data_7KUA # _entry.id 7KUA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7KUA pdb_00007kua 10.2210/pdb7kua/pdb WWPDB D_1000253168 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7KUA _pdbx_database_status.recvd_initial_deposition_date 2020-11-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Walton, W.G.' 1 0000-0001-6745-534X 'Lietzan, A.D.' 2 0000-0001-6388-2491 'Redinbo, M.R.' 3 0000-0003-0814-5346 'Dangl, J.L.' 4 0000-0003-3199-8654 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2058-5276 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 1817 _citation.page_last 1833 _citation.title 'Diverse MarR bacterial regulators of auxin catabolism in the plant microbiome.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41564-022-01244-3 _citation.pdbx_database_id_PubMed 36266335 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Conway, J.M.' 1 0000-0002-2715-2149 primary 'Walton, W.G.' 2 ? primary 'Salas-Gonzalez, I.' 3 0000-0002-0347-5058 primary 'Law, T.F.' 4 ? primary 'Lindberg, C.A.' 5 ? primary 'Crook, L.E.' 6 ? primary 'Kosina, S.M.' 7 0000-0003-2885-1248 primary 'Fitzpatrick, C.R.' 8 ? primary 'Lietzan, A.D.' 9 0000-0001-6388-2491 primary 'Northen, T.R.' 10 0000-0001-8404-3259 primary 'Jones, C.D.' 11 ? primary 'Finkel, O.M.' 12 0000-0003-4770-0402 primary 'Redinbo, M.R.' 13 0000-0003-0814-5346 primary 'Dangl, J.L.' 14 0000-0003-3199-8654 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7KUA _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.557 _cell.length_a_esd ? _cell.length_b 57.557 _cell.length_b_esd ? _cell.length_c 91.384 _cell.length_c_esd ? _cell.volume 262178.512 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7KUA _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator, MarR family' 22120.930 1 ? ? ? ? 2 non-polymer syn '1H-INDOL-3-YLACETIC ACID' 175.184 1 ? ? ? ? 3 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IacR protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSNAMSNAKNTSAASPARKGHSHHDPASDEFRKEDFPFYWLARVHGRYTQNMERLLKKID LDVPRWRVLWILNENGESSISEISTHAIAKLSTITKIVYRMKEDGLVDTAPSPEDGRVTQVRITEVGLQNIERMQEVTRE LFQRSFKGLTEAQVQRLNRMLEVVFHNLETL ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSNAMSNAKNTSAASPARKGHSHHDPASDEFRKEDFPFYWLARVHGRYTQNMERLLKKID LDVPRWRVLWILNENGESSISEISTHAIAKLSTITKIVYRMKEDGLVDTAPSPEDGRVTQVRITEVGLQNIERMQEVTRE LFQRSFKGLTEAQVQRLNRMLEVVFHNLETL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 ASN n 1 24 ALA n 1 25 MET n 1 26 SER n 1 27 ASN n 1 28 ALA n 1 29 LYS n 1 30 ASN n 1 31 THR n 1 32 SER n 1 33 ALA n 1 34 ALA n 1 35 SER n 1 36 PRO n 1 37 ALA n 1 38 ARG n 1 39 LYS n 1 40 GLY n 1 41 HIS n 1 42 SER n 1 43 HIS n 1 44 HIS n 1 45 ASP n 1 46 PRO n 1 47 ALA n 1 48 SER n 1 49 ASP n 1 50 GLU n 1 51 PHE n 1 52 ARG n 1 53 LYS n 1 54 GLU n 1 55 ASP n 1 56 PHE n 1 57 PRO n 1 58 PHE n 1 59 TYR n 1 60 TRP n 1 61 LEU n 1 62 ALA n 1 63 ARG n 1 64 VAL n 1 65 HIS n 1 66 GLY n 1 67 ARG n 1 68 TYR n 1 69 THR n 1 70 GLN n 1 71 ASN n 1 72 MET n 1 73 GLU n 1 74 ARG n 1 75 LEU n 1 76 LEU n 1 77 LYS n 1 78 LYS n 1 79 ILE n 1 80 ASP n 1 81 LEU n 1 82 ASP n 1 83 VAL n 1 84 PRO n 1 85 ARG n 1 86 TRP n 1 87 ARG n 1 88 VAL n 1 89 LEU n 1 90 TRP n 1 91 ILE n 1 92 LEU n 1 93 ASN n 1 94 GLU n 1 95 ASN n 1 96 GLY n 1 97 GLU n 1 98 SER n 1 99 SER n 1 100 ILE n 1 101 SER n 1 102 GLU n 1 103 ILE n 1 104 SER n 1 105 THR n 1 106 HIS n 1 107 ALA n 1 108 ILE n 1 109 ALA n 1 110 LYS n 1 111 LEU n 1 112 SER n 1 113 THR n 1 114 ILE n 1 115 THR n 1 116 LYS n 1 117 ILE n 1 118 VAL n 1 119 TYR n 1 120 ARG n 1 121 MET n 1 122 LYS n 1 123 GLU n 1 124 ASP n 1 125 GLY n 1 126 LEU n 1 127 VAL n 1 128 ASP n 1 129 THR n 1 130 ALA n 1 131 PRO n 1 132 SER n 1 133 PRO n 1 134 GLU n 1 135 ASP n 1 136 GLY n 1 137 ARG n 1 138 VAL n 1 139 THR n 1 140 GLN n 1 141 VAL n 1 142 ARG n 1 143 ILE n 1 144 THR n 1 145 GLU n 1 146 VAL n 1 147 GLY n 1 148 LEU n 1 149 GLN n 1 150 ASN n 1 151 ILE n 1 152 GLU n 1 153 ARG n 1 154 MET n 1 155 GLN n 1 156 GLU n 1 157 VAL n 1 158 THR n 1 159 ARG n 1 160 GLU n 1 161 LEU n 1 162 PHE n 1 163 GLN n 1 164 ARG n 1 165 SER n 1 166 PHE n 1 167 LYS n 1 168 GLY n 1 169 LEU n 1 170 THR n 1 171 GLU n 1 172 ALA n 1 173 GLN n 1 174 VAL n 1 175 GLN n 1 176 ARG n 1 177 LEU n 1 178 ASN n 1 179 ARG n 1 180 MET n 1 181 LEU n 1 182 GLU n 1 183 VAL n 1 184 VAL n 1 185 PHE n 1 186 HIS n 1 187 ASN n 1 188 LEU n 1 189 GLU n 1 190 THR n 1 191 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 191 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'iacR, E6B08_12615' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas putida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B0FXI7_PSEPU _struct_ref.pdbx_db_accession B0FXI7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSNAKNTSAASPARKGHSHHDPASDEFRKEDFPFYWLARVHGRYTQNMERLLKKIDLDVPRWRVLWILNENGESSISEIS THAIAKLSTITKIVYRMKEDGLVDTAPSPEDGRVTQVRITEVGLQNIERMQEVTRELFQRSFKGLTEAQVQRLNRMLEVV FHNLETL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7KUA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 25 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 191 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B0FXI7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 167 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 167 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7KUA MET A 1 ? UNP B0FXI7 ? ? 'initiating methionine' -23 1 1 7KUA HIS A 2 ? UNP B0FXI7 ? ? 'expression tag' -22 2 1 7KUA HIS A 3 ? UNP B0FXI7 ? ? 'expression tag' -21 3 1 7KUA HIS A 4 ? UNP B0FXI7 ? ? 'expression tag' -20 4 1 7KUA HIS A 5 ? UNP B0FXI7 ? ? 'expression tag' -19 5 1 7KUA HIS A 6 ? UNP B0FXI7 ? ? 'expression tag' -18 6 1 7KUA HIS A 7 ? UNP B0FXI7 ? ? 'expression tag' -17 7 1 7KUA SER A 8 ? UNP B0FXI7 ? ? 'expression tag' -16 8 1 7KUA SER A 9 ? UNP B0FXI7 ? ? 'expression tag' -15 9 1 7KUA GLY A 10 ? UNP B0FXI7 ? ? 'expression tag' -14 10 1 7KUA VAL A 11 ? UNP B0FXI7 ? ? 'expression tag' -13 11 1 7KUA ASP A 12 ? UNP B0FXI7 ? ? 'expression tag' -12 12 1 7KUA LEU A 13 ? UNP B0FXI7 ? ? 'expression tag' -11 13 1 7KUA GLY A 14 ? UNP B0FXI7 ? ? 'expression tag' -10 14 1 7KUA THR A 15 ? UNP B0FXI7 ? ? 'expression tag' -9 15 1 7KUA GLU A 16 ? UNP B0FXI7 ? ? 'expression tag' -8 16 1 7KUA ASN A 17 ? UNP B0FXI7 ? ? 'expression tag' -7 17 1 7KUA LEU A 18 ? UNP B0FXI7 ? ? 'expression tag' -6 18 1 7KUA TYR A 19 ? UNP B0FXI7 ? ? 'expression tag' -5 19 1 7KUA PHE A 20 ? UNP B0FXI7 ? ? 'expression tag' -4 20 1 7KUA GLN A 21 ? UNP B0FXI7 ? ? 'expression tag' -3 21 1 7KUA SER A 22 ? UNP B0FXI7 ? ? 'expression tag' -2 22 1 7KUA ASN A 23 ? UNP B0FXI7 ? ? 'expression tag' -1 23 1 7KUA ALA A 24 ? UNP B0FXI7 ? ? 'expression tag' 0 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IAC non-polymer . '1H-INDOL-3-YLACETIC ACID' 'INDOLE ACETIC ACID' 'C10 H9 N O2' 175.184 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7KUA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Anatrace MCSG2 screen 35 % (v/v) Microlytic Mix(1), pH 7.0, which consists of: 1.8305 M Malonic acid, 0.25 M Ammonium citrate tribasic, 0.12 M Succinic acid, 0.3 M DL-Malic acid, 0.4 M Sodium acetate trihydrate, 0.5 M Sodium formate, 0.16 M Ammonium tartrate dibasic, the mixture titrated to pH 7.0 using sodium hydroxide ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03322 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03322 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 29.48 _reflns.entry_id 7KUA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.88 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14591 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 33.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.88 _reflns_shell.d_res_low 1.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 715 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.957 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 39.08 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7KUA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.89 _refine.ls_d_res_low 25.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14518 _refine.ls_number_reflns_R_free 1460 _refine.ls_number_reflns_R_work 13058 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.15 _refine.ls_percent_reflns_R_free 10.06 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1823 _refine.ls_R_factor_R_free 0.2158 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1785 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3CJN _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.0325 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2014 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.89 _refine_hist.d_res_low 25.99 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1308 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1237 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0096 ? 1312 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9179 ? 1778 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.3684 ? 193 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0052 ? 233 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 23.1363 ? 504 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.89 1.95 . . 134 1211 93.08 . . . 0.3369 . 0.2829 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.95 2.03 . . 145 1282 99.72 . . . 0.2675 . 0.2235 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.03 2.12 . . 140 1306 99.59 . . . 0.2570 . 0.2027 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.12 2.24 . . 144 1273 99.72 . . . 0.2623 . 0.1860 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.24 2.38 . . 147 1307 99.86 . . . 0.2237 . 0.1904 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.38 2.56 . . 145 1296 99.86 . . . 0.2139 . 0.1837 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.56 2.82 . . 146 1316 99.93 . . . 0.2510 . 0.1884 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.82 3.22 . . 147 1320 99.93 . . . 0.2338 . 0.1839 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.22 4.06 . . 152 1335 99.93 . . . 0.1689 . 0.1626 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.06 25.99 . . 160 1412 99.87 . . . 0.2020 . 0.1614 . . . . . . . . . . . # _struct.entry_id 7KUA _struct.title 'Crystal structure of the MarR family transcriptional regulator from Pseudomonas putida bound to Indole 3 acetic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7KUA _struct_keywords.text 'Transcriptional Regulator, Ligand Binding, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 52 ? ASP A 55 ? ARG A 28 ASP A 31 5 ? 4 HELX_P HELX_P2 AA2 PHE A 56 ? LYS A 78 ? PHE A 32 LYS A 54 1 ? 23 HELX_P HELX_P3 AA3 ASP A 82 ? GLY A 96 ? ASP A 58 GLY A 72 1 ? 15 HELX_P HELX_P4 AA4 ILE A 100 ? ILE A 108 ? ILE A 76 ILE A 84 1 ? 9 HELX_P HELX_P5 AA5 LYS A 110 ? ASP A 124 ? LYS A 86 ASP A 100 1 ? 15 HELX_P HELX_P6 AA6 THR A 144 ? THR A 158 ? THR A 120 THR A 134 1 ? 15 HELX_P HELX_P7 AA7 THR A 158 ? PHE A 166 ? THR A 134 PHE A 142 1 ? 9 HELX_P HELX_P8 AA8 THR A 170 ? GLU A 189 ? THR A 146 GLU A 165 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 98 ? SER A 99 ? SER A 74 SER A 75 AA1 2 THR A 139 ? ILE A 143 ? THR A 115 ILE A 119 AA1 3 VAL A 127 ? PRO A 131 ? VAL A 103 PRO A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 98 ? N SER A 74 O VAL A 141 ? O VAL A 117 AA1 2 3 O GLN A 140 ? O GLN A 116 N ALA A 130 ? N ALA A 106 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id IAC _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue IAC A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 PHE A 56 ? PHE A 32 . ? 4_555 ? 2 AC1 9 PHE A 58 ? PHE A 34 . ? 4_555 ? 3 AC1 9 TYR A 59 ? TYR A 35 . ? 4_555 ? 4 AC1 9 TYR A 68 ? TYR A 44 . ? 1_555 ? 5 AC1 9 TRP A 86 ? TRP A 62 . ? 1_555 ? 6 AC1 9 ARG A 87 ? ARG A 63 . ? 1_555 ? 7 AC1 9 TRP A 90 ? TRP A 66 . ? 1_555 ? 8 AC1 9 HIS A 106 ? HIS A 82 . ? 1_555 ? 9 AC1 9 ILE A 108 ? ILE A 84 . ? 1_555 ? # _atom_sites.entry_id 7KUA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017374 _atom_sites.fract_transf_matrix[1][2] 0.010031 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020062 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010943 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -23 ? ? ? A . n A 1 2 HIS 2 -22 ? ? ? A . n A 1 3 HIS 3 -21 ? ? ? A . n A 1 4 HIS 4 -20 ? ? ? A . n A 1 5 HIS 5 -19 ? ? ? A . n A 1 6 HIS 6 -18 ? ? ? A . n A 1 7 HIS 7 -17 ? ? ? A . n A 1 8 SER 8 -16 ? ? ? A . n A 1 9 SER 9 -15 ? ? ? A . n A 1 10 GLY 10 -14 ? ? ? A . n A 1 11 VAL 11 -13 ? ? ? A . n A 1 12 ASP 12 -12 ? ? ? A . n A 1 13 LEU 13 -11 ? ? ? A . n A 1 14 GLY 14 -10 ? ? ? A . n A 1 15 THR 15 -9 ? ? ? A . n A 1 16 GLU 16 -8 ? ? ? A . n A 1 17 ASN 17 -7 ? ? ? A . n A 1 18 LEU 18 -6 ? ? ? A . n A 1 19 TYR 19 -5 ? ? ? A . n A 1 20 PHE 20 -4 ? ? ? A . n A 1 21 GLN 21 -3 ? ? ? A . n A 1 22 SER 22 -2 ? ? ? A . n A 1 23 ASN 23 -1 ? ? ? A . n A 1 24 ALA 24 0 ? ? ? A . n A 1 25 MET 25 1 ? ? ? A . n A 1 26 SER 26 2 ? ? ? A . n A 1 27 ASN 27 3 ? ? ? A . n A 1 28 ALA 28 4 ? ? ? A . n A 1 29 LYS 29 5 ? ? ? A . n A 1 30 ASN 30 6 ? ? ? A . n A 1 31 THR 31 7 ? ? ? A . n A 1 32 SER 32 8 ? ? ? A . n A 1 33 ALA 33 9 ? ? ? A . n A 1 34 ALA 34 10 ? ? ? A . n A 1 35 SER 35 11 ? ? ? A . n A 1 36 PRO 36 12 ? ? ? A . n A 1 37 ALA 37 13 ? ? ? A . n A 1 38 ARG 38 14 ? ? ? A . n A 1 39 LYS 39 15 ? ? ? A . n A 1 40 GLY 40 16 ? ? ? A . n A 1 41 HIS 41 17 ? ? ? A . n A 1 42 SER 42 18 ? ? ? A . n A 1 43 HIS 43 19 19 HIS HIS A . n A 1 44 HIS 44 20 20 HIS HIS A . n A 1 45 ASP 45 21 21 ASP ASP A . n A 1 46 PRO 46 22 22 PRO PRO A . n A 1 47 ALA 47 23 23 ALA ALA A . n A 1 48 SER 48 24 24 SER SER A . n A 1 49 ASP 49 25 25 ASP ASP A . n A 1 50 GLU 50 26 26 GLU GLU A . n A 1 51 PHE 51 27 27 PHE PHE A . n A 1 52 ARG 52 28 28 ARG ARG A . n A 1 53 LYS 53 29 29 LYS LYS A . n A 1 54 GLU 54 30 30 GLU GLU A . n A 1 55 ASP 55 31 31 ASP ASP A . n A 1 56 PHE 56 32 32 PHE PHE A . n A 1 57 PRO 57 33 33 PRO PRO A . n A 1 58 PHE 58 34 34 PHE PHE A . n A 1 59 TYR 59 35 35 TYR TYR A . n A 1 60 TRP 60 36 36 TRP TRP A . n A 1 61 LEU 61 37 37 LEU LEU A . n A 1 62 ALA 62 38 38 ALA ALA A . n A 1 63 ARG 63 39 39 ARG ARG A . n A 1 64 VAL 64 40 40 VAL VAL A . n A 1 65 HIS 65 41 41 HIS HIS A . n A 1 66 GLY 66 42 42 GLY GLY A . n A 1 67 ARG 67 43 43 ARG ARG A . n A 1 68 TYR 68 44 44 TYR TYR A . n A 1 69 THR 69 45 45 THR THR A . n A 1 70 GLN 70 46 46 GLN GLN A . n A 1 71 ASN 71 47 47 ASN ASN A . n A 1 72 MET 72 48 48 MET MET A . n A 1 73 GLU 73 49 49 GLU GLU A . n A 1 74 ARG 74 50 50 ARG ARG A . n A 1 75 LEU 75 51 51 LEU LEU A . n A 1 76 LEU 76 52 52 LEU LEU A . n A 1 77 LYS 77 53 53 LYS LYS A . n A 1 78 LYS 78 54 54 LYS LYS A . n A 1 79 ILE 79 55 55 ILE ILE A . n A 1 80 ASP 80 56 56 ASP ASP A . n A 1 81 LEU 81 57 57 LEU LEU A . n A 1 82 ASP 82 58 58 ASP ASP A . n A 1 83 VAL 83 59 59 VAL VAL A . n A 1 84 PRO 84 60 60 PRO PRO A . n A 1 85 ARG 85 61 61 ARG ARG A . n A 1 86 TRP 86 62 62 TRP TRP A . n A 1 87 ARG 87 63 63 ARG ARG A . n A 1 88 VAL 88 64 64 VAL VAL A . n A 1 89 LEU 89 65 65 LEU LEU A . n A 1 90 TRP 90 66 66 TRP TRP A . n A 1 91 ILE 91 67 67 ILE ILE A . n A 1 92 LEU 92 68 68 LEU LEU A . n A 1 93 ASN 93 69 69 ASN ASN A . n A 1 94 GLU 94 70 70 GLU GLU A . n A 1 95 ASN 95 71 71 ASN ASN A . n A 1 96 GLY 96 72 72 GLY GLY A . n A 1 97 GLU 97 73 73 GLU GLU A . n A 1 98 SER 98 74 74 SER SER A . n A 1 99 SER 99 75 75 SER SER A . n A 1 100 ILE 100 76 76 ILE ILE A . n A 1 101 SER 101 77 77 SER SER A . n A 1 102 GLU 102 78 78 GLU GLU A . n A 1 103 ILE 103 79 79 ILE ILE A . n A 1 104 SER 104 80 80 SER SER A . n A 1 105 THR 105 81 81 THR THR A . n A 1 106 HIS 106 82 82 HIS HIS A . n A 1 107 ALA 107 83 83 ALA ALA A . n A 1 108 ILE 108 84 84 ILE ILE A . n A 1 109 ALA 109 85 85 ALA ALA A . n A 1 110 LYS 110 86 86 LYS LYS A . n A 1 111 LEU 111 87 87 LEU LEU A . n A 1 112 SER 112 88 88 SER SER A . n A 1 113 THR 113 89 89 THR THR A . n A 1 114 ILE 114 90 90 ILE ILE A . n A 1 115 THR 115 91 91 THR THR A . n A 1 116 LYS 116 92 92 LYS LYS A . n A 1 117 ILE 117 93 93 ILE ILE A . n A 1 118 VAL 118 94 94 VAL VAL A . n A 1 119 TYR 119 95 95 TYR TYR A . n A 1 120 ARG 120 96 96 ARG ARG A . n A 1 121 MET 121 97 97 MET MET A . n A 1 122 LYS 122 98 98 LYS LYS A . n A 1 123 GLU 123 99 99 GLU GLU A . n A 1 124 ASP 124 100 100 ASP ASP A . n A 1 125 GLY 125 101 101 GLY GLY A . n A 1 126 LEU 126 102 102 LEU LEU A . n A 1 127 VAL 127 103 103 VAL VAL A . n A 1 128 ASP 128 104 104 ASP ASP A . n A 1 129 THR 129 105 105 THR THR A . n A 1 130 ALA 130 106 106 ALA ALA A . n A 1 131 PRO 131 107 107 PRO PRO A . n A 1 132 SER 132 108 108 SER SER A . n A 1 133 PRO 133 109 109 PRO PRO A . n A 1 134 GLU 134 110 110 GLU GLU A . n A 1 135 ASP 135 111 111 ASP ASP A . n A 1 136 GLY 136 112 112 GLY GLY A . n A 1 137 ARG 137 113 113 ARG ARG A . n A 1 138 VAL 138 114 114 VAL VAL A . n A 1 139 THR 139 115 115 THR THR A . n A 1 140 GLN 140 116 116 GLN GLN A . n A 1 141 VAL 141 117 117 VAL VAL A . n A 1 142 ARG 142 118 118 ARG ARG A . n A 1 143 ILE 143 119 119 ILE ILE A . n A 1 144 THR 144 120 120 THR THR A . n A 1 145 GLU 145 121 121 GLU GLU A . n A 1 146 VAL 146 122 122 VAL VAL A . n A 1 147 GLY 147 123 123 GLY GLY A . n A 1 148 LEU 148 124 124 LEU LEU A . n A 1 149 GLN 149 125 125 GLN GLN A . n A 1 150 ASN 150 126 126 ASN ASN A . n A 1 151 ILE 151 127 127 ILE ILE A . n A 1 152 GLU 152 128 128 GLU GLU A . n A 1 153 ARG 153 129 129 ARG ARG A . n A 1 154 MET 154 130 130 MET MET A . n A 1 155 GLN 155 131 131 GLN GLN A . n A 1 156 GLU 156 132 132 GLU GLU A . n A 1 157 VAL 157 133 133 VAL VAL A . n A 1 158 THR 158 134 134 THR THR A . n A 1 159 ARG 159 135 135 ARG ARG A . n A 1 160 GLU 160 136 136 GLU GLU A . n A 1 161 LEU 161 137 137 LEU LEU A . n A 1 162 PHE 162 138 138 PHE PHE A . n A 1 163 GLN 163 139 139 GLN GLN A . n A 1 164 ARG 164 140 140 ARG ARG A . n A 1 165 SER 165 141 141 SER SER A . n A 1 166 PHE 166 142 142 PHE PHE A . n A 1 167 LYS 167 143 143 LYS LYS A . n A 1 168 GLY 168 144 144 GLY GLY A . n A 1 169 LEU 169 145 145 LEU LEU A . n A 1 170 THR 170 146 146 THR THR A . n A 1 171 GLU 171 147 147 GLU GLU A . n A 1 172 ALA 172 148 148 ALA ALA A . n A 1 173 GLN 173 149 149 GLN GLN A . n A 1 174 VAL 174 150 150 VAL VAL A . n A 1 175 GLN 175 151 151 GLN GLN A . n A 1 176 ARG 176 152 152 ARG ARG A . n A 1 177 LEU 177 153 153 LEU LEU A . n A 1 178 ASN 178 154 154 ASN ASN A . n A 1 179 ARG 179 155 155 ARG ARG A . n A 1 180 MET 180 156 156 MET MET A . n A 1 181 LEU 181 157 157 LEU LEU A . n A 1 182 GLU 182 158 158 GLU GLU A . n A 1 183 VAL 183 159 159 VAL VAL A . n A 1 184 VAL 184 160 160 VAL VAL A . n A 1 185 PHE 185 161 161 PHE PHE A . n A 1 186 HIS 186 162 162 HIS HIS A . n A 1 187 ASN 187 163 163 ASN ASN A . n A 1 188 LEU 188 164 164 LEU LEU A . n A 1 189 GLU 189 165 165 GLU GLU A . n A 1 190 THR 190 166 166 THR THR A . n A 1 191 LEU 191 167 167 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IAC 1 201 201 IAC IAA A . C 3 HOH 1 301 19 HOH HOH A . C 3 HOH 2 302 14 HOH HOH A . C 3 HOH 3 303 16 HOH HOH A . C 3 HOH 4 304 40 HOH HOH A . C 3 HOH 5 305 1 HOH HOH A . C 3 HOH 6 306 56 HOH HOH A . C 3 HOH 7 307 10 HOH HOH A . C 3 HOH 8 308 24 HOH HOH A . C 3 HOH 9 309 15 HOH HOH A . C 3 HOH 10 310 38 HOH HOH A . C 3 HOH 11 311 43 HOH HOH A . C 3 HOH 12 312 21 HOH HOH A . C 3 HOH 13 313 41 HOH HOH A . C 3 HOH 14 314 11 HOH HOH A . C 3 HOH 15 315 17 HOH HOH A . C 3 HOH 16 316 13 HOH HOH A . C 3 HOH 17 317 54 HOH HOH A . C 3 HOH 18 318 4 HOH HOH A . C 3 HOH 19 319 42 HOH HOH A . C 3 HOH 20 320 5 HOH HOH A . C 3 HOH 21 321 9 HOH HOH A . C 3 HOH 22 322 30 HOH HOH A . C 3 HOH 23 323 23 HOH HOH A . C 3 HOH 24 324 58 HOH HOH A . C 3 HOH 25 325 22 HOH HOH A . C 3 HOH 26 326 3 HOH HOH A . C 3 HOH 27 327 12 HOH HOH A . C 3 HOH 28 328 7 HOH HOH A . C 3 HOH 29 329 49 HOH HOH A . C 3 HOH 30 330 37 HOH HOH A . C 3 HOH 31 331 32 HOH HOH A . C 3 HOH 32 332 2 HOH HOH A . C 3 HOH 33 333 29 HOH HOH A . C 3 HOH 34 334 25 HOH HOH A . C 3 HOH 35 335 36 HOH HOH A . C 3 HOH 36 336 6 HOH HOH A . C 3 HOH 37 337 48 HOH HOH A . C 3 HOH 38 338 44 HOH HOH A . C 3 HOH 39 339 50 HOH HOH A . C 3 HOH 40 340 60 HOH HOH A . C 3 HOH 41 341 26 HOH HOH A . C 3 HOH 42 342 8 HOH HOH A . C 3 HOH 43 343 33 HOH HOH A . C 3 HOH 44 344 28 HOH HOH A . C 3 HOH 45 345 57 HOH HOH A . C 3 HOH 46 346 20 HOH HOH A . C 3 HOH 47 347 61 HOH HOH A . C 3 HOH 48 348 46 HOH HOH A . C 3 HOH 49 349 39 HOH HOH A . C 3 HOH 50 350 51 HOH HOH A . C 3 HOH 51 351 47 HOH HOH A . C 3 HOH 52 352 62 HOH HOH A . C 3 HOH 53 353 35 HOH HOH A . C 3 HOH 54 354 27 HOH HOH A . C 3 HOH 55 355 18 HOH HOH A . C 3 HOH 56 356 34 HOH HOH A . C 3 HOH 57 357 45 HOH HOH A . C 3 HOH 58 358 31 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7360 ? 1 MORE -38 ? 1 'SSA (A^2)' 14640 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-01 2 'Structure model' 1 1 2022-11-23 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 7KUA _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -23 ? A MET 1 2 1 Y 1 A HIS -22 ? A HIS 2 3 1 Y 1 A HIS -21 ? A HIS 3 4 1 Y 1 A HIS -20 ? A HIS 4 5 1 Y 1 A HIS -19 ? A HIS 5 6 1 Y 1 A HIS -18 ? A HIS 6 7 1 Y 1 A HIS -17 ? A HIS 7 8 1 Y 1 A SER -16 ? A SER 8 9 1 Y 1 A SER -15 ? A SER 9 10 1 Y 1 A GLY -14 ? A GLY 10 11 1 Y 1 A VAL -13 ? A VAL 11 12 1 Y 1 A ASP -12 ? A ASP 12 13 1 Y 1 A LEU -11 ? A LEU 13 14 1 Y 1 A GLY -10 ? A GLY 14 15 1 Y 1 A THR -9 ? A THR 15 16 1 Y 1 A GLU -8 ? A GLU 16 17 1 Y 1 A ASN -7 ? A ASN 17 18 1 Y 1 A LEU -6 ? A LEU 18 19 1 Y 1 A TYR -5 ? A TYR 19 20 1 Y 1 A PHE -4 ? A PHE 20 21 1 Y 1 A GLN -3 ? A GLN 21 22 1 Y 1 A SER -2 ? A SER 22 23 1 Y 1 A ASN -1 ? A ASN 23 24 1 Y 1 A ALA 0 ? A ALA 24 25 1 Y 1 A MET 1 ? A MET 25 26 1 Y 1 A SER 2 ? A SER 26 27 1 Y 1 A ASN 3 ? A ASN 27 28 1 Y 1 A ALA 4 ? A ALA 28 29 1 Y 1 A LYS 5 ? A LYS 29 30 1 Y 1 A ASN 6 ? A ASN 30 31 1 Y 1 A THR 7 ? A THR 31 32 1 Y 1 A SER 8 ? A SER 32 33 1 Y 1 A ALA 9 ? A ALA 33 34 1 Y 1 A ALA 10 ? A ALA 34 35 1 Y 1 A SER 11 ? A SER 35 36 1 Y 1 A PRO 12 ? A PRO 36 37 1 Y 1 A ALA 13 ? A ALA 37 38 1 Y 1 A ARG 14 ? A ARG 38 39 1 Y 1 A LYS 15 ? A LYS 39 40 1 Y 1 A GLY 16 ? A GLY 40 41 1 Y 1 A HIS 17 ? A HIS 41 42 1 Y 1 A SER 18 ? A SER 42 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 IAC C C Y N 147 IAC C1 C Y N 148 IAC C2 C Y N 149 IAC C3 C Y N 150 IAC C4 C Y N 151 IAC C5 C Y N 152 IAC C7 C Y N 153 IAC C8 C Y N 154 IAC C17 C N N 155 IAC C18 C N N 156 IAC N N Y N 157 IAC O2 O N N 158 IAC O3 O N N 159 IAC H2 H N N 160 IAC H3 H N N 161 IAC H4 H N N 162 IAC H5 H N N 163 IAC H8 H N N 164 IAC H171 H N N 165 IAC H172 H N N 166 IAC HN H N N 167 IAC HO2 H N N 168 ILE N N N N 169 ILE CA C N S 170 ILE C C N N 171 ILE O O N N 172 ILE CB C N S 173 ILE CG1 C N N 174 ILE CG2 C N N 175 ILE CD1 C N N 176 ILE OXT O N N 177 ILE H H N N 178 ILE H2 H N N 179 ILE HA H N N 180 ILE HB H N N 181 ILE HG12 H N N 182 ILE HG13 H N N 183 ILE HG21 H N N 184 ILE HG22 H N N 185 ILE HG23 H N N 186 ILE HD11 H N N 187 ILE HD12 H N N 188 ILE HD13 H N N 189 ILE HXT H N N 190 LEU N N N N 191 LEU CA C N S 192 LEU C C N N 193 LEU O O N N 194 LEU CB C N N 195 LEU CG C N N 196 LEU CD1 C N N 197 LEU CD2 C N N 198 LEU OXT O N N 199 LEU H H N N 200 LEU H2 H N N 201 LEU HA H N N 202 LEU HB2 H N N 203 LEU HB3 H N N 204 LEU HG H N N 205 LEU HD11 H N N 206 LEU HD12 H N N 207 LEU HD13 H N N 208 LEU HD21 H N N 209 LEU HD22 H N N 210 LEU HD23 H N N 211 LEU HXT H N N 212 LYS N N N N 213 LYS CA C N S 214 LYS C C N N 215 LYS O O N N 216 LYS CB C N N 217 LYS CG C N N 218 LYS CD C N N 219 LYS CE C N N 220 LYS NZ N N N 221 LYS OXT O N N 222 LYS H H N N 223 LYS H2 H N N 224 LYS HA H N N 225 LYS HB2 H N N 226 LYS HB3 H N N 227 LYS HG2 H N N 228 LYS HG3 H N N 229 LYS HD2 H N N 230 LYS HD3 H N N 231 LYS HE2 H N N 232 LYS HE3 H N N 233 LYS HZ1 H N N 234 LYS HZ2 H N N 235 LYS HZ3 H N N 236 LYS HXT H N N 237 MET N N N N 238 MET CA C N S 239 MET C C N N 240 MET O O N N 241 MET CB C N N 242 MET CG C N N 243 MET SD S N N 244 MET CE C N N 245 MET OXT O N N 246 MET H H N N 247 MET H2 H N N 248 MET HA H N N 249 MET HB2 H N N 250 MET HB3 H N N 251 MET HG2 H N N 252 MET HG3 H N N 253 MET HE1 H N N 254 MET HE2 H N N 255 MET HE3 H N N 256 MET HXT H N N 257 PHE N N N N 258 PHE CA C N S 259 PHE C C N N 260 PHE O O N N 261 PHE CB C N N 262 PHE CG C Y N 263 PHE CD1 C Y N 264 PHE CD2 C Y N 265 PHE CE1 C Y N 266 PHE CE2 C Y N 267 PHE CZ C Y N 268 PHE OXT O N N 269 PHE H H N N 270 PHE H2 H N N 271 PHE HA H N N 272 PHE HB2 H N N 273 PHE HB3 H N N 274 PHE HD1 H N N 275 PHE HD2 H N N 276 PHE HE1 H N N 277 PHE HE2 H N N 278 PHE HZ H N N 279 PHE HXT H N N 280 PRO N N N N 281 PRO CA C N S 282 PRO C C N N 283 PRO O O N N 284 PRO CB C N N 285 PRO CG C N N 286 PRO CD C N N 287 PRO OXT O N N 288 PRO H H N N 289 PRO HA H N N 290 PRO HB2 H N N 291 PRO HB3 H N N 292 PRO HG2 H N N 293 PRO HG3 H N N 294 PRO HD2 H N N 295 PRO HD3 H N N 296 PRO HXT H N N 297 SER N N N N 298 SER CA C N S 299 SER C C N N 300 SER O O N N 301 SER CB C N N 302 SER OG O N N 303 SER OXT O N N 304 SER H H N N 305 SER H2 H N N 306 SER HA H N N 307 SER HB2 H N N 308 SER HB3 H N N 309 SER HG H N N 310 SER HXT H N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TRP N N N N 329 TRP CA C N S 330 TRP C C N N 331 TRP O O N N 332 TRP CB C N N 333 TRP CG C Y N 334 TRP CD1 C Y N 335 TRP CD2 C Y N 336 TRP NE1 N Y N 337 TRP CE2 C Y N 338 TRP CE3 C Y N 339 TRP CZ2 C Y N 340 TRP CZ3 C Y N 341 TRP CH2 C Y N 342 TRP OXT O N N 343 TRP H H N N 344 TRP H2 H N N 345 TRP HA H N N 346 TRP HB2 H N N 347 TRP HB3 H N N 348 TRP HD1 H N N 349 TRP HE1 H N N 350 TRP HE3 H N N 351 TRP HZ2 H N N 352 TRP HZ3 H N N 353 TRP HH2 H N N 354 TRP HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 IAC C N sing Y N 139 IAC C C1 doub Y N 140 IAC C C5 sing Y N 141 IAC C1 C7 sing Y N 142 IAC C1 C2 sing Y N 143 IAC C2 C3 doub Y N 144 IAC C2 H2 sing N N 145 IAC C3 C4 sing Y N 146 IAC C3 H3 sing N N 147 IAC C4 C5 doub Y N 148 IAC C4 H4 sing N N 149 IAC C5 H5 sing N N 150 IAC C7 C17 sing N N 151 IAC C7 C8 doub Y N 152 IAC C8 N sing Y N 153 IAC C8 H8 sing N N 154 IAC C17 C18 sing N N 155 IAC C17 H171 sing N N 156 IAC C17 H172 sing N N 157 IAC C18 O3 doub N N 158 IAC C18 O2 sing N N 159 IAC N HN sing N N 160 IAC O2 HO2 sing N N 161 ILE N CA sing N N 162 ILE N H sing N N 163 ILE N H2 sing N N 164 ILE CA C sing N N 165 ILE CA CB sing N N 166 ILE CA HA sing N N 167 ILE C O doub N N 168 ILE C OXT sing N N 169 ILE CB CG1 sing N N 170 ILE CB CG2 sing N N 171 ILE CB HB sing N N 172 ILE CG1 CD1 sing N N 173 ILE CG1 HG12 sing N N 174 ILE CG1 HG13 sing N N 175 ILE CG2 HG21 sing N N 176 ILE CG2 HG22 sing N N 177 ILE CG2 HG23 sing N N 178 ILE CD1 HD11 sing N N 179 ILE CD1 HD12 sing N N 180 ILE CD1 HD13 sing N N 181 ILE OXT HXT sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TRP N CA sing N N 316 TRP N H sing N N 317 TRP N H2 sing N N 318 TRP CA C sing N N 319 TRP CA CB sing N N 320 TRP CA HA sing N N 321 TRP C O doub N N 322 TRP C OXT sing N N 323 TRP CB CG sing N N 324 TRP CB HB2 sing N N 325 TRP CB HB3 sing N N 326 TRP CG CD1 doub Y N 327 TRP CG CD2 sing Y N 328 TRP CD1 NE1 sing Y N 329 TRP CD1 HD1 sing N N 330 TRP CD2 CE2 doub Y N 331 TRP CD2 CE3 sing Y N 332 TRP NE1 CE2 sing Y N 333 TRP NE1 HE1 sing N N 334 TRP CE2 CZ2 sing Y N 335 TRP CE3 CZ3 doub Y N 336 TRP CE3 HE3 sing N N 337 TRP CZ2 CH2 doub Y N 338 TRP CZ2 HZ2 sing N N 339 TRP CZ3 CH2 sing Y N 340 TRP CZ3 HZ3 sing N N 341 TRP CH2 HH2 sing N N 342 TRP OXT HXT sing N N 343 TYR N CA sing N N 344 TYR N H sing N N 345 TYR N H2 sing N N 346 TYR CA C sing N N 347 TYR CA CB sing N N 348 TYR CA HA sing N N 349 TYR C O doub N N 350 TYR C OXT sing N N 351 TYR CB CG sing N N 352 TYR CB HB2 sing N N 353 TYR CB HB3 sing N N 354 TYR CG CD1 doub Y N 355 TYR CG CD2 sing Y N 356 TYR CD1 CE1 sing Y N 357 TYR CD1 HD1 sing N N 358 TYR CD2 CE2 doub Y N 359 TYR CD2 HD2 sing N N 360 TYR CE1 CZ doub Y N 361 TYR CE1 HE1 sing N N 362 TYR CE2 CZ sing Y N 363 TYR CE2 HE2 sing N N 364 TYR CZ OH sing N N 365 TYR OH HH sing N N 366 TYR OXT HXT sing N N 367 VAL N CA sing N N 368 VAL N H sing N N 369 VAL N H2 sing N N 370 VAL CA C sing N N 371 VAL CA CB sing N N 372 VAL CA HA sing N N 373 VAL C O doub N N 374 VAL C OXT sing N N 375 VAL CB CG1 sing N N 376 VAL CB CG2 sing N N 377 VAL CB HB sing N N 378 VAL CG1 HG11 sing N N 379 VAL CG1 HG12 sing N N 380 VAL CG1 HG13 sing N N 381 VAL CG2 HG21 sing N N 382 VAL CG2 HG22 sing N N 383 VAL CG2 HG23 sing N N 384 VAL OXT HXT sing N N 385 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number IOS-1917270 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IAC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IAC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1H-INDOL-3-YLACETIC ACID' IAC 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3CJN _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 #