C25 C24 sing N N 409 VBY O26 C24 doub N N 410 VBY C12 C9 sing Y N 411 VBY C8 C5 doub Y N 412 VBY C24 N01 sing N N 413 VBY O7 C1 doub N N 414 VBY N01 C19 sing N N 415 VBY C9 C4 doub Y N 416 VBY C13 C19 doub Y N 417 VBY C13 C3 sing Y N 418 VBY C19 C21 sing Y N 419 VBY C5 C4 sing Y N 420 VBY C5 C6 sing N N 421 VBY C1 C3 sing N N 422 VBY C1 N2 sing N N 423 VBY C3 C10 doub Y N 424 VBY C21 C17 doub Y N 425 VBY C10 C17 sing Y N 426 VBY C10 C16 sing N N 427 VBY C6 N2 sing N N 428 VBY C6 C01 sing N N 429 VBY C12 H1 sing N N 430 VBY C13 H2 sing N N 431 VBY C14 H3 sing N N 432 VBY C16 H4 sing N N 433 VBY C16 H5 sing N N 434 VBY C16 H6 sing N N 435 VBY C17 H7 sing N N 436 VBY C18 H8 sing N N 437 VBY C20 H9 sing N N 438 VBY C21 H10 sing N N 439 VBY C22 H11 sing N N 440 VBY C25 H12 sing N N 441 VBY C27 H13 sing N N 442 VBY C27 H14 sing N N 443 VBY C4 H15 sing N N 444 VBY C6 H16 sing N N 445 VBY C9 H17 sing N N 446 VBY N2 H18 sing N N 447 VBY N01 H19 sing N N 448 VBY C01 H20 sing N N 449 VBY C01 H21 sing N N 450 VBY C01 H22 sing N N 451 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272201200026C 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272201700060C 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id VBY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id VBY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]benzamide' VBY 3 'ZINC ION' ZN 4 'CHLORIDE ION' CL 5 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6WZU _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #