data_7JNE # _entry.id 7JNE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7JNE pdb_00007jne 10.2210/pdb7jne/pdb WWPDB D_1000251125 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '7JM8 contains the same protein but in complex with another peptide' 7JM8 unspecified PDB '7JMM contains the same protein but in complex with another peptide' 7JMM unspecified PDB '7JML contains the same protein but in complex with another peptide' 7JML unspecified PDB '7JMZ contains the same protein but in complex with another peptide' 7JMZ unspecified PDB '7JN8 contains the same protein but in complex with another peptide' 7JN8 unspecified PDB '7JN9 contains the same protein but in complex with another peptide' 7JN9 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JNE _pdbx_database_status.recvd_initial_deposition_date 2020-08-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jansen, R.M.' 1 0000-0003-4666-9976 'Ozden, C.' 2 0000-0002-5673-878X 'Gierasch, L.M.' 3 0000-0002-5706-115X 'Garman, S.C.' 4 0000-0001-9912-2670 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 118 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Selective promiscuity in the binding of E. coli Hsp70 to an unfolded protein.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2016962118 _citation.pdbx_database_id_PubMed 34625496 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clerico, E.M.' 1 0000-0002-4433-8842 primary 'Pozhidaeva, A.K.' 2 0000-0001-8602-1790 primary 'Jansen, R.M.' 3 0000-0003-4666-9976 primary 'Ozden, C.' 4 0000-0002-5673-878X primary 'Tilitsky, J.M.' 5 0000-0001-8555-398X primary 'Gierasch, L.M.' 6 0000-0002-5706-115X # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7JNE _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.261 _cell.length_a_esd ? _cell.length_b 95.872 _cell.length_b_esd ? _cell.length_c 117.008 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JNE _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chaperone protein DnaK' 23820.777 1 ? ? ? ? 2 polymer syn 'Alkaline phosphatase peptide' 1146.326 1 3.1.3.1 'T435R, A443S, Y444R' ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 6 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'HSP70,Heat shock 70 kDa protein,Heat shock protein 70' 2 APase # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRG MPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRK QVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA ; ;VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRG MPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRK QVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA ; A ? 2 'polypeptide(L)' no no RGSQLRIASR RGSQLRIASR B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 LEU n 1 4 LEU n 1 5 ASP n 1 6 VAL n 1 7 THR n 1 8 PRO n 1 9 LEU n 1 10 SER n 1 11 LEU n 1 12 GLY n 1 13 ILE n 1 14 GLU n 1 15 THR n 1 16 MET n 1 17 GLY n 1 18 GLY n 1 19 VAL n 1 20 MET n 1 21 THR n 1 22 THR n 1 23 LEU n 1 24 ILE n 1 25 ALA n 1 26 LYS n 1 27 ASN n 1 28 THR n 1 29 THR n 1 30 ILE n 1 31 PRO n 1 32 THR n 1 33 LYS n 1 34 HIS n 1 35 SER n 1 36 GLN n 1 37 VAL n 1 38 PHE n 1 39 SER n 1 40 THR n 1 41 ALA n 1 42 GLU n 1 43 ASP n 1 44 ASN n 1 45 GLN n 1 46 SER n 1 47 ALA n 1 48 VAL n 1 49 THR n 1 50 ILE n 1 51 HIS n 1 52 VAL n 1 53 LEU n 1 54 GLN n 1 55 GLY n 1 56 GLU n 1 57 ARG n 1 58 LYS n 1 59 ARG n 1 60 ALA n 1 61 ALA n 1 62 ASP n 1 63 ASN n 1 64 LYS n 1 65 SER n 1 66 LEU n 1 67 GLY n 1 68 GLN n 1 69 PHE n 1 70 ASN n 1 71 LEU n 1 72 ASP n 1 73 GLY n 1 74 ILE n 1 75 ASN n 1 76 PRO n 1 77 ALA n 1 78 PRO n 1 79 ARG n 1 80 GLY n 1 81 MET n 1 82 PRO n 1 83 GLN n 1 84 ILE n 1 85 GLU n 1 86 VAL n 1 87 THR n 1 88 PHE n 1 89 ASP n 1 90 ILE n 1 91 ASP n 1 92 ALA n 1 93 ASP n 1 94 GLY n 1 95 ILE n 1 96 LEU n 1 97 HIS n 1 98 VAL n 1 99 SER n 1 100 ALA n 1 101 LYS n 1 102 ASP n 1 103 LYS n 1 104 ASN n 1 105 SER n 1 106 GLY n 1 107 LYS n 1 108 GLU n 1 109 GLN n 1 110 LYS n 1 111 ILE n 1 112 THR n 1 113 ILE n 1 114 LYS n 1 115 ALA n 1 116 SER n 1 117 SER n 1 118 GLY n 1 119 LEU n 1 120 ASN n 1 121 GLU n 1 122 ASP n 1 123 GLU n 1 124 ILE n 1 125 GLN n 1 126 LYS n 1 127 MET n 1 128 VAL n 1 129 ARG n 1 130 ASP n 1 131 ALA n 1 132 GLU n 1 133 ALA n 1 134 ASN n 1 135 ALA n 1 136 GLU n 1 137 ALA n 1 138 ASP n 1 139 ARG n 1 140 LYS n 1 141 PHE n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 VAL n 1 146 GLN n 1 147 THR n 1 148 ARG n 1 149 ASN n 1 150 GLN n 1 151 GLY n 1 152 ASP n 1 153 HIS n 1 154 LEU n 1 155 LEU n 1 156 HIS n 1 157 SER n 1 158 THR n 1 159 ARG n 1 160 LYS n 1 161 GLN n 1 162 VAL n 1 163 GLU n 1 164 GLU n 1 165 ALA n 1 166 GLY n 1 167 ASP n 1 168 LYS n 1 169 LEU n 1 170 PRO n 1 171 ALA n 1 172 ASP n 1 173 ASP n 1 174 LYS n 1 175 THR n 1 176 ALA n 1 177 ILE n 1 178 GLU n 1 179 SER n 1 180 ALA n 1 181 LEU n 1 182 THR n 1 183 ALA n 1 184 LEU n 1 185 GLU n 1 186 THR n 1 187 ALA n 1 188 LEU n 1 189 LYS n 1 190 GLY n 1 191 GLU n 1 192 ASP n 1 193 LYS n 1 194 ALA n 1 195 ALA n 1 196 ILE n 1 197 GLU n 1 198 ALA n 1 199 LYS n 1 200 MET n 1 201 GLN n 1 202 GLU n 1 203 LEU n 1 204 ALA n 1 205 GLN n 1 206 VAL n 1 207 SER n 1 208 GLN n 1 209 LYS n 1 210 LEU n 1 211 MET n 1 212 GLU n 1 213 ILE n 1 214 ALA n 1 215 GLN n 1 216 GLN n 1 217 GLN n 1 218 HIS n 1 219 ALA n 2 1 ARG n 2 2 GLY n 2 3 SER n 2 4 GLN n 2 5 LEU n 2 6 ARG n 2 7 ILE n 2 8 ALA n 2 9 SER n 2 10 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 219 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dnaK, groP, grpF, seg, b0014, JW0013' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Escherichia coli (strain K12)' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 83333 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP DNAK_ECOLI P0A6Y8 ? 1 ;VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRG MPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRK QVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA ; 389 2 UNP PPB_ECOLI P00634 ? 2 TGSQLRIAAY 435 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7JNE A 1 ? 219 ? P0A6Y8 389 ? 607 ? 389 607 2 2 7JNE B 1 ? 10 ? P00634 435 ? 444 ? 414 423 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 7JNE ARG B 1 ? UNP P00634 THR 435 'engineered mutation' 414 1 2 7JNE SER B 9 ? UNP P00634 ALA 443 'engineered mutation' 422 2 2 7JNE ARG B 10 ? UNP P00634 TYR 444 'engineered mutation' 423 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JNE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M (NH4)2SO4, 0.1 M K3PO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details '100 K throughout the collection' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Rigaku VariMax HF' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 R 200K-A' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-01-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7JNE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5400 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7047 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.000 _reflns.pdbx_Rmerge_I_obs 0.246 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 3.601 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.269 _reflns.pdbx_Rpim_I_all 0.108 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.560 2.600 ? ? ? ? ? ? 349 96.900 ? ? ? ? 2.042 ? ? ? ? ? ? ? ? 5.000 ? 1.285 ? ? 2.272 0.975 ? 1 1 0.412 ? ? 2.600 2.650 ? ? ? ? ? ? 325 99.700 ? ? ? ? 1.837 ? ? ? ? ? ? ? ? 5.500 ? 1.600 ? ? 2.028 0.845 ? 2 1 0.381 ? ? 2.650 2.700 ? ? ? ? ? ? 350 99.400 ? ? ? ? 1.779 ? ? ? ? ? ? ? ? 5.700 ? 1.951 ? ? 1.959 0.807 ? 3 1 0.443 ? ? 2.700 2.760 ? ? ? ? ? ? 347 99.700 ? ? ? ? 1.505 ? ? ? ? ? ? ? ? 5.700 ? 1.501 ? ? 1.656 0.680 ? 4 1 0.603 ? ? 2.760 2.820 ? ? ? ? ? ? 343 100.000 ? ? ? ? 1.275 ? ? ? ? ? ? ? ? 5.900 ? 1.736 ? ? 1.399 0.569 ? 5 1 0.814 ? ? 2.820 2.880 ? ? ? ? ? ? 333 100.000 ? ? ? ? 1.096 ? ? ? ? ? ? ? ? 5.900 ? 1.899 ? ? 1.202 0.486 ? 6 1 0.561 ? ? 2.880 2.960 ? ? ? ? ? ? 352 100.000 ? ? ? ? 0.946 ? ? ? ? ? ? ? ? 5.900 ? 2.294 ? ? 1.037 0.419 ? 7 1 0.598 ? ? 2.960 3.040 ? ? ? ? ? ? 361 100.000 ? ? ? ? 0.653 ? ? ? ? ? ? ? ? 6.100 ? 2.872 ? ? 0.713 0.282 ? 8 1 0.708 ? ? 3.040 3.120 ? ? ? ? ? ? 342 100.000 ? ? ? ? 0.530 ? ? ? ? ? ? ? ? 6.300 ? 2.731 ? ? 0.578 0.226 ? 9 1 0.834 ? ? 3.120 3.230 ? ? ? ? ? ? 342 100.000 ? ? ? ? 0.386 ? ? ? ? ? ? ? ? 6.300 ? 3.582 ? ? 0.421 0.164 ? 10 1 0.900 ? ? 3.230 3.340 ? ? ? ? ? ? 351 100.000 ? ? ? ? 0.320 ? ? ? ? ? ? ? ? 6.500 ? 2.767 ? ? 0.348 0.135 ? 11 1 0.939 ? ? 3.340 3.470 ? ? ? ? ? ? 347 100.000 ? ? ? ? 0.264 ? ? ? ? ? ? ? ? 6.400 ? 3.304 ? ? 0.287 0.111 ? 12 1 0.943 ? ? 3.470 3.630 ? ? ? ? ? ? 358 100.000 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 6.500 ? 3.000 ? ? 0.259 0.100 ? 13 1 0.978 ? ? 3.630 3.820 ? ? ? ? ? ? 340 100.000 ? ? ? ? 0.235 ? ? ? ? ? ? ? ? 6.400 ? 3.847 ? ? 0.255 0.099 ? 14 1 0.968 ? ? 3.820 4.060 ? ? ? ? ? ? 358 100.000 ? ? ? ? 0.186 ? ? ? ? ? ? ? ? 6.400 ? 3.748 ? ? 0.203 0.079 ? 15 1 0.977 ? ? 4.060 4.380 ? ? ? ? ? ? 355 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 6.300 ? 3.589 ? ? 0.158 0.061 ? 16 1 0.980 ? ? 4.380 4.820 ? ? ? ? ? ? 353 100.000 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 6.300 ? 4.856 ? ? 0.137 0.054 ? 17 1 0.989 ? ? 4.820 5.510 ? ? ? ? ? ? 368 100.000 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 6.200 ? 6.594 ? ? 0.165 0.065 ? 18 1 0.974 ? ? 5.510 6.940 ? ? ? ? ? ? 372 100.000 ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 5.900 ? 8.157 ? ? 0.181 0.073 ? 19 1 0.975 ? ? 6.940 50.000 ? ? ? ? ? ? 401 99.500 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 5.100 ? 9.500 ? ? 0.109 0.047 ? 20 1 0.991 ? ? # _refine.aniso_B[1][1] 1.5200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.5400 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -3.0600 _refine.B_iso_max 91.710 _refine.B_iso_mean 41.9890 _refine.B_iso_min 26.400 _refine.correlation_coeff_Fo_to_Fc 0.9390 _refine.correlation_coeff_Fo_to_Fc_free 0.8310 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JNE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5400 _refine.ls_d_res_low 37.1100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6691 _refine.ls_number_reflns_R_free 353 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.7100 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2211 _refine.ls_R_factor_R_free 0.3343 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2155 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1DKZ _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.8780 _refine.pdbx_overall_ESU_R_Free 0.4320 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 17.2050 _refine.overall_SU_ML 0.3580 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5400 _refine_hist.d_res_low 37.1100 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1636 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 219 _refine_hist.pdbx_B_iso_mean_ligand 70.43 _refine_hist.pdbx_B_iso_mean_solvent 37.73 _refine_hist.pdbx_number_atoms_protein 1625 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 1642 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1535 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.566 1.638 2218 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.226 1.577 3570 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.243 5.000 217 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.965 25.195 77 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.367 15.000 298 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.737 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.055 0.200 236 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1841 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 276 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5400 _refine_ls_shell.d_res_low 2.6040 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 9 _refine_ls_shell.number_reflns_R_work 298 _refine_ls_shell.percent_reflns_obs 58.1400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2880 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2880 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7JNE _struct.title 'Crystal structure of the substrate-binding domain of E. coli DnaK in complex with the peptide RGSQLRIASR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JNE _struct_keywords.text 'Complex, Molecular chaperone, Protein/Peptide, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 59 ? ASN A 63 ? ARG A 447 ASN A 451 5 ? 5 HELX_P HELX_P2 AA2 ASN A 120 ? ASN A 134 ? ASN A 508 ASN A 522 1 ? 15 HELX_P HELX_P3 AA3 ASN A 134 ? GLY A 166 ? ASN A 522 GLY A 554 1 ? 33 HELX_P HELX_P4 AA4 ASP A 167 ? LEU A 169 ? ASP A 555 LEU A 557 5 ? 3 HELX_P HELX_P5 AA5 PRO A 170 ? LYS A 189 ? PRO A 558 LYS A 577 1 ? 20 HELX_P HELX_P6 AA6 ASP A 192 ? SER A 207 ? ASP A 580 SER A 595 1 ? 16 HELX_P HELX_P7 AA7 SER A 207 ? GLN A 215 ? SER A 595 GLN A 603 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 30 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 418 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 31 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 419 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.11 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 19 ? ILE A 24 ? VAL A 407 ILE A 412 AA1 2 LEU A 11 ? THR A 15 ? LEU A 399 THR A 403 AA1 3 VAL A 48 ? GLN A 54 ? VAL A 436 GLN A 442 AA1 4 LYS A 64 ? LEU A 71 ? LYS A 452 LEU A 459 AA2 1 GLU A 108 ? ILE A 113 ? GLU A 496 ILE A 501 AA2 2 LEU A 96 ? ASP A 102 ? LEU A 484 ASP A 490 AA2 3 ILE A 84 ? ILE A 90 ? ILE A 472 ILE A 478 AA2 4 THR A 32 ? THR A 40 ? THR A 420 THR A 428 AA2 5 ARG B 6 ? ILE B 7 ? ARG B 419 ILE B 420 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 21 ? O THR A 409 N ILE A 13 ? N ILE A 401 AA1 2 3 N GLY A 12 ? N GLY A 400 O LEU A 53 ? O LEU A 441 AA1 3 4 N GLN A 54 ? N GLN A 442 O LYS A 64 ? O LYS A 452 AA2 1 2 O ILE A 113 ? O ILE A 501 N LEU A 96 ? N LEU A 484 AA2 2 3 O HIS A 97 ? O HIS A 485 N ASP A 89 ? N ASP A 477 AA2 3 4 O VAL A 86 ? O VAL A 474 N GLN A 36 ? N GLN A 424 AA2 4 5 N SER A 39 ? N SER A 427 O ILE B 7 ? O ILE B 420 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 701 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue SO4 A 701' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ARG A 79 ? ARG A 467 . ? 1_555 ? 2 AC1 5 HIS A 153 ? HIS A 541 . ? 1_555 ? 3 AC1 5 HIS A 156 ? HIS A 544 . ? 1_555 ? 4 AC1 5 SER A 157 ? SER A 545 . ? 1_555 ? 5 AC1 5 ARG B 6 ? ARG B 419 . ? 1_555 ? # _atom_sites.entry_id 7JNE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026838 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010431 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008546 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 389 389 VAL VAL A . n A 1 2 LEU 2 390 390 LEU LEU A . n A 1 3 LEU 3 391 391 LEU LEU A . n A 1 4 LEU 4 392 392 LEU LEU A . n A 1 5 ASP 5 393 393 ASP ASP A . n A 1 6 VAL 6 394 394 VAL VAL A . n A 1 7 THR 7 395 395 THR THR A . n A 1 8 PRO 8 396 396 PRO PRO A . n A 1 9 LEU 9 397 397 LEU LEU A . n A 1 10 SER 10 398 398 SER SER A . n A 1 11 LEU 11 399 399 LEU LEU A . n A 1 12 GLY 12 400 400 GLY GLY A . n A 1 13 ILE 13 401 401 ILE ILE A . n A 1 14 GLU 14 402 402 GLU GLU A . n A 1 15 THR 15 403 403 THR THR A . n A 1 16 MET 16 404 404 MET MET A . n A 1 17 GLY 17 405 405 GLY GLY A . n A 1 18 GLY 18 406 406 GLY GLY A . n A 1 19 VAL 19 407 407 VAL VAL A . n A 1 20 MET 20 408 408 MET MET A . n A 1 21 THR 21 409 409 THR THR A . n A 1 22 THR 22 410 410 THR THR A . n A 1 23 LEU 23 411 411 LEU LEU A . n A 1 24 ILE 24 412 412 ILE ILE A . n A 1 25 ALA 25 413 413 ALA ALA A . n A 1 26 LYS 26 414 414 LYS LYS A . n A 1 27 ASN 27 415 415 ASN ASN A . n A 1 28 THR 28 416 416 THR THR A . n A 1 29 THR 29 417 417 THR THR A . n A 1 30 ILE 30 418 418 ILE ILE A . n A 1 31 PRO 31 419 419 PRO PRO A . n A 1 32 THR 32 420 420 THR THR A . n A 1 33 LYS 33 421 421 LYS LYS A . n A 1 34 HIS 34 422 422 HIS HIS A . n A 1 35 SER 35 423 423 SER SER A . n A 1 36 GLN 36 424 424 GLN GLN A . n A 1 37 VAL 37 425 425 VAL VAL A . n A 1 38 PHE 38 426 426 PHE PHE A . n A 1 39 SER 39 427 427 SER SER A . n A 1 40 THR 40 428 428 THR THR A . n A 1 41 ALA 41 429 429 ALA ALA A . n A 1 42 GLU 42 430 430 GLU GLU A . n A 1 43 ASP 43 431 431 ASP ASP A . n A 1 44 ASN 44 432 432 ASN ASN A . n A 1 45 GLN 45 433 433 GLN GLN A . n A 1 46 SER 46 434 434 SER SER A . n A 1 47 ALA 47 435 435 ALA ALA A . n A 1 48 VAL 48 436 436 VAL VAL A . n A 1 49 THR 49 437 437 THR THR A . n A 1 50 ILE 50 438 438 ILE ILE A . n A 1 51 HIS 51 439 439 HIS HIS A . n A 1 52 VAL 52 440 440 VAL VAL A . n A 1 53 LEU 53 441 441 LEU LEU A . n A 1 54 GLN 54 442 442 GLN GLN A . n A 1 55 GLY 55 443 443 GLY GLY A . n A 1 56 GLU 56 444 444 GLU GLU A . n A 1 57 ARG 57 445 445 ARG ARG A . n A 1 58 LYS 58 446 446 LYS LYS A . n A 1 59 ARG 59 447 447 ARG ARG A . n A 1 60 ALA 60 448 448 ALA ALA A . n A 1 61 ALA 61 449 449 ALA ALA A . n A 1 62 ASP 62 450 450 ASP ASP A . n A 1 63 ASN 63 451 451 ASN ASN A . n A 1 64 LYS 64 452 452 LYS LYS A . n A 1 65 SER 65 453 453 SER SER A . n A 1 66 LEU 66 454 454 LEU LEU A . n A 1 67 GLY 67 455 455 GLY GLY A . n A 1 68 GLN 68 456 456 GLN GLN A . n A 1 69 PHE 69 457 457 PHE PHE A . n A 1 70 ASN 70 458 458 ASN ASN A . n A 1 71 LEU 71 459 459 LEU LEU A . n A 1 72 ASP 72 460 460 ASP ASP A . n A 1 73 GLY 73 461 461 GLY GLY A . n A 1 74 ILE 74 462 462 ILE ILE A . n A 1 75 ASN 75 463 463 ASN ASN A . n A 1 76 PRO 76 464 464 PRO PRO A . n A 1 77 ALA 77 465 465 ALA ALA A . n A 1 78 PRO 78 466 466 PRO PRO A . n A 1 79 ARG 79 467 467 ARG ARG A . n A 1 80 GLY 80 468 468 GLY GLY A . n A 1 81 MET 81 469 469 MET MET A . n A 1 82 PRO 82 470 470 PRO PRO A . n A 1 83 GLN 83 471 471 GLN GLN A . n A 1 84 ILE 84 472 472 ILE ILE A . n A 1 85 GLU 85 473 473 GLU GLU A . n A 1 86 VAL 86 474 474 VAL VAL A . n A 1 87 THR 87 475 475 THR THR A . n A 1 88 PHE 88 476 476 PHE PHE A . n A 1 89 ASP 89 477 477 ASP ASP A . n A 1 90 ILE 90 478 478 ILE ILE A . n A 1 91 ASP 91 479 479 ASP ASP A . n A 1 92 ALA 92 480 480 ALA ALA A . n A 1 93 ASP 93 481 481 ASP ASP A . n A 1 94 GLY 94 482 482 GLY GLY A . n A 1 95 ILE 95 483 483 ILE ILE A . n A 1 96 LEU 96 484 484 LEU LEU A . n A 1 97 HIS 97 485 485 HIS HIS A . n A 1 98 VAL 98 486 486 VAL VAL A . n A 1 99 SER 99 487 487 SER SER A . n A 1 100 ALA 100 488 488 ALA ALA A . n A 1 101 LYS 101 489 489 LYS LYS A . n A 1 102 ASP 102 490 490 ASP ASP A . n A 1 103 LYS 103 491 491 LYS LYS A . n A 1 104 ASN 104 492 492 ASN ASN A . n A 1 105 SER 105 493 493 SER SER A . n A 1 106 GLY 106 494 494 GLY GLY A . n A 1 107 LYS 107 495 495 LYS LYS A . n A 1 108 GLU 108 496 496 GLU GLU A . n A 1 109 GLN 109 497 497 GLN GLN A . n A 1 110 LYS 110 498 498 LYS LYS A . n A 1 111 ILE 111 499 499 ILE ILE A . n A 1 112 THR 112 500 500 THR THR A . n A 1 113 ILE 113 501 501 ILE ILE A . n A 1 114 LYS 114 502 502 LYS LYS A . n A 1 115 ALA 115 503 503 ALA ALA A . n A 1 116 SER 116 504 504 SER SER A . n A 1 117 SER 117 505 505 SER SER A . n A 1 118 GLY 118 506 506 GLY GLY A . n A 1 119 LEU 119 507 507 LEU LEU A . n A 1 120 ASN 120 508 508 ASN ASN A . n A 1 121 GLU 121 509 509 GLU GLU A . n A 1 122 ASP 122 510 510 ASP ASP A . n A 1 123 GLU 123 511 511 GLU GLU A . n A 1 124 ILE 124 512 512 ILE ILE A . n A 1 125 GLN 125 513 513 GLN GLN A . n A 1 126 LYS 126 514 514 LYS LYS A . n A 1 127 MET 127 515 515 MET MET A . n A 1 128 VAL 128 516 516 VAL VAL A . n A 1 129 ARG 129 517 517 ARG ARG A . n A 1 130 ASP 130 518 518 ASP ASP A . n A 1 131 ALA 131 519 519 ALA ALA A . n A 1 132 GLU 132 520 520 GLU GLU A . n A 1 133 ALA 133 521 521 ALA ALA A . n A 1 134 ASN 134 522 522 ASN ASN A . n A 1 135 ALA 135 523 523 ALA ALA A . n A 1 136 GLU 136 524 524 GLU GLU A . n A 1 137 ALA 137 525 525 ALA ALA A . n A 1 138 ASP 138 526 526 ASP ASP A . n A 1 139 ARG 139 527 527 ARG ARG A . n A 1 140 LYS 140 528 528 LYS LYS A . n A 1 141 PHE 141 529 529 PHE PHE A . n A 1 142 GLU 142 530 530 GLU GLU A . n A 1 143 GLU 143 531 531 GLU GLU A . n A 1 144 LEU 144 532 532 LEU LEU A . n A 1 145 VAL 145 533 533 VAL VAL A . n A 1 146 GLN 146 534 534 GLN GLN A . n A 1 147 THR 147 535 535 THR THR A . n A 1 148 ARG 148 536 536 ARG ARG A . n A 1 149 ASN 149 537 537 ASN ASN A . n A 1 150 GLN 150 538 538 GLN GLN A . n A 1 151 GLY 151 539 539 GLY GLY A . n A 1 152 ASP 152 540 540 ASP ASP A . n A 1 153 HIS 153 541 541 HIS HIS A . n A 1 154 LEU 154 542 542 LEU LEU A . n A 1 155 LEU 155 543 543 LEU LEU A . n A 1 156 HIS 156 544 544 HIS HIS A . n A 1 157 SER 157 545 545 SER SER A . n A 1 158 THR 158 546 546 THR THR A . n A 1 159 ARG 159 547 547 ARG ARG A . n A 1 160 LYS 160 548 548 LYS LYS A . n A 1 161 GLN 161 549 549 GLN GLN A . n A 1 162 VAL 162 550 550 VAL VAL A . n A 1 163 GLU 163 551 551 GLU GLU A . n A 1 164 GLU 164 552 552 GLU GLU A . n A 1 165 ALA 165 553 553 ALA ALA A . n A 1 166 GLY 166 554 554 GLY GLY A . n A 1 167 ASP 167 555 555 ASP ASP A . n A 1 168 LYS 168 556 556 LYS LYS A . n A 1 169 LEU 169 557 557 LEU LEU A . n A 1 170 PRO 170 558 558 PRO PRO A . n A 1 171 ALA 171 559 559 ALA ALA A . n A 1 172 ASP 172 560 560 ASP ASP A . n A 1 173 ASP 173 561 561 ASP ASP A . n A 1 174 LYS 174 562 562 LYS LYS A . n A 1 175 THR 175 563 563 THR THR A . n A 1 176 ALA 176 564 564 ALA ALA A . n A 1 177 ILE 177 565 565 ILE ILE A . n A 1 178 GLU 178 566 566 GLU GLU A . n A 1 179 SER 179 567 567 SER SER A . n A 1 180 ALA 180 568 568 ALA ALA A . n A 1 181 LEU 181 569 569 LEU LEU A . n A 1 182 THR 182 570 570 THR THR A . n A 1 183 ALA 183 571 571 ALA ALA A . n A 1 184 LEU 184 572 572 LEU LEU A . n A 1 185 GLU 185 573 573 GLU GLU A . n A 1 186 THR 186 574 574 THR THR A . n A 1 187 ALA 187 575 575 ALA ALA A . n A 1 188 LEU 188 576 576 LEU LEU A . n A 1 189 LYS 189 577 577 LYS LYS A . n A 1 190 GLY 190 578 578 GLY GLY A . n A 1 191 GLU 191 579 579 GLU GLU A . n A 1 192 ASP 192 580 580 ASP ASP A . n A 1 193 LYS 193 581 581 LYS LYS A . n A 1 194 ALA 194 582 582 ALA ALA A . n A 1 195 ALA 195 583 583 ALA ALA A . n A 1 196 ILE 196 584 584 ILE ILE A . n A 1 197 GLU 197 585 585 GLU GLU A . n A 1 198 ALA 198 586 586 ALA ALA A . n A 1 199 LYS 199 587 587 LYS LYS A . n A 1 200 MET 200 588 588 MET MET A . n A 1 201 GLN 201 589 589 GLN GLN A . n A 1 202 GLU 202 590 590 GLU GLU A . n A 1 203 LEU 203 591 591 LEU LEU A . n A 1 204 ALA 204 592 592 ALA ALA A . n A 1 205 GLN 205 593 593 GLN GLN A . n A 1 206 VAL 206 594 594 VAL VAL A . n A 1 207 SER 207 595 595 SER SER A . n A 1 208 GLN 208 596 596 GLN GLN A . n A 1 209 LYS 209 597 597 LYS LYS A . n A 1 210 LEU 210 598 598 LEU LEU A . n A 1 211 MET 211 599 599 MET MET A . n A 1 212 GLU 212 600 600 GLU GLU A . n A 1 213 ILE 213 601 601 ILE ILE A . n A 1 214 ALA 214 602 602 ALA ALA A . n A 1 215 GLN 215 603 603 GLN GLN A . n A 1 216 GLN 216 604 ? ? ? A . n A 1 217 GLN 217 605 ? ? ? A . n A 1 218 HIS 218 606 ? ? ? A . n A 1 219 ALA 219 607 ? ? ? A . n B 2 1 ARG 1 414 ? ? ? B . n B 2 2 GLY 2 415 ? ? ? B . n B 2 3 SER 3 416 ? ? ? B . n B 2 4 GLN 4 417 ? ? ? B . n B 2 5 LEU 5 418 417 LEU LEU B . n B 2 6 ARG 6 419 418 ARG ARG B . n B 2 7 ILE 7 420 419 ILE ILE B . n B 2 8 ALA 8 421 420 ALA ALA B . n B 2 9 SER 9 422 ? ? ? B . n B 2 10 ARG 10 423 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 701 1 SO4 SO4 A . D 4 HOH 1 801 6 HOH HOH A . D 4 HOH 2 802 2 HOH HOH A . D 4 HOH 3 803 4 HOH HOH A . D 4 HOH 4 804 3 HOH HOH A . D 4 HOH 5 805 1 HOH HOH A . D 4 HOH 6 806 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1160 ? 1 MORE -21 ? 1 'SSA (A^2)' 12060 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-26 2 'Structure model' 2 0 2021-07-07 3 'Structure model' 2 1 2021-10-20 4 'Structure model' 2 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Derived calculations' 5 2 'Structure model' 'Structure summary' 6 3 'Structure model' 'Database references' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_poly_seq_scheme 3 2 'Structure model' pdbx_struct_sheet_hbond 4 2 'Structure model' pdbx_unobs_or_zero_occ_residues 5 2 'Structure model' struct_ref_seq 6 2 'Structure model' struct_ref_seq_dif 7 2 'Structure model' struct_sheet_range 8 2 'Structure model' struct_site_gen 9 3 'Structure model' citation 10 3 'Structure model' citation_author 11 3 'Structure model' database_2 12 4 'Structure model' chem_comp_atom 13 4 'Structure model' chem_comp_bond 14 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.auth_seq_id' 2 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_seq_num' 3 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 4 2 'Structure model' '_pdbx_unobs_or_zero_occ_residues.auth_seq_id' 5 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 6 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 7 2 'Structure model' '_struct_ref_seq_dif.pdbx_auth_seq_num' 8 2 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 9 2 'Structure model' '_struct_sheet_range.end_auth_seq_id' 10 2 'Structure model' '_struct_site_gen.auth_seq_id' 11 3 'Structure model' '_citation.country' 12 3 'Structure model' '_citation.journal_abbrev' 13 3 'Structure model' '_citation.journal_id_ASTM' 14 3 'Structure model' '_citation.journal_id_CSD' 15 3 'Structure model' '_citation.journal_id_ISSN' 16 3 'Structure model' '_citation.journal_volume' 17 3 'Structure model' '_citation.pdbx_database_id_DOI' 18 3 'Structure model' '_citation.pdbx_database_id_PubMed' 19 3 'Structure model' '_citation.title' 20 3 'Structure model' '_citation.year' 21 3 'Structure model' '_database_2.pdbx_DOI' 22 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7JNE _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 397 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 801 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 404 ? ? -39.03 118.86 2 1 LYS A 414 ? ? -26.72 135.16 3 1 LYS A 502 ? ? -47.84 151.46 4 1 ASP A 510 ? ? -75.55 -70.26 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 391 ? CG ? A LEU 3 CG 2 1 Y 1 A LEU 391 ? CD1 ? A LEU 3 CD1 3 1 Y 1 A LEU 391 ? CD2 ? A LEU 3 CD2 4 1 Y 1 A ILE 418 ? CD1 ? A ILE 30 CD1 5 1 Y 1 A LYS 421 ? CE ? A LYS 33 CE 6 1 Y 1 A LYS 421 ? NZ ? A LYS 33 NZ 7 1 Y 1 A LYS 446 ? CE ? A LYS 58 CE 8 1 Y 1 A LYS 446 ? NZ ? A LYS 58 NZ 9 1 Y 1 A LYS 498 ? NZ ? A LYS 110 NZ 10 1 Y 1 A LYS 502 ? NZ ? A LYS 114 NZ 11 1 Y 1 A GLN 513 ? CG ? A GLN 125 CG 12 1 Y 1 A GLN 513 ? CD ? A GLN 125 CD 13 1 Y 1 A GLN 513 ? OE1 ? A GLN 125 OE1 14 1 Y 1 A GLN 513 ? NE2 ? A GLN 125 NE2 15 1 Y 1 A LYS 514 ? NZ ? A LYS 126 NZ 16 1 Y 1 A GLU 520 ? CG ? A GLU 132 CG 17 1 Y 1 A GLU 520 ? CD ? A GLU 132 CD 18 1 Y 1 A GLU 520 ? OE1 ? A GLU 132 OE1 19 1 Y 1 A GLU 520 ? OE2 ? A GLU 132 OE2 20 1 Y 1 A GLU 524 ? CD ? A GLU 136 CD 21 1 Y 1 A GLU 524 ? OE1 ? A GLU 136 OE1 22 1 Y 1 A GLU 524 ? OE2 ? A GLU 136 OE2 23 1 Y 1 A ARG 527 ? NE ? A ARG 139 NE 24 1 Y 1 A ARG 527 ? CZ ? A ARG 139 CZ 25 1 Y 1 A ARG 527 ? NH1 ? A ARG 139 NH1 26 1 Y 1 A ARG 527 ? NH2 ? A ARG 139 NH2 27 1 Y 1 A LYS 528 ? CD ? A LYS 140 CD 28 1 Y 1 A LYS 528 ? CE ? A LYS 140 CE 29 1 Y 1 A LYS 528 ? NZ ? A LYS 140 NZ 30 1 Y 1 A LYS 548 ? CE ? A LYS 160 CE 31 1 Y 1 A LYS 548 ? NZ ? A LYS 160 NZ 32 1 Y 1 A LYS 556 ? NZ ? A LYS 168 NZ 33 1 Y 1 A ALA 559 ? CB ? A ALA 171 CB 34 1 Y 1 A LYS 597 ? CD ? A LYS 209 CD 35 1 Y 1 A LYS 597 ? CE ? A LYS 209 CE 36 1 Y 1 A LYS 597 ? NZ ? A LYS 209 NZ 37 1 Y 1 A GLU 600 ? CD ? A GLU 212 CD 38 1 Y 1 A GLU 600 ? OE1 ? A GLU 212 OE1 39 1 Y 1 A GLU 600 ? OE2 ? A GLU 212 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 604 ? A GLN 216 2 1 Y 1 A GLN 605 ? A GLN 217 3 1 Y 1 A HIS 606 ? A HIS 218 4 1 Y 1 A ALA 607 ? A ALA 219 5 1 Y 1 B ARG 414 ? B ARG 1 6 1 Y 1 B GLY 415 ? B GLY 2 7 1 Y 1 B SER 416 ? B SER 3 8 1 Y 1 B GLN 417 ? B GLN 4 9 1 Y 1 B SER 422 ? B SER 9 10 1 Y 1 B ARG 423 ? B ARG 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TYR N CA sing N N 297 TYR N H sing N N 298 TYR N H2 sing N N 299 TYR CA C sing N N 300 TYR CA CB sing N N 301 TYR CA HA sing N N 302 TYR C O doub N N 303 TYR C OXT sing N N 304 TYR CB CG sing N N 305 TYR CB HB2 sing N N 306 TYR CB HB3 sing N N 307 TYR CG CD1 doub Y N 308 TYR CG CD2 sing Y N 309 TYR CD1 CE1 sing Y N 310 TYR CD1 HD1 sing N N 311 TYR CD2 CE2 doub Y N 312 TYR CD2 HD2 sing N N 313 TYR CE1 CZ doub Y N 314 TYR CE1 HE1 sing N N 315 TYR CE2 CZ sing Y N 316 TYR CE2 HE2 sing N N 317 TYR CZ OH sing N N 318 TYR OH HH sing N N 319 TYR OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number '5 R35 GM118161' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1DKZ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #