data_7JQE # _entry.id 7JQE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 7JQE WWPDB D_1000251238 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JQE _pdbx_database_status.recvd_initial_deposition_date 2020-08-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Klein, T.A.' 1 ? 'Grebenc, D.W.' 2 ? 'Kim, Y.' 3 ? 'Whitney, J.C.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 177 _citation.page_last 185.e6 _citation.title 'Structure of the Extracellular Region of the Bacterial Type VIIb Secretion System Subunit EsaA.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2020.11.002 _citation.pdbx_database_id_PubMed 33238147 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klein, T.A.' 1 ? primary 'Grebenc, D.W.' 2 ? primary 'Gandhi, S.Y.' 3 ? primary 'Shah, V.S.' 4 ? primary 'Kim, Y.' 5 ? primary 'Whitney, J.C.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7JQE _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.466 _cell.length_a_esd ? _cell.length_b 248.235 _cell.length_b_esd ? _cell.length_c 81.095 _cell.length_c_esd ? _cell.volume 1499046.550 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JQE _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ESAT-6/WXG100 secretion system protein' 66067.625 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 23 ? ? ? ? 4 water nat water 18.015 28 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VSSISELLNSTSSGLNSELPEVKSFVDLQQDIAKTNVATANTAISDQYQTDTELYDALNSNILSSLSSFYTSTSD ITTESTSNGTVYKLFENQITAYNEEVENYRSKVENARTELSDLLEEVKATRSKVSNQYFNSDLALDINSYFATTNQEERK LAIKIDLLNQVTDDSVKSALANQIQESLGGTLPSEYETEIASL(MSE)GSVDVAASDYATLFSKLEE(MSE)GA(MSE)T SDEVSDYQSKLALLGKYKSAKGVTTVSGATYSFLTAEDAKPEQSNVISVDVAPTSTQIITTTTSSTSEDESNTDDTSSNS SEGNEQETTPTTTENTETKEDPTTVTISNVSGGTVVFADDNSVSKTISKAQSLKISYTFDSLSVGTHTITLDLNIGDNRI P(MSE)TYTIYVTDTADDVSLVKDDLKTIFAQLSKIDTASA(MSE)IQTLYGEPGQTDLSQIDITNPSANSVAN(MSE)Y GNLTFDNIDGLDVTNFKESGVTLYTELTNEIIELQSTIDSLPTLPEGY(MSE)PTDYFSTELQSLVNWYNTTSQSLNNEY AKWSQNQAKELNVGSYGSGTSDNSTLYTDTASGDALYDGISELVKSTADSAQSTTSNYEAIGT(MSE)TDDFLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSSISELLNSTSSGLNSELPEVKSFVDLQQDIAKTNVATANTAISDQYQTDTELYDALNSNILSSLSSFYTSTSDITTE STSNGTVYKLFENQITAYNEEVENYRSKVENARTELSDLLEEVKATRSKVSNQYFNSDLALDINSYFATTNQEERKLAIK IDLLNQVTDDSVKSALANQIQESLGGTLPSEYETEIASLMGSVDVAASDYATLFSKLEEMGAMTSDEVSDYQSKLALLGK YKSAKGVTTVSGATYSFLTAEDAKPEQSNVISVDVAPTSTQIITTTTSSTSEDESNTDDTSSNSSEGNEQETTPTTTENT ETKEDPTTVTISNVSGGTVVFADDNSVSKTISKAQSLKISYTFDSLSVGTHTITLDLNIGDNRIPMTYTIYVTDTADDVS LVKDDLKTIFAQLSKIDTASAMIQTLYGEPGQTDLSQIDITNPSANSVANMYGNLTFDNIDGLDVTNFKESGVTLYTELT NEIIELQSTIDSLPTLPEGYMPTDYFSTELQSLVNWYNTTSQSLNNEYAKWSQNQAKELNVGSYGSGTSDNSTLYTDTAS GDALYDGISELVKSTADSAQSTTSNYEAIGTMTDDFLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 SER n 1 4 SER n 1 5 ILE n 1 6 SER n 1 7 GLU n 1 8 LEU n 1 9 LEU n 1 10 ASN n 1 11 SER n 1 12 THR n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 LEU n 1 17 ASN n 1 18 SER n 1 19 GLU n 1 20 LEU n 1 21 PRO n 1 22 GLU n 1 23 VAL n 1 24 LYS n 1 25 SER n 1 26 PHE n 1 27 VAL n 1 28 ASP n 1 29 LEU n 1 30 GLN n 1 31 GLN n 1 32 ASP n 1 33 ILE n 1 34 ALA n 1 35 LYS n 1 36 THR n 1 37 ASN n 1 38 VAL n 1 39 ALA n 1 40 THR n 1 41 ALA n 1 42 ASN n 1 43 THR n 1 44 ALA n 1 45 ILE n 1 46 SER n 1 47 ASP n 1 48 GLN n 1 49 TYR n 1 50 GLN n 1 51 THR n 1 52 ASP n 1 53 THR n 1 54 GLU n 1 55 LEU n 1 56 TYR n 1 57 ASP n 1 58 ALA n 1 59 LEU n 1 60 ASN n 1 61 SER n 1 62 ASN n 1 63 ILE n 1 64 LEU n 1 65 SER n 1 66 SER n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 PHE n 1 71 TYR n 1 72 THR n 1 73 SER n 1 74 THR n 1 75 SER n 1 76 ASP n 1 77 ILE n 1 78 THR n 1 79 THR n 1 80 GLU n 1 81 SER n 1 82 THR n 1 83 SER n 1 84 ASN n 1 85 GLY n 1 86 THR n 1 87 VAL n 1 88 TYR n 1 89 LYS n 1 90 LEU n 1 91 PHE n 1 92 GLU n 1 93 ASN n 1 94 GLN n 1 95 ILE n 1 96 THR n 1 97 ALA n 1 98 TYR n 1 99 ASN n 1 100 GLU n 1 101 GLU n 1 102 VAL n 1 103 GLU n 1 104 ASN n 1 105 TYR n 1 106 ARG n 1 107 SER n 1 108 LYS n 1 109 VAL n 1 110 GLU n 1 111 ASN n 1 112 ALA n 1 113 ARG n 1 114 THR n 1 115 GLU n 1 116 LEU n 1 117 SER n 1 118 ASP n 1 119 LEU n 1 120 LEU n 1 121 GLU n 1 122 GLU n 1 123 VAL n 1 124 LYS n 1 125 ALA n 1 126 THR n 1 127 ARG n 1 128 SER n 1 129 LYS n 1 130 VAL n 1 131 SER n 1 132 ASN n 1 133 GLN n 1 134 TYR n 1 135 PHE n 1 136 ASN n 1 137 SER n 1 138 ASP n 1 139 LEU n 1 140 ALA n 1 141 LEU n 1 142 ASP n 1 143 ILE n 1 144 ASN n 1 145 SER n 1 146 TYR n 1 147 PHE n 1 148 ALA n 1 149 THR n 1 150 THR n 1 151 ASN n 1 152 GLN n 1 153 GLU n 1 154 GLU n 1 155 ARG n 1 156 LYS n 1 157 LEU n 1 158 ALA n 1 159 ILE n 1 160 LYS n 1 161 ILE n 1 162 ASP n 1 163 LEU n 1 164 LEU n 1 165 ASN n 1 166 GLN n 1 167 VAL n 1 168 THR n 1 169 ASP n 1 170 ASP n 1 171 SER n 1 172 VAL n 1 173 LYS n 1 174 SER n 1 175 ALA n 1 176 LEU n 1 177 ALA n 1 178 ASN n 1 179 GLN n 1 180 ILE n 1 181 GLN n 1 182 GLU n 1 183 SER n 1 184 LEU n 1 185 GLY n 1 186 GLY n 1 187 THR n 1 188 LEU n 1 189 PRO n 1 190 SER n 1 191 GLU n 1 192 TYR n 1 193 GLU n 1 194 THR n 1 195 GLU n 1 196 ILE n 1 197 ALA n 1 198 SER n 1 199 LEU n 1 200 MSE n 1 201 GLY n 1 202 SER n 1 203 VAL n 1 204 ASP n 1 205 VAL n 1 206 ALA n 1 207 ALA n 1 208 SER n 1 209 ASP n 1 210 TYR n 1 211 ALA n 1 212 THR n 1 213 LEU n 1 214 PHE n 1 215 SER n 1 216 LYS n 1 217 LEU n 1 218 GLU n 1 219 GLU n 1 220 MSE n 1 221 GLY n 1 222 ALA n 1 223 MSE n 1 224 THR n 1 225 SER n 1 226 ASP n 1 227 GLU n 1 228 VAL n 1 229 SER n 1 230 ASP n 1 231 TYR n 1 232 GLN n 1 233 SER n 1 234 LYS n 1 235 LEU n 1 236 ALA n 1 237 LEU n 1 238 LEU n 1 239 GLY n 1 240 LYS n 1 241 TYR n 1 242 LYS n 1 243 SER n 1 244 ALA n 1 245 LYS n 1 246 GLY n 1 247 VAL n 1 248 THR n 1 249 THR n 1 250 VAL n 1 251 SER n 1 252 GLY n 1 253 ALA n 1 254 THR n 1 255 TYR n 1 256 SER n 1 257 PHE n 1 258 LEU n 1 259 THR n 1 260 ALA n 1 261 GLU n 1 262 ASP n 1 263 ALA n 1 264 LYS n 1 265 PRO n 1 266 GLU n 1 267 GLN n 1 268 SER n 1 269 ASN n 1 270 VAL n 1 271 ILE n 1 272 SER n 1 273 VAL n 1 274 ASP n 1 275 VAL n 1 276 ALA n 1 277 PRO n 1 278 THR n 1 279 SER n 1 280 THR n 1 281 GLN n 1 282 ILE n 1 283 ILE n 1 284 THR n 1 285 THR n 1 286 THR n 1 287 THR n 1 288 SER n 1 289 SER n 1 290 THR n 1 291 SER n 1 292 GLU n 1 293 ASP n 1 294 GLU n 1 295 SER n 1 296 ASN n 1 297 THR n 1 298 ASP n 1 299 ASP n 1 300 THR n 1 301 SER n 1 302 SER n 1 303 ASN n 1 304 SER n 1 305 SER n 1 306 GLU n 1 307 GLY n 1 308 ASN n 1 309 GLU n 1 310 GLN n 1 311 GLU n 1 312 THR n 1 313 THR n 1 314 PRO n 1 315 THR n 1 316 THR n 1 317 THR n 1 318 GLU n 1 319 ASN n 1 320 THR n 1 321 GLU n 1 322 THR n 1 323 LYS n 1 324 GLU n 1 325 ASP n 1 326 PRO n 1 327 THR n 1 328 THR n 1 329 VAL n 1 330 THR n 1 331 ILE n 1 332 SER n 1 333 ASN n 1 334 VAL n 1 335 SER n 1 336 GLY n 1 337 GLY n 1 338 THR n 1 339 VAL n 1 340 VAL n 1 341 PHE n 1 342 ALA n 1 343 ASP n 1 344 ASP n 1 345 ASN n 1 346 SER n 1 347 VAL n 1 348 SER n 1 349 LYS n 1 350 THR n 1 351 ILE n 1 352 SER n 1 353 LYS n 1 354 ALA n 1 355 GLN n 1 356 SER n 1 357 LEU n 1 358 LYS n 1 359 ILE n 1 360 SER n 1 361 TYR n 1 362 THR n 1 363 PHE n 1 364 ASP n 1 365 SER n 1 366 LEU n 1 367 SER n 1 368 VAL n 1 369 GLY n 1 370 THR n 1 371 HIS n 1 372 THR n 1 373 ILE n 1 374 THR n 1 375 LEU n 1 376 ASP n 1 377 LEU n 1 378 ASN n 1 379 ILE n 1 380 GLY n 1 381 ASP n 1 382 ASN n 1 383 ARG n 1 384 ILE n 1 385 PRO n 1 386 MSE n 1 387 THR n 1 388 TYR n 1 389 THR n 1 390 ILE n 1 391 TYR n 1 392 VAL n 1 393 THR n 1 394 ASP n 1 395 THR n 1 396 ALA n 1 397 ASP n 1 398 ASP n 1 399 VAL n 1 400 SER n 1 401 LEU n 1 402 VAL n 1 403 LYS n 1 404 ASP n 1 405 ASP n 1 406 LEU n 1 407 LYS n 1 408 THR n 1 409 ILE n 1 410 PHE n 1 411 ALA n 1 412 GLN n 1 413 LEU n 1 414 SER n 1 415 LYS n 1 416 ILE n 1 417 ASP n 1 418 THR n 1 419 ALA n 1 420 SER n 1 421 ALA n 1 422 MSE n 1 423 ILE n 1 424 GLN n 1 425 THR n 1 426 LEU n 1 427 TYR n 1 428 GLY n 1 429 GLU n 1 430 PRO n 1 431 GLY n 1 432 GLN n 1 433 THR n 1 434 ASP n 1 435 LEU n 1 436 SER n 1 437 GLN n 1 438 ILE n 1 439 ASP n 1 440 ILE n 1 441 THR n 1 442 ASN n 1 443 PRO n 1 444 SER n 1 445 ALA n 1 446 ASN n 1 447 SER n 1 448 VAL n 1 449 ALA n 1 450 ASN n 1 451 MSE n 1 452 TYR n 1 453 GLY n 1 454 ASN n 1 455 LEU n 1 456 THR n 1 457 PHE n 1 458 ASP n 1 459 ASN n 1 460 ILE n 1 461 ASP n 1 462 GLY n 1 463 LEU n 1 464 ASP n 1 465 VAL n 1 466 THR n 1 467 ASN n 1 468 PHE n 1 469 LYS n 1 470 GLU n 1 471 SER n 1 472 GLY n 1 473 VAL n 1 474 THR n 1 475 LEU n 1 476 TYR n 1 477 THR n 1 478 GLU n 1 479 LEU n 1 480 THR n 1 481 ASN n 1 482 GLU n 1 483 ILE n 1 484 ILE n 1 485 GLU n 1 486 LEU n 1 487 GLN n 1 488 SER n 1 489 THR n 1 490 ILE n 1 491 ASP n 1 492 SER n 1 493 LEU n 1 494 PRO n 1 495 THR n 1 496 LEU n 1 497 PRO n 1 498 GLU n 1 499 GLY n 1 500 TYR n 1 501 MSE n 1 502 PRO n 1 503 THR n 1 504 ASP n 1 505 TYR n 1 506 PHE n 1 507 SER n 1 508 THR n 1 509 GLU n 1 510 LEU n 1 511 GLN n 1 512 SER n 1 513 LEU n 1 514 VAL n 1 515 ASN n 1 516 TRP n 1 517 TYR n 1 518 ASN n 1 519 THR n 1 520 THR n 1 521 SER n 1 522 GLN n 1 523 SER n 1 524 LEU n 1 525 ASN n 1 526 ASN n 1 527 GLU n 1 528 TYR n 1 529 ALA n 1 530 LYS n 1 531 TRP n 1 532 SER n 1 533 GLN n 1 534 ASN n 1 535 GLN n 1 536 ALA n 1 537 LYS n 1 538 GLU n 1 539 LEU n 1 540 ASN n 1 541 VAL n 1 542 GLY n 1 543 SER n 1 544 TYR n 1 545 GLY n 1 546 SER n 1 547 GLY n 1 548 THR n 1 549 SER n 1 550 ASP n 1 551 ASN n 1 552 SER n 1 553 THR n 1 554 LEU n 1 555 TYR n 1 556 THR n 1 557 ASP n 1 558 THR n 1 559 ALA n 1 560 SER n 1 561 GLY n 1 562 ASP n 1 563 ALA n 1 564 LEU n 1 565 TYR n 1 566 ASP n 1 567 GLY n 1 568 ILE n 1 569 SER n 1 570 GLU n 1 571 LEU n 1 572 VAL n 1 573 LYS n 1 574 SER n 1 575 THR n 1 576 ALA n 1 577 ASP n 1 578 SER n 1 579 ALA n 1 580 GLN n 1 581 SER n 1 582 THR n 1 583 THR n 1 584 SER n 1 585 ASN n 1 586 TYR n 1 587 GLU n 1 588 ALA n 1 589 ILE n 1 590 GLY n 1 591 THR n 1 592 MSE n 1 593 THR n 1 594 ASP n 1 595 ASP n 1 596 PHE n 1 597 LEU n 1 598 GLU n 1 599 HIS n 1 600 HIS n 1 601 HIS n 1 602 HIS n 1 603 HIS n 1 604 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 604 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'esaA, SGGB_0524' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43143 / F-1867' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus gallolyticus (strain ATCC 43143 / F-1867)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 981539 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant CodonPlus _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F5WZF6_STRG1 _struct_ref.pdbx_db_accession F5WZF6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSSISELLNSTSSGLNSELPEVKSFVDLQQDIAKTNVATANTAISDQYQTDTELYDALNSNILSSLSSFYTSTSDITTES TSNGTVYKLFENQITAYNEEVENYRSKVENARTELSDLLEEVKATRSKVSNQYFNSDLALDINSYFATTNQEERKLAIKI DLLNQVTDDSVKSALANQIQESLGGTLPSEYETEIASLMGSVDVAASDYATLFSKLEEMGAMTSDEVSDYQSKLALLGKY KSAKGVTTVSGATYSFLTAEDAKPEQSNVISVDVAPTSTQIITTTTSSTSEDESNTDDTSSNSSEGNEQETTPTTTENTE TKEDPTTVTISNVSGGTVVFADDNSVSKTISKAQSLKISYTFDSLSVGTHTITLDLNIGDNRIPMTYTIYVTDTADDVSL VKDDLKTIFAQLSKIDTASAMIQTLYGEPGQTDLSQIDITNPSANSVANMYGNLTFDNIDGLDVTNFKESGVTLYTELTN EIIELQSTIDSLPTLPEGYMPTDYFSTELQSLVNWYNTTSQSLNNEYAKWSQNQAKELNVGSYGSGTSDNSTLYTDTASG DALYDGISELVKSTADSAQSTTSNYEAIGTMTDDF ; _struct_ref.pdbx_align_begin 235 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7JQE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 596 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F5WZF6 _struct_ref_seq.db_align_beg 235 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 829 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 596 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7JQE MSE A 1 ? UNP F5WZF6 ? ? 'initiating methionine' 1 1 1 7JQE LEU A 597 ? UNP F5WZF6 ? ? 'expression tag' 597 2 1 7JQE GLU A 598 ? UNP F5WZF6 ? ? 'expression tag' 598 3 1 7JQE HIS A 599 ? UNP F5WZF6 ? ? 'expression tag' 599 4 1 7JQE HIS A 600 ? UNP F5WZF6 ? ? 'expression tag' 600 5 1 7JQE HIS A 601 ? UNP F5WZF6 ? ? 'expression tag' 601 6 1 7JQE HIS A 602 ? UNP F5WZF6 ? ? 'expression tag' 602 7 1 7JQE HIS A 603 ? UNP F5WZF6 ? ? 'expression tag' 603 8 1 7JQE HIS A 604 ? UNP F5WZF6 ? ? 'expression tag' 604 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JQE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M MgCl2, 0.1M Tris-HCl pH 7.0, 10% (w/v) PEG 8000.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 51.38 _reflns.entry_id 7JQE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 55.3 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 29568 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_Rmerge_I_obs 0.136 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.069 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1310 _reflns_shell.percent_possible_all 89.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.954 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.644 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.513 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 78.08 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JQE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 41.37 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29206 _refine.ls_number_reflns_R_free 1475 _refine.ls_number_reflns_R_work 27731 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.73 _refine.ls_percent_reflns_R_free 5.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2169 _refine.ls_R_factor_R_free 0.2616 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2146 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.7526 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3407 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 41.37 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 2837 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2716 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 93 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0025 ? 2816 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4274 ? 3782 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0363 ? 462 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0022 ? 481 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.7868 ? 1020 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.40 2.48 . . 126 2224 88.78 . . . 0.4337 . 0.3749 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.48 2.57 . . 121 2429 95.04 . . . 0.3535 . 0.3329 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.57 2.67 . . 136 2471 97.93 . . . 0.2994 . 0.2951 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.67 2.79 . . 120 2554 98.89 . . . 0.3222 . 0.2710 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.79 2.94 . . 143 2517 98.88 . . . 0.3488 . 0.2578 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.94 3.12 . . 135 2540 99.29 . . . 0.2988 . 0.2517 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.12 3.36 . . 153 2533 99.44 . . . 0.2666 . 0.2313 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.36 3.70 . . 141 2574 99.41 . . . 0.2385 . 0.2060 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.70 4.23 . . 132 2591 99.52 . . . 0.2133 . 0.1856 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.24 5.33 . . 119 2604 99.23 . . . 0.2399 . 0.1710 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.34 41.37 . . 149 2694 98.27 . . . 0.2437 . 0.1955 . . . . . . . . . . . # _struct.entry_id 7JQE _struct.title 'Structure of an extracellular fragment of EsaA from Streptococcus gallolyticus' _struct.pdbx_descriptor 'ESAT-6/WXG100 secretion system protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JQE _struct_keywords.text 'Bacterial type VII secretion system, bacterial toxin transport, membrane protein, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? M N N 3 ? N N N 3 ? O N N 3 ? P N N 3 ? Q N N 3 ? R N N 3 ? S N N 3 ? T N N 3 ? U N N 3 ? V N N 3 ? W N N 3 ? X N N 3 ? Y N N 3 ? Z N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 101 ? ASN A 136 ? GLU A 101 ASN A 136 1 ? 36 HELX_P HELX_P2 AA2 ASP A 142 ? PHE A 147 ? ASP A 142 PHE A 147 5 ? 6 HELX_P HELX_P3 AA3 ASN A 151 ? ASN A 165 ? ASN A 151 ASN A 165 1 ? 15 HELX_P HELX_P4 AA4 THR A 168 ? ILE A 180 ? THR A 168 ILE A 180 1 ? 13 HELX_P HELX_P5 AA5 SER A 190 ? GLY A 201 ? SER A 190 GLY A 201 1 ? 12 HELX_P HELX_P6 AA6 ALA A 206 ? ASP A 209 ? ALA A 206 ASP A 209 5 ? 4 HELX_P HELX_P7 AA7 TYR A 210 ? MSE A 220 ? TYR A 210 MSE A 220 1 ? 11 HELX_P HELX_P8 AA8 THR A 224 ? LYS A 245 ? THR A 224 LYS A 245 1 ? 22 HELX_P HELX_P9 AA9 TYR A 255 ? THR A 259 ? TYR A 255 THR A 259 5 ? 5 HELX_P HELX_P10 AB1 THR A 395 ? ASP A 404 ? THR A 395 ASP A 404 1 ? 10 HELX_P HELX_P11 AB2 ASP A 405 ? GLY A 428 ? ASP A 405 GLY A 428 1 ? 24 HELX_P HELX_P12 AB3 ASP A 434 ? ILE A 438 ? ASP A 434 ILE A 438 5 ? 5 HELX_P HELX_P13 AB4 SER A 447 ? TYR A 452 ? SER A 447 TYR A 452 1 ? 6 HELX_P HELX_P14 AB5 ASP A 461 ? SER A 492 ? ASP A 461 SER A 492 1 ? 32 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 199 C ? ? ? 1_555 A MSE 200 N ? ? A LEU 199 A MSE 200 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 200 C ? ? ? 1_555 A GLY 201 N ? ? A MSE 200 A GLY 201 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? A GLU 219 C ? ? ? 1_555 A MSE 220 N ? ? A GLU 219 A MSE 220 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 220 C ? ? ? 1_555 A GLY 221 N ? ? A MSE 220 A GLY 221 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale5 covale both ? A ALA 222 C ? ? ? 1_555 A MSE 223 N ? ? A ALA 222 A MSE 223 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale6 covale both ? A MSE 223 C ? ? ? 1_555 A THR 224 N ? ? A MSE 223 A THR 224 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? A PRO 385 C ? ? ? 1_555 A MSE 386 N ? ? A PRO 385 A MSE 386 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A MSE 386 C ? ? ? 1_555 A THR 387 N ? ? A MSE 386 A THR 387 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale9 covale both ? A ALA 421 C ? ? ? 1_555 A MSE 422 N ? ? A ALA 421 A MSE 422 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale10 covale both ? A MSE 422 C ? ? ? 1_555 A ILE 423 N ? ? A MSE 422 A ILE 423 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale11 covale both ? A ASN 450 C ? ? ? 1_555 A MSE 451 N ? ? A ASN 450 A MSE 451 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale12 covale both ? A MSE 451 C ? ? ? 1_555 A TYR 452 N ? ? A MSE 451 A TYR 452 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 268 ? VAL A 275 ? SER A 268 VAL A 275 AA1 2 GLN A 355 ? PHE A 363 ? GLN A 355 PHE A 363 AA1 3 GLY A 337 ? PHE A 341 ? GLY A 337 PHE A 341 AA2 1 SER A 348 ? ILE A 351 ? SER A 348 ILE A 351 AA2 2 THR A 327 ? SER A 335 ? THR A 327 SER A 335 AA2 3 GLY A 369 ? ILE A 379 ? GLY A 369 ILE A 379 AA2 4 ASN A 382 ? VAL A 392 ? ASN A 382 VAL A 392 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 275 ? N VAL A 275 O GLN A 355 ? O GLN A 355 AA1 2 3 O SER A 360 ? O SER A 360 N VAL A 340 ? N VAL A 340 AA2 1 2 O LYS A 349 ? O LYS A 349 N VAL A 329 ? N VAL A 329 AA2 2 3 N SER A 332 ? N SER A 332 O ASP A 376 ? O ASP A 376 AA2 3 4 N HIS A 371 ? N HIS A 371 O ILE A 390 ? O ILE A 390 # _atom_sites.entry_id 7JQE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013429 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.004028 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012331 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 GLY 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 ASN 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 LEU 20 20 ? ? ? A . n A 1 21 PRO 21 21 ? ? ? A . n A 1 22 GLU 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 LYS 24 24 ? ? ? A . n A 1 25 SER 25 25 ? ? ? A . n A 1 26 PHE 26 26 ? ? ? A . n A 1 27 VAL 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 LEU 29 29 ? ? ? A . n A 1 30 GLN 30 30 ? ? ? A . n A 1 31 GLN 31 31 ? ? ? A . n A 1 32 ASP 32 32 ? ? ? A . n A 1 33 ILE 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 LYS 35 35 ? ? ? A . n A 1 36 THR 36 36 ? ? ? A . n A 1 37 ASN 37 37 ? ? ? A . n A 1 38 VAL 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 THR 40 40 ? ? ? A . n A 1 41 ALA 41 41 ? ? ? A . n A 1 42 ASN 42 42 ? ? ? A . n A 1 43 THR 43 43 ? ? ? A . n A 1 44 ALA 44 44 ? ? ? A . n A 1 45 ILE 45 45 ? ? ? A . n A 1 46 SER 46 46 ? ? ? A . n A 1 47 ASP 47 47 ? ? ? A . n A 1 48 GLN 48 48 ? ? ? A . n A 1 49 TYR 49 49 ? ? ? A . n A 1 50 GLN 50 50 ? ? ? A . n A 1 51 THR 51 51 ? ? ? A . n A 1 52 ASP 52 52 ? ? ? A . n A 1 53 THR 53 53 ? ? ? A . n A 1 54 GLU 54 54 ? ? ? A . n A 1 55 LEU 55 55 ? ? ? A . n A 1 56 TYR 56 56 ? ? ? A . n A 1 57 ASP 57 57 ? ? ? A . n A 1 58 ALA 58 58 ? ? ? A . n A 1 59 LEU 59 59 ? ? ? A . n A 1 60 ASN 60 60 ? ? ? A . n A 1 61 SER 61 61 ? ? ? A . n A 1 62 ASN 62 62 ? ? ? A . n A 1 63 ILE 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 SER 65 65 ? ? ? A . n A 1 66 SER 66 66 ? ? ? A . n A 1 67 LEU 67 67 ? ? ? A . n A 1 68 SER 68 68 ? ? ? A . n A 1 69 SER 69 69 ? ? ? A . n A 1 70 PHE 70 70 ? ? ? A . n A 1 71 TYR 71 71 ? ? ? A . n A 1 72 THR 72 72 ? ? ? A . n A 1 73 SER 73 73 ? ? ? A . n A 1 74 THR 74 74 ? ? ? A . n A 1 75 SER 75 75 ? ? ? A . n A 1 76 ASP 76 76 ? ? ? A . n A 1 77 ILE 77 77 ? ? ? A . n A 1 78 THR 78 78 ? ? ? A . n A 1 79 THR 79 79 ? ? ? A . n A 1 80 GLU 80 80 ? ? ? A . n A 1 81 SER 81 81 ? ? ? A . n A 1 82 THR 82 82 ? ? ? A . n A 1 83 SER 83 83 ? ? ? A . n A 1 84 ASN 84 84 ? ? ? A . n A 1 85 GLY 85 85 ? ? ? A . n A 1 86 THR 86 86 ? ? ? A . n A 1 87 VAL 87 87 ? ? ? A . n A 1 88 TYR 88 88 ? ? ? A . n A 1 89 LYS 89 89 ? ? ? A . n A 1 90 LEU 90 90 ? ? ? A . n A 1 91 PHE 91 91 ? ? ? A . n A 1 92 GLU 92 92 ? ? ? A . n A 1 93 ASN 93 93 ? ? ? A . n A 1 94 GLN 94 94 ? ? ? A . n A 1 95 ILE 95 95 ? ? ? A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 MSE 200 200 200 MSE MSE A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 TYR 210 210 210 TYR TYR A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 MSE 220 220 220 MSE MSE A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 MSE 223 223 223 MSE MSE A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 TYR 231 231 231 TYR TYR A . n A 1 232 GLN 232 232 232 GLN GLN A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 TYR 241 241 241 TYR TYR A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 THR 248 248 248 THR THR A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 TYR 255 255 255 TYR TYR A . n A 1 256 SER 256 256 256 SER SER A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 GLU 261 261 261 GLU GLU A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 PRO 265 265 265 PRO PRO A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 GLN 267 267 267 GLN GLN A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 VAL 273 273 273 VAL VAL A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 THR 280 280 ? ? ? A . n A 1 281 GLN 281 281 ? ? ? A . n A 1 282 ILE 282 282 ? ? ? A . n A 1 283 ILE 283 283 ? ? ? A . n A 1 284 THR 284 284 ? ? ? A . n A 1 285 THR 285 285 ? ? ? A . n A 1 286 THR 286 286 ? ? ? A . n A 1 287 THR 287 287 ? ? ? A . n A 1 288 SER 288 288 ? ? ? A . n A 1 289 SER 289 289 ? ? ? A . n A 1 290 THR 290 290 ? ? ? A . n A 1 291 SER 291 291 ? ? ? A . n A 1 292 GLU 292 292 ? ? ? A . n A 1 293 ASP 293 293 ? ? ? A . n A 1 294 GLU 294 294 ? ? ? A . n A 1 295 SER 295 295 ? ? ? A . n A 1 296 ASN 296 296 ? ? ? A . n A 1 297 THR 297 297 ? ? ? A . n A 1 298 ASP 298 298 ? ? ? A . n A 1 299 ASP 299 299 ? ? ? A . n A 1 300 THR 300 300 ? ? ? A . n A 1 301 SER 301 301 ? ? ? A . n A 1 302 SER 302 302 ? ? ? A . n A 1 303 ASN 303 303 ? ? ? A . n A 1 304 SER 304 304 ? ? ? A . n A 1 305 SER 305 305 ? ? ? A . n A 1 306 GLU 306 306 ? ? ? A . n A 1 307 GLY 307 307 ? ? ? A . n A 1 308 ASN 308 308 ? ? ? A . n A 1 309 GLU 309 309 ? ? ? A . n A 1 310 GLN 310 310 ? ? ? A . n A 1 311 GLU 311 311 ? ? ? A . n A 1 312 THR 312 312 ? ? ? A . n A 1 313 THR 313 313 ? ? ? A . n A 1 314 PRO 314 314 ? ? ? A . n A 1 315 THR 315 315 ? ? ? A . n A 1 316 THR 316 316 ? ? ? A . n A 1 317 THR 317 317 ? ? ? A . n A 1 318 GLU 318 318 ? ? ? A . n A 1 319 ASN 319 319 ? ? ? A . n A 1 320 THR 320 320 ? ? ? A . n A 1 321 GLU 321 321 ? ? ? A . n A 1 322 THR 322 322 322 THR THR A . n A 1 323 LYS 323 323 323 LYS LYS A . n A 1 324 GLU 324 324 324 GLU GLU A . n A 1 325 ASP 325 325 325 ASP ASP A . n A 1 326 PRO 326 326 326 PRO PRO A . n A 1 327 THR 327 327 327 THR THR A . n A 1 328 THR 328 328 328 THR THR A . n A 1 329 VAL 329 329 329 VAL VAL A . n A 1 330 THR 330 330 330 THR THR A . n A 1 331 ILE 331 331 331 ILE ILE A . n A 1 332 SER 332 332 332 SER SER A . n A 1 333 ASN 333 333 333 ASN ASN A . n A 1 334 VAL 334 334 334 VAL VAL A . n A 1 335 SER 335 335 335 SER SER A . n A 1 336 GLY 336 336 336 GLY GLY A . n A 1 337 GLY 337 337 337 GLY GLY A . n A 1 338 THR 338 338 338 THR THR A . n A 1 339 VAL 339 339 339 VAL VAL A . n A 1 340 VAL 340 340 340 VAL VAL A . n A 1 341 PHE 341 341 341 PHE PHE A . n A 1 342 ALA 342 342 342 ALA ALA A . n A 1 343 ASP 343 343 343 ASP ASP A . n A 1 344 ASP 344 344 344 ASP ASP A . n A 1 345 ASN 345 345 345 ASN ASN A . n A 1 346 SER 346 346 346 SER SER A . n A 1 347 VAL 347 347 347 VAL VAL A . n A 1 348 SER 348 348 348 SER SER A . n A 1 349 LYS 349 349 349 LYS LYS A . n A 1 350 THR 350 350 350 THR THR A . n A 1 351 ILE 351 351 351 ILE ILE A . n A 1 352 SER 352 352 352 SER SER A . n A 1 353 LYS 353 353 353 LYS LYS A . n A 1 354 ALA 354 354 354 ALA ALA A . n A 1 355 GLN 355 355 355 GLN GLN A . n A 1 356 SER 356 356 356 SER SER A . n A 1 357 LEU 357 357 357 LEU LEU A . n A 1 358 LYS 358 358 358 LYS LYS A . n A 1 359 ILE 359 359 359 ILE ILE A . n A 1 360 SER 360 360 360 SER SER A . n A 1 361 TYR 361 361 361 TYR TYR A . n A 1 362 THR 362 362 362 THR THR A . n A 1 363 PHE 363 363 363 PHE PHE A . n A 1 364 ASP 364 364 364 ASP ASP A . n A 1 365 SER 365 365 365 SER SER A . n A 1 366 LEU 366 366 366 LEU LEU A . n A 1 367 SER 367 367 367 SER SER A . n A 1 368 VAL 368 368 368 VAL VAL A . n A 1 369 GLY 369 369 369 GLY GLY A . n A 1 370 THR 370 370 370 THR THR A . n A 1 371 HIS 371 371 371 HIS HIS A . n A 1 372 THR 372 372 372 THR THR A . n A 1 373 ILE 373 373 373 ILE ILE A . n A 1 374 THR 374 374 374 THR THR A . n A 1 375 LEU 375 375 375 LEU LEU A . n A 1 376 ASP 376 376 376 ASP ASP A . n A 1 377 LEU 377 377 377 LEU LEU A . n A 1 378 ASN 378 378 378 ASN ASN A . n A 1 379 ILE 379 379 379 ILE ILE A . n A 1 380 GLY 380 380 380 GLY GLY A . n A 1 381 ASP 381 381 381 ASP ASP A . n A 1 382 ASN 382 382 382 ASN ASN A . n A 1 383 ARG 383 383 383 ARG ARG A . n A 1 384 ILE 384 384 384 ILE ILE A . n A 1 385 PRO 385 385 385 PRO PRO A . n A 1 386 MSE 386 386 386 MSE MSE A . n A 1 387 THR 387 387 387 THR THR A . n A 1 388 TYR 388 388 388 TYR TYR A . n A 1 389 THR 389 389 389 THR THR A . n A 1 390 ILE 390 390 390 ILE ILE A . n A 1 391 TYR 391 391 391 TYR TYR A . n A 1 392 VAL 392 392 392 VAL VAL A . n A 1 393 THR 393 393 393 THR THR A . n A 1 394 ASP 394 394 394 ASP ASP A . n A 1 395 THR 395 395 395 THR THR A . n A 1 396 ALA 396 396 396 ALA ALA A . n A 1 397 ASP 397 397 397 ASP ASP A . n A 1 398 ASP 398 398 398 ASP ASP A . n A 1 399 VAL 399 399 399 VAL VAL A . n A 1 400 SER 400 400 400 SER SER A . n A 1 401 LEU 401 401 401 LEU LEU A . n A 1 402 VAL 402 402 402 VAL VAL A . n A 1 403 LYS 403 403 403 LYS LYS A . n A 1 404 ASP 404 404 404 ASP ASP A . n A 1 405 ASP 405 405 405 ASP ASP A . n A 1 406 LEU 406 406 406 LEU LEU A . n A 1 407 LYS 407 407 407 LYS LYS A . n A 1 408 THR 408 408 408 THR THR A . n A 1 409 ILE 409 409 409 ILE ILE A . n A 1 410 PHE 410 410 410 PHE PHE A . n A 1 411 ALA 411 411 411 ALA ALA A . n A 1 412 GLN 412 412 412 GLN GLN A . n A 1 413 LEU 413 413 413 LEU LEU A . n A 1 414 SER 414 414 414 SER SER A . n A 1 415 LYS 415 415 415 LYS LYS A . n A 1 416 ILE 416 416 416 ILE ILE A . n A 1 417 ASP 417 417 417 ASP ASP A . n A 1 418 THR 418 418 418 THR THR A . n A 1 419 ALA 419 419 419 ALA ALA A . n A 1 420 SER 420 420 420 SER SER A . n A 1 421 ALA 421 421 421 ALA ALA A . n A 1 422 MSE 422 422 422 MSE MSE A . n A 1 423 ILE 423 423 423 ILE ILE A . n A 1 424 GLN 424 424 424 GLN GLN A . n A 1 425 THR 425 425 425 THR THR A . n A 1 426 LEU 426 426 426 LEU LEU A . n A 1 427 TYR 427 427 427 TYR TYR A . n A 1 428 GLY 428 428 428 GLY GLY A . n A 1 429 GLU 429 429 429 GLU GLU A . n A 1 430 PRO 430 430 430 PRO PRO A . n A 1 431 GLY 431 431 431 GLY GLY A . n A 1 432 GLN 432 432 432 GLN GLN A . n A 1 433 THR 433 433 433 THR THR A . n A 1 434 ASP 434 434 434 ASP ASP A . n A 1 435 LEU 435 435 435 LEU LEU A . n A 1 436 SER 436 436 436 SER SER A . n A 1 437 GLN 437 437 437 GLN GLN A . n A 1 438 ILE 438 438 438 ILE ILE A . n A 1 439 ASP 439 439 439 ASP ASP A . n A 1 440 ILE 440 440 440 ILE ILE A . n A 1 441 THR 441 441 441 THR THR A . n A 1 442 ASN 442 442 442 ASN ASN A . n A 1 443 PRO 443 443 443 PRO PRO A . n A 1 444 SER 444 444 444 SER SER A . n A 1 445 ALA 445 445 445 ALA ALA A . n A 1 446 ASN 446 446 446 ASN ASN A . n A 1 447 SER 447 447 447 SER SER A . n A 1 448 VAL 448 448 448 VAL VAL A . n A 1 449 ALA 449 449 449 ALA ALA A . n A 1 450 ASN 450 450 450 ASN ASN A . n A 1 451 MSE 451 451 451 MSE MSE A . n A 1 452 TYR 452 452 452 TYR TYR A . n A 1 453 GLY 453 453 453 GLY GLY A . n A 1 454 ASN 454 454 454 ASN ASN A . n A 1 455 LEU 455 455 455 LEU LEU A . n A 1 456 THR 456 456 456 THR THR A . n A 1 457 PHE 457 457 457 PHE PHE A . n A 1 458 ASP 458 458 458 ASP ASP A . n A 1 459 ASN 459 459 459 ASN ASN A . n A 1 460 ILE 460 460 460 ILE ILE A . n A 1 461 ASP 461 461 461 ASP ASP A . n A 1 462 GLY 462 462 462 GLY GLY A . n A 1 463 LEU 463 463 463 LEU LEU A . n A 1 464 ASP 464 464 464 ASP ASP A . n A 1 465 VAL 465 465 465 VAL VAL A . n A 1 466 THR 466 466 466 THR THR A . n A 1 467 ASN 467 467 467 ASN ASN A . n A 1 468 PHE 468 468 468 PHE PHE A . n A 1 469 LYS 469 469 469 LYS LYS A . n A 1 470 GLU 470 470 470 GLU GLU A . n A 1 471 SER 471 471 471 SER SER A . n A 1 472 GLY 472 472 472 GLY GLY A . n A 1 473 VAL 473 473 473 VAL VAL A . n A 1 474 THR 474 474 474 THR THR A . n A 1 475 LEU 475 475 475 LEU LEU A . n A 1 476 TYR 476 476 476 TYR TYR A . n A 1 477 THR 477 477 477 THR THR A . n A 1 478 GLU 478 478 478 GLU GLU A . n A 1 479 LEU 479 479 479 LEU LEU A . n A 1 480 THR 480 480 480 THR THR A . n A 1 481 ASN 481 481 481 ASN ASN A . n A 1 482 GLU 482 482 482 GLU GLU A . n A 1 483 ILE 483 483 483 ILE ILE A . n A 1 484 ILE 484 484 484 ILE ILE A . n A 1 485 GLU 485 485 485 GLU GLU A . n A 1 486 LEU 486 486 486 LEU LEU A . n A 1 487 GLN 487 487 487 GLN GLN A . n A 1 488 SER 488 488 488 SER SER A . n A 1 489 THR 489 489 489 THR THR A . n A 1 490 ILE 490 490 490 ILE ILE A . n A 1 491 ASP 491 491 491 ASP ASP A . n A 1 492 SER 492 492 492 SER SER A . n A 1 493 LEU 493 493 493 LEU LEU A . n A 1 494 PRO 494 494 494 PRO PRO A . n A 1 495 THR 495 495 ? ? ? A . n A 1 496 LEU 496 496 ? ? ? A . n A 1 497 PRO 497 497 ? ? ? A . n A 1 498 GLU 498 498 ? ? ? A . n A 1 499 GLY 499 499 ? ? ? A . n A 1 500 TYR 500 500 ? ? ? A . n A 1 501 MSE 501 501 ? ? ? A . n A 1 502 PRO 502 502 ? ? ? A . n A 1 503 THR 503 503 ? ? ? A . n A 1 504 ASP 504 504 ? ? ? A . n A 1 505 TYR 505 505 ? ? ? A . n A 1 506 PHE 506 506 ? ? ? A . n A 1 507 SER 507 507 ? ? ? A . n A 1 508 THR 508 508 ? ? ? A . n A 1 509 GLU 509 509 ? ? ? A . n A 1 510 LEU 510 510 ? ? ? A . n A 1 511 GLN 511 511 ? ? ? A . n A 1 512 SER 512 512 ? ? ? A . n A 1 513 LEU 513 513 ? ? ? A . n A 1 514 VAL 514 514 ? ? ? A . n A 1 515 ASN 515 515 ? ? ? A . n A 1 516 TRP 516 516 ? ? ? A . n A 1 517 TYR 517 517 ? ? ? A . n A 1 518 ASN 518 518 ? ? ? A . n A 1 519 THR 519 519 ? ? ? A . n A 1 520 THR 520 520 ? ? ? A . n A 1 521 SER 521 521 ? ? ? A . n A 1 522 GLN 522 522 ? ? ? A . n A 1 523 SER 523 523 ? ? ? A . n A 1 524 LEU 524 524 ? ? ? A . n A 1 525 ASN 525 525 ? ? ? A . n A 1 526 ASN 526 526 ? ? ? A . n A 1 527 GLU 527 527 ? ? ? A . n A 1 528 TYR 528 528 ? ? ? A . n A 1 529 ALA 529 529 ? ? ? A . n A 1 530 LYS 530 530 ? ? ? A . n A 1 531 TRP 531 531 ? ? ? A . n A 1 532 SER 532 532 ? ? ? A . n A 1 533 GLN 533 533 ? ? ? A . n A 1 534 ASN 534 534 ? ? ? A . n A 1 535 GLN 535 535 ? ? ? A . n A 1 536 ALA 536 536 ? ? ? A . n A 1 537 LYS 537 537 ? ? ? A . n A 1 538 GLU 538 538 ? ? ? A . n A 1 539 LEU 539 539 ? ? ? A . n A 1 540 ASN 540 540 ? ? ? A . n A 1 541 VAL 541 541 ? ? ? A . n A 1 542 GLY 542 542 ? ? ? A . n A 1 543 SER 543 543 ? ? ? A . n A 1 544 TYR 544 544 ? ? ? A . n A 1 545 GLY 545 545 ? ? ? A . n A 1 546 SER 546 546 ? ? ? A . n A 1 547 GLY 547 547 ? ? ? A . n A 1 548 THR 548 548 ? ? ? A . n A 1 549 SER 549 549 ? ? ? A . n A 1 550 ASP 550 550 ? ? ? A . n A 1 551 ASN 551 551 ? ? ? A . n A 1 552 SER 552 552 ? ? ? A . n A 1 553 THR 553 553 ? ? ? A . n A 1 554 LEU 554 554 ? ? ? A . n A 1 555 TYR 555 555 ? ? ? A . n A 1 556 THR 556 556 ? ? ? A . n A 1 557 ASP 557 557 ? ? ? A . n A 1 558 THR 558 558 ? ? ? A . n A 1 559 ALA 559 559 ? ? ? A . n A 1 560 SER 560 560 ? ? ? A . n A 1 561 GLY 561 561 ? ? ? A . n A 1 562 ASP 562 562 ? ? ? A . n A 1 563 ALA 563 563 ? ? ? A . n A 1 564 LEU 564 564 ? ? ? A . n A 1 565 TYR 565 565 ? ? ? A . n A 1 566 ASP 566 566 ? ? ? A . n A 1 567 GLY 567 567 ? ? ? A . n A 1 568 ILE 568 568 ? ? ? A . n A 1 569 SER 569 569 ? ? ? A . n A 1 570 GLU 570 570 ? ? ? A . n A 1 571 LEU 571 571 ? ? ? A . n A 1 572 VAL 572 572 ? ? ? A . n A 1 573 LYS 573 573 ? ? ? A . n A 1 574 SER 574 574 ? ? ? A . n A 1 575 THR 575 575 ? ? ? A . n A 1 576 ALA 576 576 ? ? ? A . n A 1 577 ASP 577 577 ? ? ? A . n A 1 578 SER 578 578 ? ? ? A . n A 1 579 ALA 579 579 ? ? ? A . n A 1 580 GLN 580 580 ? ? ? A . n A 1 581 SER 581 581 ? ? ? A . n A 1 582 THR 582 582 ? ? ? A . n A 1 583 THR 583 583 ? ? ? A . n A 1 584 SER 584 584 ? ? ? A . n A 1 585 ASN 585 585 ? ? ? A . n A 1 586 TYR 586 586 ? ? ? A . n A 1 587 GLU 587 587 ? ? ? A . n A 1 588 ALA 588 588 ? ? ? A . n A 1 589 ILE 589 589 ? ? ? A . n A 1 590 GLY 590 590 ? ? ? A . n A 1 591 THR 591 591 ? ? ? A . n A 1 592 MSE 592 592 ? ? ? A . n A 1 593 THR 593 593 ? ? ? A . n A 1 594 ASP 594 594 ? ? ? A . n A 1 595 ASP 595 595 ? ? ? A . n A 1 596 PHE 596 596 ? ? ? A . n A 1 597 LEU 597 597 ? ? ? A . n A 1 598 GLU 598 598 ? ? ? A . n A 1 599 HIS 599 599 ? ? ? A . n A 1 600 HIS 600 600 ? ? ? A . n A 1 601 HIS 601 601 ? ? ? A . n A 1 602 HIS 602 602 ? ? ? A . n A 1 603 HIS 603 603 ? ? ? A . n A 1 604 HIS 604 604 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 701 603 CL CL A . C 3 EDO 1 702 701 EDO EDO A . D 3 EDO 1 703 901 EDO EDO A . E 3 EDO 1 704 1101 EDO EDO A . F 3 EDO 1 705 1401 EDO EDO A . G 3 EDO 1 706 1601 EDO EDO A . H 3 EDO 1 707 1701 EDO EDO A . I 3 EDO 1 708 1801 EDO EDO A . J 3 EDO 1 709 1901 EDO EDO A . K 3 EDO 1 710 2001 EDO EDO A . L 3 EDO 1 711 2201 EDO EDO A . M 3 EDO 1 712 2301 EDO EDO A . N 3 EDO 1 713 2601 EDO EDO A . O 3 EDO 1 714 2701 EDO EDO A . P 3 EDO 1 715 3201 EDO EDO A . Q 3 EDO 1 716 3301 EDO EDO A . R 3 EDO 1 717 3401 EDO EDO A . S 3 EDO 1 718 3601 EDO EDO A . T 3 EDO 1 719 3801 EDO EDO A . U 3 EDO 1 720 3901 EDO EDO A . V 3 EDO 1 721 4001 EDO EDO A . W 3 EDO 1 722 4201 EDO EDO A . X 3 EDO 1 723 4701 EDO EDO A . Y 3 EDO 1 724 4901 EDO EDO A . Z 4 HOH 1 801 1 HOH HOH A . Z 4 HOH 2 802 17 HOH HOH A . Z 4 HOH 3 803 22 HOH HOH A . Z 4 HOH 4 804 2 HOH HOH A . Z 4 HOH 5 805 9 HOH HOH A . Z 4 HOH 6 806 13 HOH HOH A . Z 4 HOH 7 807 16 HOH HOH A . Z 4 HOH 8 808 12 HOH HOH A . Z 4 HOH 9 809 15 HOH HOH A . Z 4 HOH 10 810 21 HOH HOH A . Z 4 HOH 11 811 8 HOH HOH A . Z 4 HOH 12 812 4 HOH HOH A . Z 4 HOH 13 813 19 HOH HOH A . Z 4 HOH 14 814 14 HOH HOH A . Z 4 HOH 15 815 11 HOH HOH A . Z 4 HOH 16 816 23 HOH HOH A . Z 4 HOH 17 817 28 HOH HOH A . Z 4 HOH 18 818 27 HOH HOH A . Z 4 HOH 19 819 10 HOH HOH A . Z 4 HOH 20 820 18 HOH HOH A . Z 4 HOH 21 821 20 HOH HOH A . Z 4 HOH 22 822 3 HOH HOH A . Z 4 HOH 23 823 24 HOH HOH A . Z 4 HOH 24 824 6 HOH HOH A . Z 4 HOH 25 825 5 HOH HOH A . Z 4 HOH 26 826 7 HOH HOH A . Z 4 HOH 27 827 26 HOH HOH A . Z 4 HOH 28 828 25 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 200 A MSE 200 ? MET 'modified residue' 2 A MSE 220 A MSE 220 ? MET 'modified residue' 3 A MSE 223 A MSE 223 ? MET 'modified residue' 4 A MSE 386 A MSE 386 ? MET 'modified residue' 5 A MSE 422 A MSE 422 ? MET 'modified residue' 6 A MSE 451 A MSE 451 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 16450 ? 1 MORE 11 ? 1 'SSA (A^2)' 34310 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_756 -x+2,y,-z+3/2 -1.0000000000 0.0000000000 0.0000000000 148.9320000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 121.6425000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 827 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id Z _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-11 2 'Structure model' 1 1 2020-12-09 3 'Structure model' 1 2 2021-02-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.year' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 67.9913979929 -35.4756295537 64.2222538642 0.726428033893 ? -0.0206548055619 ? 0.07242231553 ? 0.372777665401 ? 0.0442943247261 ? 0.45436170014 ? 1.07161168423 ? 0.0502372068916 ? -0.0522233813386 ? 3.67010760528 ? 0.222523814356 ? 0.593554228465 ? -0.0958686069617 ? -0.0340118294119 ? -0.475897604346 ? 0.298709861269 ? -0.00216412404458 ? 0.358583684375 ? 0.19367066473 ? -0.0379628301974 ? 0.0149053611594 ? 2 'X-RAY DIFFRACTION' ? refined 68.4020817296 11.1722854701 62.0325605162 0.721384014485 ? 0.00562907857193 ? -0.0730826411037 ? 0.362648527764 ? -0.00359757669045 ? 0.347042164445 ? 0.846792940487 ? 0.0184267011852 ? -0.0982833593835 ? 3.84869073041 ? 0.0767203560158 ? 0.260031460167 ? -0.0762582597987 ? 0.000153177653096 ? 0.201886327745 ? -0.175943326132 ? 0.0594436097177 ? 0.433598985005 ? -0.0643108966828 ? -0.044733467042 ? 0.00625138809077 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 96 through 267 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 268 through 494 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? BUCCANEER ? ? ? . 6 # _pdbx_entry_details.entry_id 7JQE _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 97 ? ? -150.15 -22.13 2 1 ALA A 253 ? ? -177.98 140.27 3 1 LEU A 493 ? ? -161.30 100.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A GLY 15 ? A GLY 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A ASN 17 ? A ASN 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A GLU 19 ? A GLU 19 20 1 Y 1 A LEU 20 ? A LEU 20 21 1 Y 1 A PRO 21 ? A PRO 21 22 1 Y 1 A GLU 22 ? A GLU 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A LYS 24 ? A LYS 24 25 1 Y 1 A SER 25 ? A SER 25 26 1 Y 1 A PHE 26 ? A PHE 26 27 1 Y 1 A VAL 27 ? A VAL 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A LEU 29 ? A LEU 29 30 1 Y 1 A GLN 30 ? A GLN 30 31 1 Y 1 A GLN 31 ? A GLN 31 32 1 Y 1 A ASP 32 ? A ASP 32 33 1 Y 1 A ILE 33 ? A ILE 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A LYS 35 ? A LYS 35 36 1 Y 1 A THR 36 ? A THR 36 37 1 Y 1 A ASN 37 ? A ASN 37 38 1 Y 1 A VAL 38 ? A VAL 38 39 1 Y 1 A ALA 39 ? A ALA 39 40 1 Y 1 A THR 40 ? A THR 40 41 1 Y 1 A ALA 41 ? A ALA 41 42 1 Y 1 A ASN 42 ? A ASN 42 43 1 Y 1 A THR 43 ? A THR 43 44 1 Y 1 A ALA 44 ? A ALA 44 45 1 Y 1 A ILE 45 ? A ILE 45 46 1 Y 1 A SER 46 ? A SER 46 47 1 Y 1 A ASP 47 ? A ASP 47 48 1 Y 1 A GLN 48 ? A GLN 48 49 1 Y 1 A TYR 49 ? A TYR 49 50 1 Y 1 A GLN 50 ? A GLN 50 51 1 Y 1 A THR 51 ? A THR 51 52 1 Y 1 A ASP 52 ? A ASP 52 53 1 Y 1 A THR 53 ? A THR 53 54 1 Y 1 A GLU 54 ? A GLU 54 55 1 Y 1 A LEU 55 ? A LEU 55 56 1 Y 1 A TYR 56 ? A TYR 56 57 1 Y 1 A ASP 57 ? A ASP 57 58 1 Y 1 A ALA 58 ? A ALA 58 59 1 Y 1 A LEU 59 ? A LEU 59 60 1 Y 1 A ASN 60 ? A ASN 60 61 1 Y 1 A SER 61 ? A SER 61 62 1 Y 1 A ASN 62 ? A ASN 62 63 1 Y 1 A ILE 63 ? A ILE 63 64 1 Y 1 A LEU 64 ? A LEU 64 65 1 Y 1 A SER 65 ? A SER 65 66 1 Y 1 A SER 66 ? A SER 66 67 1 Y 1 A LEU 67 ? A LEU 67 68 1 Y 1 A SER 68 ? A SER 68 69 1 Y 1 A SER 69 ? A SER 69 70 1 Y 1 A PHE 70 ? A PHE 70 71 1 Y 1 A TYR 71 ? A TYR 71 72 1 Y 1 A THR 72 ? A THR 72 73 1 Y 1 A SER 73 ? A SER 73 74 1 Y 1 A THR 74 ? A THR 74 75 1 Y 1 A SER 75 ? A SER 75 76 1 Y 1 A ASP 76 ? A ASP 76 77 1 Y 1 A ILE 77 ? A ILE 77 78 1 Y 1 A THR 78 ? A THR 78 79 1 Y 1 A THR 79 ? A THR 79 80 1 Y 1 A GLU 80 ? A GLU 80 81 1 Y 1 A SER 81 ? A SER 81 82 1 Y 1 A THR 82 ? A THR 82 83 1 Y 1 A SER 83 ? A SER 83 84 1 Y 1 A ASN 84 ? A ASN 84 85 1 Y 1 A GLY 85 ? A GLY 85 86 1 Y 1 A THR 86 ? A THR 86 87 1 Y 1 A VAL 87 ? A VAL 87 88 1 Y 1 A TYR 88 ? A TYR 88 89 1 Y 1 A LYS 89 ? A LYS 89 90 1 Y 1 A LEU 90 ? A LEU 90 91 1 Y 1 A PHE 91 ? A PHE 91 92 1 Y 1 A GLU 92 ? A GLU 92 93 1 Y 1 A ASN 93 ? A ASN 93 94 1 Y 1 A GLN 94 ? A GLN 94 95 1 Y 1 A ILE 95 ? A ILE 95 96 1 Y 1 A THR 280 ? A THR 280 97 1 Y 1 A GLN 281 ? A GLN 281 98 1 Y 1 A ILE 282 ? A ILE 282 99 1 Y 1 A ILE 283 ? A ILE 283 100 1 Y 1 A THR 284 ? A THR 284 101 1 Y 1 A THR 285 ? A THR 285 102 1 Y 1 A THR 286 ? A THR 286 103 1 Y 1 A THR 287 ? A THR 287 104 1 Y 1 A SER 288 ? A SER 288 105 1 Y 1 A SER 289 ? A SER 289 106 1 Y 1 A THR 290 ? A THR 290 107 1 Y 1 A SER 291 ? A SER 291 108 1 Y 1 A GLU 292 ? A GLU 292 109 1 Y 1 A ASP 293 ? A ASP 293 110 1 Y 1 A GLU 294 ? A GLU 294 111 1 Y 1 A SER 295 ? A SER 295 112 1 Y 1 A ASN 296 ? A ASN 296 113 1 Y 1 A THR 297 ? A THR 297 114 1 Y 1 A ASP 298 ? A ASP 298 115 1 Y 1 A ASP 299 ? A ASP 299 116 1 Y 1 A THR 300 ? A THR 300 117 1 Y 1 A SER 301 ? A SER 301 118 1 Y 1 A SER 302 ? A SER 302 119 1 Y 1 A ASN 303 ? A ASN 303 120 1 Y 1 A SER 304 ? A SER 304 121 1 Y 1 A SER 305 ? A SER 305 122 1 Y 1 A GLU 306 ? A GLU 306 123 1 Y 1 A GLY 307 ? A GLY 307 124 1 Y 1 A ASN 308 ? A ASN 308 125 1 Y 1 A GLU 309 ? A GLU 309 126 1 Y 1 A GLN 310 ? A GLN 310 127 1 Y 1 A GLU 311 ? A GLU 311 128 1 Y 1 A THR 312 ? A THR 312 129 1 Y 1 A THR 313 ? A THR 313 130 1 Y 1 A PRO 314 ? A PRO 314 131 1 Y 1 A THR 315 ? A THR 315 132 1 Y 1 A THR 316 ? A THR 316 133 1 Y 1 A THR 317 ? A THR 317 134 1 Y 1 A GLU 318 ? A GLU 318 135 1 Y 1 A ASN 319 ? A ASN 319 136 1 Y 1 A THR 320 ? A THR 320 137 1 Y 1 A GLU 321 ? A GLU 321 138 1 Y 1 A THR 495 ? A THR 495 139 1 Y 1 A LEU 496 ? A LEU 496 140 1 Y 1 A PRO 497 ? A PRO 497 141 1 Y 1 A GLU 498 ? A GLU 498 142 1 Y 1 A GLY 499 ? A GLY 499 143 1 Y 1 A TYR 500 ? A TYR 500 144 1 Y 1 A MSE 501 ? A MSE 501 145 1 Y 1 A PRO 502 ? A PRO 502 146 1 Y 1 A THR 503 ? A THR 503 147 1 Y 1 A ASP 504 ? A ASP 504 148 1 Y 1 A TYR 505 ? A TYR 505 149 1 Y 1 A PHE 506 ? A PHE 506 150 1 Y 1 A SER 507 ? A SER 507 151 1 Y 1 A THR 508 ? A THR 508 152 1 Y 1 A GLU 509 ? A GLU 509 153 1 Y 1 A LEU 510 ? A LEU 510 154 1 Y 1 A GLN 511 ? A GLN 511 155 1 Y 1 A SER 512 ? A SER 512 156 1 Y 1 A LEU 513 ? A LEU 513 157 1 Y 1 A VAL 514 ? A VAL 514 158 1 Y 1 A ASN 515 ? A ASN 515 159 1 Y 1 A TRP 516 ? A TRP 516 160 1 Y 1 A TYR 517 ? A TYR 517 161 1 Y 1 A ASN 518 ? A ASN 518 162 1 Y 1 A THR 519 ? A THR 519 163 1 Y 1 A THR 520 ? A THR 520 164 1 Y 1 A SER 521 ? A SER 521 165 1 Y 1 A GLN 522 ? A GLN 522 166 1 Y 1 A SER 523 ? A SER 523 167 1 Y 1 A LEU 524 ? A LEU 524 168 1 Y 1 A ASN 525 ? A ASN 525 169 1 Y 1 A ASN 526 ? A ASN 526 170 1 Y 1 A GLU 527 ? A GLU 527 171 1 Y 1 A TYR 528 ? A TYR 528 172 1 Y 1 A ALA 529 ? A ALA 529 173 1 Y 1 A LYS 530 ? A LYS 530 174 1 Y 1 A TRP 531 ? A TRP 531 175 1 Y 1 A SER 532 ? A SER 532 176 1 Y 1 A GLN 533 ? A GLN 533 177 1 Y 1 A ASN 534 ? A ASN 534 178 1 Y 1 A GLN 535 ? A GLN 535 179 1 Y 1 A ALA 536 ? A ALA 536 180 1 Y 1 A LYS 537 ? A LYS 537 181 1 Y 1 A GLU 538 ? A GLU 538 182 1 Y 1 A LEU 539 ? A LEU 539 183 1 Y 1 A ASN 540 ? A ASN 540 184 1 Y 1 A VAL 541 ? A VAL 541 185 1 Y 1 A GLY 542 ? A GLY 542 186 1 Y 1 A SER 543 ? A SER 543 187 1 Y 1 A TYR 544 ? A TYR 544 188 1 Y 1 A GLY 545 ? A GLY 545 189 1 Y 1 A SER 546 ? A SER 546 190 1 Y 1 A GLY 547 ? A GLY 547 191 1 Y 1 A THR 548 ? A THR 548 192 1 Y 1 A SER 549 ? A SER 549 193 1 Y 1 A ASP 550 ? A ASP 550 194 1 Y 1 A ASN 551 ? A ASN 551 195 1 Y 1 A SER 552 ? A SER 552 196 1 Y 1 A THR 553 ? A THR 553 197 1 Y 1 A LEU 554 ? A LEU 554 198 1 Y 1 A TYR 555 ? A TYR 555 199 1 Y 1 A THR 556 ? A THR 556 200 1 Y 1 A ASP 557 ? A ASP 557 201 1 Y 1 A THR 558 ? A THR 558 202 1 Y 1 A ALA 559 ? A ALA 559 203 1 Y 1 A SER 560 ? A SER 560 204 1 Y 1 A GLY 561 ? A GLY 561 205 1 Y 1 A ASP 562 ? A ASP 562 206 1 Y 1 A ALA 563 ? A ALA 563 207 1 Y 1 A LEU 564 ? A LEU 564 208 1 Y 1 A TYR 565 ? A TYR 565 209 1 Y 1 A ASP 566 ? A ASP 566 210 1 Y 1 A GLY 567 ? A GLY 567 211 1 Y 1 A ILE 568 ? A ILE 568 212 1 Y 1 A SER 569 ? A SER 569 213 1 Y 1 A GLU 570 ? A GLU 570 214 1 Y 1 A LEU 571 ? A LEU 571 215 1 Y 1 A VAL 572 ? A VAL 572 216 1 Y 1 A LYS 573 ? A LYS 573 217 1 Y 1 A SER 574 ? A SER 574 218 1 Y 1 A THR 575 ? A THR 575 219 1 Y 1 A ALA 576 ? A ALA 576 220 1 Y 1 A ASP 577 ? A ASP 577 221 1 Y 1 A SER 578 ? A SER 578 222 1 Y 1 A ALA 579 ? A ALA 579 223 1 Y 1 A GLN 580 ? A GLN 580 224 1 Y 1 A SER 581 ? A SER 581 225 1 Y 1 A THR 582 ? A THR 582 226 1 Y 1 A THR 583 ? A THR 583 227 1 Y 1 A SER 584 ? A SER 584 228 1 Y 1 A ASN 585 ? A ASN 585 229 1 Y 1 A TYR 586 ? A TYR 586 230 1 Y 1 A GLU 587 ? A GLU 587 231 1 Y 1 A ALA 588 ? A ALA 588 232 1 Y 1 A ILE 589 ? A ILE 589 233 1 Y 1 A GLY 590 ? A GLY 590 234 1 Y 1 A THR 591 ? A THR 591 235 1 Y 1 A MSE 592 ? A MSE 592 236 1 Y 1 A THR 593 ? A THR 593 237 1 Y 1 A ASP 594 ? A ASP 594 238 1 Y 1 A ASP 595 ? A ASP 595 239 1 Y 1 A PHE 596 ? A PHE 596 240 1 Y 1 A LEU 597 ? A LEU 597 241 1 Y 1 A GLU 598 ? A GLU 598 242 1 Y 1 A HIS 599 ? A HIS 599 243 1 Y 1 A HIS 600 ? A HIS 600 244 1 Y 1 A HIS 601 ? A HIS 601 245 1 Y 1 A HIS 602 ? A HIS 602 246 1 Y 1 A HIS 603 ? A HIS 603 247 1 Y 1 A HIS 604 ? A HIS 604 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 1,2-ETHANEDIOL EDO 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support cross-linking _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 #