data_7L91 # _entry.id 7L91 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7L91 pdb_00007l91 10.2210/pdb7l91/pdb WWPDB D_1000253832 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'structure of L1 with two zincs without antibiotic' 7L52 unspecified TargetDB . IDP97218 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7L91 _pdbx_database_status.recvd_initial_deposition_date 2021-01-01 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wilamowski, M.' 1 ? 'Kim, Y.' 2 ? 'Sherrell, D.A.' 3 ? 'Lavens, A.' 4 ? 'Henning, R.' 5 ? 'Maltseva, N.' 6 ? 'Endres, M.' 7 ? 'Babnigg, G.' 8 ? 'Vukica, S.' 9 ? 'Joachimiak, A.' 10 ? 'Center for Structural Genomics of Infectious Diseases (CSGID)' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 7379 _citation.page_last 7379 _citation.title 'Time-resolved beta-lactam cleavage by L1 metallo-beta-lactamase.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-022-35029-3 _citation.pdbx_database_id_PubMed 36450742 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wilamowski, M.' 1 0000-0001-8760-0700 primary 'Sherrell, D.A.' 2 ? primary 'Kim, Y.' 3 0000-0002-1610-4889 primary 'Lavens, A.' 4 0000-0002-3856-9919 primary 'Henning, R.W.' 5 ? primary 'Lazarski, K.' 6 ? primary 'Shigemoto, A.' 7 ? primary 'Endres, M.' 8 ? primary 'Maltseva, N.' 9 0000-0002-2871-465X primary 'Babnigg, G.' 10 0000-0002-9838-1803 primary 'Burdette, S.C.' 11 0000-0002-2176-0776 primary 'Srajer, V.' 12 ? primary 'Joachimiak, A.' 13 0000-0003-2535-6209 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7L91 _cell.details ? _cell.formula_units_Z ? _cell.length_a 105.853 _cell.length_a_esd ? _cell.length_b 105.853 _cell.length_b_esd ? _cell.length_c 99.100 _cell.length_c_esd ? _cell.volume 961635.811 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7L91 _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall 'P 64 2 (x,y,z+1/6)' _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative metallo-beta-lactamase l1 (Beta-lactamase type ii) (Ec 3.5.2.6) (Penicillinase)' 29243.938 1 3.5.2.6 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn ;(2R)-2-[(R)-carboxy{[(2R)-2-carboxy-2-(4-hydroxyphenyl)acetyl]amino}methoxymethyl]-5-{[(1-methyl-1H-tetrazol-5-yl)sulfanyl]methyl}-3,6-dihydro-2H-1,3-oxazine-4-carboxylic acid ; 538.488 1 ? ? ? ? 4 water nat water 18.015 71 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAASAAEAPLPQLRAYTVDASWLQPMAPLQVADHTWQIGTEDLTALLVQTAEGAVLLDGGMPQMAGHLLDNMKLRGVAP QDLRLILLSHAHADHAGPVAELKRRTGAHVAANAETAVLLARGGSNDLHFGDGITYPPASADRIIMDGEVVTVGGIAFTA HFMPGHTPGSTAWTWTDTRDGKPVRIAYADSLSAPGYQLKGNPRYPRLIEDYKRSFATVRALPCDLLLTPHPGASNWNYA VGSKASAEALTCNAYADAAEKKFDAQLARETAGTR ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAASAAEAPLPQLRAYTVDASWLQPMAPLQVADHTWQIGTEDLTALLVQTAEGAVLLDGGMPQMAGHLLDNMKLRGVAP QDLRLILLSHAHADHAGPVAELKRRTGAHVAANAETAVLLARGGSNDLHFGDGITYPPASADRIIMDGEVVTVGGIAFTA HFMPGHTPGSTAWTWTDTRDGKPVRIAYADSLSAPGYQLKGNPRYPRLIEDYKRSFATVRALPCDLLLTPHPGASNWNYA VGSKASAEALTCNAYADAAEKKFDAQLARETAGTR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier IDP97218 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 ALA n 1 5 SER n 1 6 ALA n 1 7 ALA n 1 8 GLU n 1 9 ALA n 1 10 PRO n 1 11 LEU n 1 12 PRO n 1 13 GLN n 1 14 LEU n 1 15 ARG n 1 16 ALA n 1 17 TYR n 1 18 THR n 1 19 VAL n 1 20 ASP n 1 21 ALA n 1 22 SER n 1 23 TRP n 1 24 LEU n 1 25 GLN n 1 26 PRO n 1 27 MET n 1 28 ALA n 1 29 PRO n 1 30 LEU n 1 31 GLN n 1 32 VAL n 1 33 ALA n 1 34 ASP n 1 35 HIS n 1 36 THR n 1 37 TRP n 1 38 GLN n 1 39 ILE n 1 40 GLY n 1 41 THR n 1 42 GLU n 1 43 ASP n 1 44 LEU n 1 45 THR n 1 46 ALA n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 GLN n 1 51 THR n 1 52 ALA n 1 53 GLU n 1 54 GLY n 1 55 ALA n 1 56 VAL n 1 57 LEU n 1 58 LEU n 1 59 ASP n 1 60 GLY n 1 61 GLY n 1 62 MET n 1 63 PRO n 1 64 GLN n 1 65 MET n 1 66 ALA n 1 67 GLY n 1 68 HIS n 1 69 LEU n 1 70 LEU n 1 71 ASP n 1 72 ASN n 1 73 MET n 1 74 LYS n 1 75 LEU n 1 76 ARG n 1 77 GLY n 1 78 VAL n 1 79 ALA n 1 80 PRO n 1 81 GLN n 1 82 ASP n 1 83 LEU n 1 84 ARG n 1 85 LEU n 1 86 ILE n 1 87 LEU n 1 88 LEU n 1 89 SER n 1 90 HIS n 1 91 ALA n 1 92 HIS n 1 93 ALA n 1 94 ASP n 1 95 HIS n 1 96 ALA n 1 97 GLY n 1 98 PRO n 1 99 VAL n 1 100 ALA n 1 101 GLU n 1 102 LEU n 1 103 LYS n 1 104 ARG n 1 105 ARG n 1 106 THR n 1 107 GLY n 1 108 ALA n 1 109 HIS n 1 110 VAL n 1 111 ALA n 1 112 ALA n 1 113 ASN n 1 114 ALA n 1 115 GLU n 1 116 THR n 1 117 ALA n 1 118 VAL n 1 119 LEU n 1 120 LEU n 1 121 ALA n 1 122 ARG n 1 123 GLY n 1 124 GLY n 1 125 SER n 1 126 ASN n 1 127 ASP n 1 128 LEU n 1 129 HIS n 1 130 PHE n 1 131 GLY n 1 132 ASP n 1 133 GLY n 1 134 ILE n 1 135 THR n 1 136 TYR n 1 137 PRO n 1 138 PRO n 1 139 ALA n 1 140 SER n 1 141 ALA n 1 142 ASP n 1 143 ARG n 1 144 ILE n 1 145 ILE n 1 146 MET n 1 147 ASP n 1 148 GLY n 1 149 GLU n 1 150 VAL n 1 151 VAL n 1 152 THR n 1 153 VAL n 1 154 GLY n 1 155 GLY n 1 156 ILE n 1 157 ALA n 1 158 PHE n 1 159 THR n 1 160 ALA n 1 161 HIS n 1 162 PHE n 1 163 MET n 1 164 PRO n 1 165 GLY n 1 166 HIS n 1 167 THR n 1 168 PRO n 1 169 GLY n 1 170 SER n 1 171 THR n 1 172 ALA n 1 173 TRP n 1 174 THR n 1 175 TRP n 1 176 THR n 1 177 ASP n 1 178 THR n 1 179 ARG n 1 180 ASP n 1 181 GLY n 1 182 LYS n 1 183 PRO n 1 184 VAL n 1 185 ARG n 1 186 ILE n 1 187 ALA n 1 188 TYR n 1 189 ALA n 1 190 ASP n 1 191 SER n 1 192 LEU n 1 193 SER n 1 194 ALA n 1 195 PRO n 1 196 GLY n 1 197 TYR n 1 198 GLN n 1 199 LEU n 1 200 LYS n 1 201 GLY n 1 202 ASN n 1 203 PRO n 1 204 ARG n 1 205 TYR n 1 206 PRO n 1 207 ARG n 1 208 LEU n 1 209 ILE n 1 210 GLU n 1 211 ASP n 1 212 TYR n 1 213 LYS n 1 214 ARG n 1 215 SER n 1 216 PHE n 1 217 ALA n 1 218 THR n 1 219 VAL n 1 220 ARG n 1 221 ALA n 1 222 LEU n 1 223 PRO n 1 224 CYS n 1 225 ASP n 1 226 LEU n 1 227 LEU n 1 228 LEU n 1 229 THR n 1 230 PRO n 1 231 HIS n 1 232 PRO n 1 233 GLY n 1 234 ALA n 1 235 SER n 1 236 ASN n 1 237 TRP n 1 238 ASN n 1 239 TYR n 1 240 ALA n 1 241 VAL n 1 242 GLY n 1 243 SER n 1 244 LYS n 1 245 ALA n 1 246 SER n 1 247 ALA n 1 248 GLU n 1 249 ALA n 1 250 LEU n 1 251 THR n 1 252 CYS n 1 253 ASN n 1 254 ALA n 1 255 TYR n 1 256 ALA n 1 257 ASP n 1 258 ALA n 1 259 ALA n 1 260 GLU n 1 261 LYS n 1 262 LYS n 1 263 PHE n 1 264 ASP n 1 265 ALA n 1 266 GLN n 1 267 LEU n 1 268 ALA n 1 269 ARG n 1 270 GLU n 1 271 THR n 1 272 ALA n 1 273 GLY n 1 274 THR n 1 275 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 275 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Smlt2667 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K279a _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Stenotrophomonas maltophilia (strain K279a)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 522373 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Gold _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG53 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2FTM1_STRMK _struct_ref.pdbx_db_accession B2FTM1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASAAEAPLPQLRAYTVDASWLQPMAPLQVADHTWQIGTEDLTALLVQTAEGAVLLDGGMPQMAGHLLDNMKLRGVAPQDL RLILLSHAHADHAGPVAELKRRTGAHVAANAETAVLLARGGSNDLHFGDGITYPPASADRIIMDGEVVTVGGIAFTAHFM PGHTPGSTAWTWTDTRDGKPVRIAYADSLSAPGYQLKGNPRYPRLIEDYKRSFATVRALPCDLLLTPHPGASNWNYAVGS KASAEALTCNAYADAAEKKFDAQLARETAGTR ; _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7L91 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 275 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B2FTM1 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 290 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 19 _struct_ref_seq.pdbx_auth_seq_align_end 290 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7L91 SER A 1 ? UNP B2FTM1 ? ? 'expression tag' 16 1 1 7L91 ASN A 2 ? UNP B2FTM1 ? ? 'expression tag' 17 2 1 7L91 ALA A 3 ? UNP B2FTM1 ? ? 'expression tag' 18 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XQP non-polymer . ;(2R)-2-[(R)-carboxy{[(2R)-2-carboxy-2-(4-hydroxyphenyl)acetyl]amino}methoxymethyl]-5-{[(1-methyl-1H-tetrazol-5-yl)sulfanyl]methyl}-3,6-dihydro-2H-1,3-oxazine-4-carboxylic acid ; ? 'C20 H22 N6 O10 S' 538.488 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7L91 _exptl.crystals_number 7816 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Batch crystallization done in polypropylene tubes. 200 ul of the L1 (48 mg/ml) in a buffer 0.015 Tris, 0.1 M KCl, 1.5 mM TCEP, 5 mM ZnCl2 pH 7.0 was added to 200 ul of 0.15 M sodium malonate pH 8.0, 20% (w/v) PEG3350. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX340-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l L _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol LAUE _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.02 1.0 2 1.18 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 14-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.02-1.18 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 22.15 _reflns.entry_id 7L91 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 33.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14754 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 86.42 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 35.4 _reflns.pdbx_Rmerge_I_obs 0.132 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.51 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.30 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 15.96 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1143 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.122 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 26.85 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7L91 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 33.03 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14723 _refine.ls_number_reflns_R_free 773 _refine.ls_number_reflns_R_work 13950 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 85.72 _refine.ls_percent_reflns_R_free 5.25 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1827 _refine.ls_R_factor_R_free 0.2075 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1814 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7L52 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.7205 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2118 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 33.03 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 2096 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1986 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0030 ? 2075 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6267 ? 2838 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0416 ? 315 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0042 ? 374 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.0325 ? 753 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.20 2.34 . . 87 1546 58.53 . . . 0.2216 . 0.2030 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.34 2.52 . . 115 2109 79.51 . . . 0.2338 . 0.2278 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.52 2.77 . . 130 2347 88.09 . . . 0.2747 . 0.2297 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.77 3.17 . . 151 2497 93.27 . . . 0.2397 . 0.2152 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.17 4.00 . . 115 2654 96.31 . . . 0.2012 . 0.1647 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.00 33.03 . . 175 2797 97.06 . . . 0.1660 . 0.1415 . . . . . . . . . . . # _struct.entry_id 7L91 _struct.title 'Structure of Metallo Beta-Lactamase L1 in a Complex with Hydrolyzed Moxalactam Determined by Pink-Beam Serial Crystallography' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7L91 _struct_keywords.text ;metallo beta lactamase, moxalactam, serial crystallography, Structural Genomics, Center for Structural Genomics of Infectious Diseases, HYDROLASE, CSGID ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 20 ? GLN A 25 ? ASP A 35 GLN A 40 5 ? 6 HELX_P HELX_P2 AA2 MET A 62 ? GLN A 64 ? MET A 77 GLN A 79 5 ? 3 HELX_P HELX_P3 AA3 MET A 65 ? ARG A 76 ? MET A 80 ARG A 91 1 ? 12 HELX_P HELX_P4 AA4 ALA A 79 ? GLN A 81 ? ALA A 94 GLN A 96 5 ? 3 HELX_P HELX_P5 AA5 HIS A 92 ? GLY A 97 ? HIS A 107 GLY A 112 1 ? 6 HELX_P HELX_P6 AA6 PRO A 98 ? GLY A 107 ? PRO A 113 GLY A 122 1 ? 10 HELX_P HELX_P7 AA7 ASN A 113 ? ARG A 122 ? ASN A 128 ARG A 137 1 ? 10 HELX_P HELX_P8 AA8 ARG A 207 ? ALA A 221 ? ARG A 222 ALA A 236 1 ? 15 HELX_P HELX_P9 AA9 HIS A 231 ? ASN A 236 ? HIS A 246 ASN A 251 5 ? 6 HELX_P HELX_P10 AB1 ASN A 238 ? ALA A 247 ? ASN A 253 ALA A 262 5 ? 10 HELX_P HELX_P11 AB2 THR A 251 ? ALA A 272 ? THR A 266 ALA A 287 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 90 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 105 A ZN 301 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc2 metalc ? ? A HIS 92 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 107 A ZN 301 1_555 ? ? ? ? ? ? ? 2.106 ? ? metalc3 metalc ? ? A ASP 94 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 109 A ZN 302 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc4 metalc ? ? A HIS 95 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 110 A ZN 302 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc5 metalc ? ? A HIS 166 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 181 A ZN 301 1_555 ? ? ? ? ? ? ? 1.984 ? ? metalc6 metalc ? ? A HIS 231 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 246 A ZN 302 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc7 metalc ? ? B ZN . ZN ? ? ? 1_555 D XQP . O10 ? ? A ZN 301 A XQP 303 1_555 ? ? ? ? ? ? ? 2.184 ? ? metalc8 metalc ? ? B ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 301 A HOH 402 1_555 ? ? ? ? ? ? ? 1.942 ? ? metalc9 metalc ? ? C ZN . ZN ? ? ? 1_555 D XQP . N1 ? ? A ZN 302 A XQP 303 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc10 metalc ? ? C ZN . ZN ? ? ? 1_555 D XQP . O8 ? ? A ZN 302 A XQP 303 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc11 metalc ? ? C ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 302 A HOH 402 1_555 ? ? ? ? ? ? ? 2.165 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 30 ? GLN A 31 ? LEU A 45 GLN A 46 AA1 2 THR A 36 ? GLN A 38 ? THR A 51 GLN A 53 AA1 3 LEU A 47 ? THR A 51 ? LEU A 62 THR A 66 AA1 4 GLY A 54 ? LEU A 58 ? GLY A 69 LEU A 73 AA1 5 LEU A 83 ? LEU A 87 ? LEU A 98 LEU A 102 AA1 6 HIS A 109 ? ALA A 112 ? HIS A 124 ALA A 127 AA1 7 ARG A 143 ? ILE A 144 ? ARG A 158 ILE A 159 AA2 1 VAL A 150 ? VAL A 153 ? VAL A 165 VAL A 168 AA2 2 ILE A 156 ? PHE A 162 ? ILE A 171 PHE A 177 AA2 3 THR A 171 ? ARG A 179 ? THR A 186 ARG A 194 AA2 4 LYS A 182 ? TYR A 188 ? LYS A 197 TYR A 203 AA2 5 LEU A 226 ? LEU A 228 ? LEU A 241 LEU A 243 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 30 ? N LEU A 45 O GLN A 38 ? O GLN A 53 AA1 2 3 N TRP A 37 ? N TRP A 52 O LEU A 48 ? O LEU A 63 AA1 3 4 N VAL A 49 ? N VAL A 64 O VAL A 56 ? O VAL A 71 AA1 4 5 N LEU A 57 ? N LEU A 72 O LEU A 87 ? O LEU A 102 AA1 5 6 N ILE A 86 ? N ILE A 101 O HIS A 109 ? O HIS A 124 AA1 6 7 N ALA A 112 ? N ALA A 127 O ARG A 143 ? O ARG A 158 AA2 1 2 N VAL A 151 ? N VAL A 166 O PHE A 158 ? O PHE A 173 AA2 2 3 N HIS A 161 ? N HIS A 176 O ALA A 172 ? O ALA A 187 AA2 3 4 N TRP A 173 ? N TRP A 188 O TYR A 188 ? O TYR A 203 AA2 4 5 N ALA A 187 ? N ALA A 202 O LEU A 228 ? O LEU A 243 # _atom_sites.entry_id 7L91 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009447 _atom_sites.fract_transf_matrix[1][2] 0.005454 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010909 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010091 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 16 ? ? ? A . n A 1 2 ASN 2 17 ? ? ? A . n A 1 3 ALA 3 18 ? ? ? A . n A 1 4 ALA 4 19 ? ? ? A . n A 1 5 SER 5 20 ? ? ? A . n A 1 6 ALA 6 21 ? ? ? A . n A 1 7 ALA 7 22 ? ? ? A . n A 1 8 GLU 8 23 ? ? ? A . n A 1 9 ALA 9 24 24 ALA ALA A . n A 1 10 PRO 10 25 25 PRO PRO A . n A 1 11 LEU 11 26 26 LEU LEU A . n A 1 12 PRO 12 27 27 PRO PRO A . n A 1 13 GLN 13 28 28 GLN GLN A . n A 1 14 LEU 14 29 29 LEU LEU A . n A 1 15 ARG 15 30 30 ARG ARG A . n A 1 16 ALA 16 31 31 ALA ALA A . n A 1 17 TYR 17 32 32 TYR TYR A . n A 1 18 THR 18 33 33 THR THR A . n A 1 19 VAL 19 34 34 VAL VAL A . n A 1 20 ASP 20 35 35 ASP ASP A . n A 1 21 ALA 21 36 36 ALA ALA A . n A 1 22 SER 22 37 37 SER SER A . n A 1 23 TRP 23 38 38 TRP TRP A . n A 1 24 LEU 24 39 39 LEU LEU A . n A 1 25 GLN 25 40 40 GLN GLN A . n A 1 26 PRO 26 41 41 PRO PRO A . n A 1 27 MET 27 42 42 MET MET A . n A 1 28 ALA 28 43 43 ALA ALA A . n A 1 29 PRO 29 44 44 PRO PRO A . n A 1 30 LEU 30 45 45 LEU LEU A . n A 1 31 GLN 31 46 46 GLN GLN A . n A 1 32 VAL 32 47 47 VAL VAL A . n A 1 33 ALA 33 48 48 ALA ALA A . n A 1 34 ASP 34 49 49 ASP ASP A . n A 1 35 HIS 35 50 50 HIS HIS A . n A 1 36 THR 36 51 51 THR THR A . n A 1 37 TRP 37 52 52 TRP TRP A . n A 1 38 GLN 38 53 53 GLN GLN A . n A 1 39 ILE 39 54 54 ILE ILE A . n A 1 40 GLY 40 55 55 GLY GLY A . n A 1 41 THR 41 56 56 THR THR A . n A 1 42 GLU 42 57 57 GLU GLU A . n A 1 43 ASP 43 58 58 ASP ASP A . n A 1 44 LEU 44 59 59 LEU LEU A . n A 1 45 THR 45 60 60 THR THR A . n A 1 46 ALA 46 61 61 ALA ALA A . n A 1 47 LEU 47 62 62 LEU LEU A . n A 1 48 LEU 48 63 63 LEU LEU A . n A 1 49 VAL 49 64 64 VAL VAL A . n A 1 50 GLN 50 65 65 GLN GLN A . n A 1 51 THR 51 66 66 THR THR A . n A 1 52 ALA 52 67 67 ALA ALA A . n A 1 53 GLU 53 68 68 GLU GLU A . n A 1 54 GLY 54 69 69 GLY GLY A . n A 1 55 ALA 55 70 70 ALA ALA A . n A 1 56 VAL 56 71 71 VAL VAL A . n A 1 57 LEU 57 72 72 LEU LEU A . n A 1 58 LEU 58 73 73 LEU LEU A . n A 1 59 ASP 59 74 74 ASP ASP A . n A 1 60 GLY 60 75 75 GLY GLY A . n A 1 61 GLY 61 76 76 GLY GLY A . n A 1 62 MET 62 77 77 MET MET A . n A 1 63 PRO 63 78 78 PRO PRO A . n A 1 64 GLN 64 79 79 GLN GLN A . n A 1 65 MET 65 80 80 MET MET A . n A 1 66 ALA 66 81 81 ALA ALA A . n A 1 67 GLY 67 82 82 GLY GLY A . n A 1 68 HIS 68 83 83 HIS HIS A . n A 1 69 LEU 69 84 84 LEU LEU A . n A 1 70 LEU 70 85 85 LEU LEU A . n A 1 71 ASP 71 86 86 ASP ASP A . n A 1 72 ASN 72 87 87 ASN ASN A . n A 1 73 MET 73 88 88 MET MET A . n A 1 74 LYS 74 89 89 LYS LYS A . n A 1 75 LEU 75 90 90 LEU LEU A . n A 1 76 ARG 76 91 91 ARG ARG A . n A 1 77 GLY 77 92 92 GLY GLY A . n A 1 78 VAL 78 93 93 VAL VAL A . n A 1 79 ALA 79 94 94 ALA ALA A . n A 1 80 PRO 80 95 95 PRO PRO A . n A 1 81 GLN 81 96 96 GLN GLN A . n A 1 82 ASP 82 97 97 ASP ASP A . n A 1 83 LEU 83 98 98 LEU LEU A . n A 1 84 ARG 84 99 99 ARG ARG A . n A 1 85 LEU 85 100 100 LEU LEU A . n A 1 86 ILE 86 101 101 ILE ILE A . n A 1 87 LEU 87 102 102 LEU LEU A . n A 1 88 LEU 88 103 103 LEU LEU A . n A 1 89 SER 89 104 104 SER SER A . n A 1 90 HIS 90 105 105 HIS HIS A . n A 1 91 ALA 91 106 106 ALA ALA A . n A 1 92 HIS 92 107 107 HIS HIS A . n A 1 93 ALA 93 108 108 ALA ALA A . n A 1 94 ASP 94 109 109 ASP ASP A . n A 1 95 HIS 95 110 110 HIS HIS A . n A 1 96 ALA 96 111 111 ALA ALA A . n A 1 97 GLY 97 112 112 GLY GLY A . n A 1 98 PRO 98 113 113 PRO PRO A . n A 1 99 VAL 99 114 114 VAL VAL A . n A 1 100 ALA 100 115 115 ALA ALA A . n A 1 101 GLU 101 116 116 GLU GLU A . n A 1 102 LEU 102 117 117 LEU LEU A . n A 1 103 LYS 103 118 118 LYS LYS A . n A 1 104 ARG 104 119 119 ARG ARG A . n A 1 105 ARG 105 120 120 ARG ARG A . n A 1 106 THR 106 121 121 THR THR A . n A 1 107 GLY 107 122 122 GLY GLY A . n A 1 108 ALA 108 123 123 ALA ALA A . n A 1 109 HIS 109 124 124 HIS HIS A . n A 1 110 VAL 110 125 125 VAL VAL A . n A 1 111 ALA 111 126 126 ALA ALA A . n A 1 112 ALA 112 127 127 ALA ALA A . n A 1 113 ASN 113 128 128 ASN ASN A . n A 1 114 ALA 114 129 129 ALA ALA A . n A 1 115 GLU 115 130 130 GLU GLU A . n A 1 116 THR 116 131 131 THR THR A . n A 1 117 ALA 117 132 132 ALA ALA A . n A 1 118 VAL 118 133 133 VAL VAL A . n A 1 119 LEU 119 134 134 LEU LEU A . n A 1 120 LEU 120 135 135 LEU LEU A . n A 1 121 ALA 121 136 136 ALA ALA A . n A 1 122 ARG 122 137 137 ARG ARG A . n A 1 123 GLY 123 138 138 GLY GLY A . n A 1 124 GLY 124 139 139 GLY GLY A . n A 1 125 SER 125 140 140 SER SER A . n A 1 126 ASN 126 141 141 ASN ASN A . n A 1 127 ASP 127 142 142 ASP ASP A . n A 1 128 LEU 128 143 143 LEU LEU A . n A 1 129 HIS 129 144 144 HIS HIS A . n A 1 130 PHE 130 145 145 PHE PHE A . n A 1 131 GLY 131 146 146 GLY GLY A . n A 1 132 ASP 132 147 147 ASP ASP A . n A 1 133 GLY 133 148 148 GLY GLY A . n A 1 134 ILE 134 149 149 ILE ILE A . n A 1 135 THR 135 150 150 THR THR A . n A 1 136 TYR 136 151 151 TYR TYR A . n A 1 137 PRO 137 152 152 PRO PRO A . n A 1 138 PRO 138 153 153 PRO PRO A . n A 1 139 ALA 139 154 154 ALA ALA A . n A 1 140 SER 140 155 155 SER SER A . n A 1 141 ALA 141 156 156 ALA ALA A . n A 1 142 ASP 142 157 157 ASP ASP A . n A 1 143 ARG 143 158 158 ARG ARG A . n A 1 144 ILE 144 159 159 ILE ILE A . n A 1 145 ILE 145 160 160 ILE ILE A . n A 1 146 MET 146 161 161 MET MET A . n A 1 147 ASP 147 162 162 ASP ASP A . n A 1 148 GLY 148 163 163 GLY GLY A . n A 1 149 GLU 149 164 164 GLU GLU A . n A 1 150 VAL 150 165 165 VAL VAL A . n A 1 151 VAL 151 166 166 VAL VAL A . n A 1 152 THR 152 167 167 THR THR A . n A 1 153 VAL 153 168 168 VAL VAL A . n A 1 154 GLY 154 169 169 GLY GLY A . n A 1 155 GLY 155 170 170 GLY GLY A . n A 1 156 ILE 156 171 171 ILE ILE A . n A 1 157 ALA 157 172 172 ALA ALA A . n A 1 158 PHE 158 173 173 PHE PHE A . n A 1 159 THR 159 174 174 THR THR A . n A 1 160 ALA 160 175 175 ALA ALA A . n A 1 161 HIS 161 176 176 HIS HIS A . n A 1 162 PHE 162 177 177 PHE PHE A . n A 1 163 MET 163 178 178 MET MET A . n A 1 164 PRO 164 179 179 PRO PRO A . n A 1 165 GLY 165 180 180 GLY GLY A . n A 1 166 HIS 166 181 181 HIS HIS A . n A 1 167 THR 167 182 182 THR THR A . n A 1 168 PRO 168 183 183 PRO PRO A . n A 1 169 GLY 169 184 184 GLY GLY A . n A 1 170 SER 170 185 185 SER SER A . n A 1 171 THR 171 186 186 THR THR A . n A 1 172 ALA 172 187 187 ALA ALA A . n A 1 173 TRP 173 188 188 TRP TRP A . n A 1 174 THR 174 189 189 THR THR A . n A 1 175 TRP 175 190 190 TRP TRP A . n A 1 176 THR 176 191 191 THR THR A . n A 1 177 ASP 177 192 192 ASP ASP A . n A 1 178 THR 178 193 193 THR THR A . n A 1 179 ARG 179 194 194 ARG ARG A . n A 1 180 ASP 180 195 195 ASP ASP A . n A 1 181 GLY 181 196 196 GLY GLY A . n A 1 182 LYS 182 197 197 LYS LYS A . n A 1 183 PRO 183 198 198 PRO PRO A . n A 1 184 VAL 184 199 199 VAL VAL A . n A 1 185 ARG 185 200 200 ARG ARG A . n A 1 186 ILE 186 201 201 ILE ILE A . n A 1 187 ALA 187 202 202 ALA ALA A . n A 1 188 TYR 188 203 203 TYR TYR A . n A 1 189 ALA 189 204 204 ALA ALA A . n A 1 190 ASP 190 205 205 ASP ASP A . n A 1 191 SER 191 206 206 SER SER A . n A 1 192 LEU 192 207 207 LEU LEU A . n A 1 193 SER 193 208 208 SER SER A . n A 1 194 ALA 194 209 209 ALA ALA A . n A 1 195 PRO 195 210 210 PRO PRO A . n A 1 196 GLY 196 211 211 GLY GLY A . n A 1 197 TYR 197 212 212 TYR TYR A . n A 1 198 GLN 198 213 213 GLN GLN A . n A 1 199 LEU 199 214 214 LEU LEU A . n A 1 200 LYS 200 215 215 LYS LYS A . n A 1 201 GLY 201 216 216 GLY GLY A . n A 1 202 ASN 202 217 217 ASN ASN A . n A 1 203 PRO 203 218 218 PRO PRO A . n A 1 204 ARG 204 219 219 ARG ARG A . n A 1 205 TYR 205 220 220 TYR TYR A . n A 1 206 PRO 206 221 221 PRO PRO A . n A 1 207 ARG 207 222 222 ARG ARG A . n A 1 208 LEU 208 223 223 LEU LEU A . n A 1 209 ILE 209 224 224 ILE ILE A . n A 1 210 GLU 210 225 225 GLU GLU A . n A 1 211 ASP 211 226 226 ASP ASP A . n A 1 212 TYR 212 227 227 TYR TYR A . n A 1 213 LYS 213 228 228 LYS LYS A . n A 1 214 ARG 214 229 229 ARG ARG A . n A 1 215 SER 215 230 230 SER SER A . n A 1 216 PHE 216 231 231 PHE PHE A . n A 1 217 ALA 217 232 232 ALA ALA A . n A 1 218 THR 218 233 233 THR THR A . n A 1 219 VAL 219 234 234 VAL VAL A . n A 1 220 ARG 220 235 235 ARG ARG A . n A 1 221 ALA 221 236 236 ALA ALA A . n A 1 222 LEU 222 237 237 LEU LEU A . n A 1 223 PRO 223 238 238 PRO PRO A . n A 1 224 CYS 224 239 239 CYS CYS A . n A 1 225 ASP 225 240 240 ASP ASP A . n A 1 226 LEU 226 241 241 LEU LEU A . n A 1 227 LEU 227 242 242 LEU LEU A . n A 1 228 LEU 228 243 243 LEU LEU A . n A 1 229 THR 229 244 244 THR THR A . n A 1 230 PRO 230 245 245 PRO PRO A . n A 1 231 HIS 231 246 246 HIS HIS A . n A 1 232 PRO 232 247 247 PRO PRO A . n A 1 233 GLY 233 248 248 GLY GLY A . n A 1 234 ALA 234 249 249 ALA ALA A . n A 1 235 SER 235 250 250 SER SER A . n A 1 236 ASN 236 251 251 ASN ASN A . n A 1 237 TRP 237 252 252 TRP TRP A . n A 1 238 ASN 238 253 253 ASN ASN A . n A 1 239 TYR 239 254 254 TYR TYR A . n A 1 240 ALA 240 255 255 ALA ALA A . n A 1 241 VAL 241 256 256 VAL VAL A . n A 1 242 GLY 242 257 257 GLY GLY A . n A 1 243 SER 243 258 258 SER SER A . n A 1 244 LYS 244 259 259 LYS LYS A . n A 1 245 ALA 245 260 260 ALA ALA A . n A 1 246 SER 246 261 261 SER SER A . n A 1 247 ALA 247 262 262 ALA ALA A . n A 1 248 GLU 248 263 263 GLU GLU A . n A 1 249 ALA 249 264 264 ALA ALA A . n A 1 250 LEU 250 265 265 LEU LEU A . n A 1 251 THR 251 266 266 THR THR A . n A 1 252 CYS 252 267 267 CYS CYS A . n A 1 253 ASN 253 268 268 ASN ASN A . n A 1 254 ALA 254 269 269 ALA ALA A . n A 1 255 TYR 255 270 270 TYR TYR A . n A 1 256 ALA 256 271 271 ALA ALA A . n A 1 257 ASP 257 272 272 ASP ASP A . n A 1 258 ALA 258 273 273 ALA ALA A . n A 1 259 ALA 259 274 274 ALA ALA A . n A 1 260 GLU 260 275 275 GLU GLU A . n A 1 261 LYS 261 276 276 LYS LYS A . n A 1 262 LYS 262 277 277 LYS LYS A . n A 1 263 PHE 263 278 278 PHE PHE A . n A 1 264 ASP 264 279 279 ASP ASP A . n A 1 265 ALA 265 280 280 ALA ALA A . n A 1 266 GLN 266 281 281 GLN GLN A . n A 1 267 LEU 267 282 282 LEU LEU A . n A 1 268 ALA 268 283 283 ALA ALA A . n A 1 269 ARG 269 284 284 ARG ARG A . n A 1 270 GLU 270 285 285 GLU GLU A . n A 1 271 THR 271 286 286 THR THR A . n A 1 272 ALA 272 287 287 ALA ALA A . n A 1 273 GLY 273 288 ? ? ? A . n A 1 274 THR 274 289 ? ? ? A . n A 1 275 ARG 275 290 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 301 ZN ZN A . C 2 ZN 1 302 302 ZN ZN A . D 3 XQP 1 303 401 XQP MOX A . E 4 HOH 1 401 538 HOH HOH A . E 4 HOH 2 402 557 HOH HOH A . E 4 HOH 3 403 532 HOH HOH A . E 4 HOH 4 404 544 HOH HOH A . E 4 HOH 5 405 518 HOH HOH A . E 4 HOH 6 406 522 HOH HOH A . E 4 HOH 7 407 507 HOH HOH A . E 4 HOH 8 408 569 HOH HOH A . E 4 HOH 9 409 503 HOH HOH A . E 4 HOH 10 410 535 HOH HOH A . E 4 HOH 11 411 525 HOH HOH A . E 4 HOH 12 412 562 HOH HOH A . E 4 HOH 13 413 558 HOH HOH A . E 4 HOH 14 414 550 HOH HOH A . E 4 HOH 15 415 529 HOH HOH A . E 4 HOH 16 416 515 HOH HOH A . E 4 HOH 17 417 559 HOH HOH A . E 4 HOH 18 418 543 HOH HOH A . E 4 HOH 19 419 564 HOH HOH A . E 4 HOH 20 420 545 HOH HOH A . E 4 HOH 21 421 502 HOH HOH A . E 4 HOH 22 422 553 HOH HOH A . E 4 HOH 23 423 534 HOH HOH A . E 4 HOH 24 424 506 HOH HOH A . E 4 HOH 25 425 560 HOH HOH A . E 4 HOH 26 426 572 HOH HOH A . E 4 HOH 27 427 527 HOH HOH A . E 4 HOH 28 428 528 HOH HOH A . E 4 HOH 29 429 539 HOH HOH A . E 4 HOH 30 430 531 HOH HOH A . E 4 HOH 31 431 556 HOH HOH A . E 4 HOH 32 432 504 HOH HOH A . E 4 HOH 33 433 523 HOH HOH A . E 4 HOH 34 434 540 HOH HOH A . E 4 HOH 35 435 566 HOH HOH A . E 4 HOH 36 436 519 HOH HOH A . E 4 HOH 37 437 541 HOH HOH A . E 4 HOH 38 438 551 HOH HOH A . E 4 HOH 39 439 511 HOH HOH A . E 4 HOH 40 440 552 HOH HOH A . E 4 HOH 41 441 510 HOH HOH A . E 4 HOH 42 442 501 HOH HOH A . E 4 HOH 43 443 536 HOH HOH A . E 4 HOH 44 444 571 HOH HOH A . E 4 HOH 45 445 508 HOH HOH A . E 4 HOH 46 446 512 HOH HOH A . E 4 HOH 47 447 517 HOH HOH A . E 4 HOH 48 448 524 HOH HOH A . E 4 HOH 49 449 565 HOH HOH A . E 4 HOH 50 450 509 HOH HOH A . E 4 HOH 51 451 537 HOH HOH A . E 4 HOH 52 452 526 HOH HOH A . E 4 HOH 53 453 513 HOH HOH A . E 4 HOH 54 454 547 HOH HOH A . E 4 HOH 55 455 516 HOH HOH A . E 4 HOH 56 456 568 HOH HOH A . E 4 HOH 57 457 554 HOH HOH A . E 4 HOH 58 458 548 HOH HOH A . E 4 HOH 59 459 546 HOH HOH A . E 4 HOH 60 460 533 HOH HOH A . E 4 HOH 61 461 542 HOH HOH A . E 4 HOH 62 462 514 HOH HOH A . E 4 HOH 63 463 561 HOH HOH A . E 4 HOH 64 464 521 HOH HOH A . E 4 HOH 65 465 549 HOH HOH A . E 4 HOH 66 466 505 HOH HOH A . E 4 HOH 67 467 563 HOH HOH A . E 4 HOH 68 468 555 HOH HOH A . E 4 HOH 69 469 570 HOH HOH A . E 4 HOH 70 470 567 HOH HOH A . E 4 HOH 71 471 530 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9040 ? 1 MORE -46 ? 1 'SSA (A^2)' 38660 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 105.8530000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 11_655 -x+y+1,y,-z -1.0000000000 0.0000000000 0.0000000000 105.8530000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 434 ? E HOH . 2 1 A HOH 471 ? E HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 90 ? A HIS 105 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 92 ? A HIS 107 ? 1_555 94.2 ? 2 NE2 ? A HIS 90 ? A HIS 105 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 166 ? A HIS 181 ? 1_555 100.0 ? 3 ND1 ? A HIS 92 ? A HIS 107 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 166 ? A HIS 181 ? 1_555 105.5 ? 4 NE2 ? A HIS 90 ? A HIS 105 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O10 ? D XQP . ? A XQP 303 ? 1_555 171.7 ? 5 ND1 ? A HIS 92 ? A HIS 107 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O10 ? D XQP . ? A XQP 303 ? 1_555 92.4 ? 6 NE2 ? A HIS 166 ? A HIS 181 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O10 ? D XQP . ? A XQP 303 ? 1_555 83.0 ? 7 NE2 ? A HIS 90 ? A HIS 105 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 98.8 ? 8 ND1 ? A HIS 92 ? A HIS 107 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 108.6 ? 9 NE2 ? A HIS 166 ? A HIS 181 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 139.4 ? 10 O10 ? D XQP . ? A XQP 303 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 74.2 ? 11 OD2 ? A ASP 94 ? A ASP 109 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 95 ? A HIS 110 ? 1_555 89.8 ? 12 OD2 ? A ASP 94 ? A ASP 109 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 231 ? A HIS 246 ? 1_555 87.8 ? 13 NE2 ? A HIS 95 ? A HIS 110 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 231 ? A HIS 246 ? 1_555 100.2 ? 14 OD2 ? A ASP 94 ? A ASP 109 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N1 ? D XQP . ? A XQP 303 ? 1_555 100.4 ? 15 NE2 ? A HIS 95 ? A HIS 110 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N1 ? D XQP . ? A XQP 303 ? 1_555 168.9 ? 16 NE2 ? A HIS 231 ? A HIS 246 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N1 ? D XQP . ? A XQP 303 ? 1_555 84.6 ? 17 OD2 ? A ASP 94 ? A ASP 109 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O8 ? D XQP . ? A XQP 303 ? 1_555 168.5 ? 18 NE2 ? A HIS 95 ? A HIS 110 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O8 ? D XQP . ? A XQP 303 ? 1_555 100.9 ? 19 NE2 ? A HIS 231 ? A HIS 246 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O8 ? D XQP . ? A XQP 303 ? 1_555 86.1 ? 20 N1 ? D XQP . ? A XQP 303 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O8 ? D XQP . ? A XQP 303 ? 1_555 69.3 ? 21 OD2 ? A ASP 94 ? A ASP 109 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 88.8 ? 22 NE2 ? A HIS 95 ? A HIS 110 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 93.6 ? 23 NE2 ? A HIS 231 ? A HIS 246 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 165.8 ? 24 N1 ? D XQP . ? A XQP 303 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 82.5 ? 25 O8 ? D XQP . ? A XQP 303 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? E HOH . ? A HOH 402 ? 1_555 94.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-09 2 'Structure model' 2 0 2022-03-16 3 'Structure model' 2 1 2023-02-08 4 'Structure model' 2 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Polymer sequence' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_poly 2 2 'Structure model' pdbx_database_related 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_poly.pdbx_target_identifier' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+2/3 3 y,-x+y,z+1/3 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z 9 y,x,-z+1/3 10 -y,-x,-z+1/3 11 -x+y,y,-z 12 x,x-y,-z+2/3 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 30.4508862966 13.5243571463 9.49503885883 0.182458026909 ? 0.0447375138845 ? 0.0135142954591 ? 0.147804575337 ? 0.0226777686488 ? 0.163113062461 ? 0.884247699429 ? 0.478030677351 ? 0.707218381049 ? 4.47271069143 ? 2.96365802467 ? 2.67880921031 ? -0.0698200795917 ? -0.161504979516 ? 0.283531398528 ? 0.131461188954 ? -0.122434465015 ? 0.628268717533 ? -0.12907919698 ? -0.362434779628 ? 0.197625701985 ? 2 'X-RAY DIFFRACTION' ? refined 42.3843206945 13.8867325117 6.55505421446 0.126686597109 ? 0.0035262582183 ? -0.0140339214699 ? 0.129547771379 ? -0.0156366737013 ? 0.142788594645 ? 1.20955156991 ? -0.664457032007 ? -0.0866726036024 ? 3.43691223134 ? -0.111052350673 ? 1.99054886681 ? -0.0178769009986 ? 0.0657983029273 ? 0.0767924172519 ? -0.177405785875 ? -0.0654247970845 ? -0.0630284086637 ? -0.0797954097192 ? -0.0479071771744 ? 0.0615913422316 ? 3 'X-RAY DIFFRACTION' ? refined 47.2510695409 14.5362294271 17.0511009909 0.21077396934 ? 0.0469258023955 ? -0.0334747101166 ? 0.0872691233907 ? -0.00537329953038 ? 0.209719666725 ? 1.0654802023 ? -0.146341673998 ? 0.21351461099 ? 1.42479508858 ? 0.0440115808103 ? 0.933898337071 ? -0.117652535645 ? 0.0190779732257 ? 0.210069859601 ? 0.163941113688 ? -0.0431472728342 ? -0.0261171151425 ? -0.18767582117 ? -0.038380221544 ? 0.107688465051 ? 4 'X-RAY DIFFRACTION' ? refined 39.2729220568 -4.98211663731 21.8939986813 0.25934009181 ? -0.00563759823998 ? 0.0506594208158 ? 0.0960149820997 ? 0.0136103353823 ? 0.238871743471 ? 4.3176071517 ? 1.23859625548 ? 0.648456504072 ? 7.74825594961 ? -0.832072056872 ? 1.17719392105 ? -0.0532810548789 ? 0.209704668875 ? -0.361602656407 ? 0.235526611274 ? 0.103399825789 ? 0.653665037272 ? -0.0866907911869 ? -0.0585617358125 ? -0.0477370900467 ? 5 'X-RAY DIFFRACTION' ? refined 43.5725948792 2.21378425078 29.0451813172 0.373643796008 ? 0.0684225351693 ? 0.0160969378706 ? 0.130341485831 ? -0.000443372016605 ? 0.160245446611 ? 8.38684104057 ? 4.9436791343 ? 1.87328508121 ? 5.41522283584 ? 1.13505218161 ? 0.443033117921 ? -0.390864584048 ? -0.321700232246 ? -0.160443280735 ? 0.447114226044 ? 0.313223685905 ? 0.0410624441786 ? 0.502896946889 ? 0.0628713423758 ? 0.127402884971 ? 6 'X-RAY DIFFRACTION' ? refined 33.5700867704 19.6324947831 23.9651668128 0.293466272904 ? 0.0951283288195 ? 0.0256400739086 ? 0.2030820413 ? -0.0324980621164 ? 0.292422755432 ? 1.064324884 ? 0.323311714091 ? 0.187494038707 ? 4.56896416732 ? 0.00568799544418 ? 2.1673231892 ? 0.0995420415179 ? -0.241020752413 ? 0.469330972527 ? 0.000358545039934 ? 0.114819919484 ? 0.0688621638052 ? -0.516314052197 ? -0.314623845107 ? -0.211856360133 ? 7 'X-RAY DIFFRACTION' ? refined 33.691150085 1.24940985189 31.1335949447 0.298880184271 ? 0.0857650974391 ? 0.0770025649575 ? 0.302864994114 ? -0.00929464583266 ? 0.175105072882 ? 6.33588172974 ? 0.0822920122726 ? -1.35594843812 ? 4.82897955803 ? -0.890102172635 ? 7.04839380927 ? -0.311481003217 ? -0.215519337633 ? -0.195663276654 ? 0.783540738298 ? 0.326635087754 ? 0.351967106459 ? 0.363316245766 ? -0.528722328149 ? 0.0191399517293 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 24 through 61 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 62 through 146 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 147 through 204 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 205 through 222 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 223 through 235 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 236 through 266 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 267 through 287 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? Precognition ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Epinorm ? ? ? . 4 # _pdbx_entry_details.entry_id 7L91 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 74 ? ? 67.75 157.49 2 1 ALA A 106 ? ? -92.41 55.37 3 1 HIS A 110 ? ? -133.14 -31.52 4 1 ASP A 192 ? ? -112.42 -167.41 5 1 PRO A 210 ? ? -66.91 99.75 6 1 TYR A 220 ? ? -157.68 70.63 7 1 LYS A 259 ? ? -75.10 23.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 16 ? A SER 1 2 1 Y 1 A ASN 17 ? A ASN 2 3 1 Y 1 A ALA 18 ? A ALA 3 4 1 Y 1 A ALA 19 ? A ALA 4 5 1 Y 1 A SER 20 ? A SER 5 6 1 Y 1 A ALA 21 ? A ALA 6 7 1 Y 1 A ALA 22 ? A ALA 7 8 1 Y 1 A GLU 23 ? A GLU 8 9 1 Y 1 A GLY 288 ? A GLY 273 10 1 Y 1 A THR 289 ? A THR 274 11 1 Y 1 A ARG 290 ? A ARG 275 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 XQP C1 C N N 391 XQP O1 O N N 392 XQP C2 C N N 393 XQP N2 N N N 394 XQP C3 C N N 395 XQP O4 O N N 396 XQP C5 C N R 397 XQP C6 C N R 398 XQP C7 C N N 399 XQP C8 C N N 400 XQP C9 C N R 401 XQP C10 C Y N 402 XQP C11 C Y N 403 XQP C12 C Y N 404 XQP C13 C Y N 405 XQP C14 C Y N 406 XQP C15 C Y N 407 XQP C16 C N N 408 XQP C17 C N N 409 XQP C18 C Y N 410 XQP C19 C N N 411 XQP C20 C N N 412 XQP C4 C N N 413 XQP N1 N N N 414 XQP N3 N Y N 415 XQP N4 N Y N 416 XQP N5 N Y N 417 XQP N6 N Y N 418 XQP O10 O N N 419 XQP O2 O N N 420 XQP O3 O N N 421 XQP O5 O N N 422 XQP O6 O N N 423 XQP O7 O N N 424 XQP O8 O N N 425 XQP O9 O N N 426 XQP S1 S N N 427 XQP H1 H N N 428 XQP H2 H N N 429 XQP H4 H N N 430 XQP H5 H N N 431 XQP H6 H N N 432 XQP H7 H N N 433 XQP H8 H N N 434 XQP H9 H N N 435 XQP H10 H N N 436 XQP H11 H N N 437 XQP H12 H N N 438 XQP H13 H N N 439 XQP H14 H N N 440 XQP H15 H N N 441 XQP H16 H N N 442 XQP H17 H N N 443 XQP H18 H N N 444 XQP H19 H N N 445 XQP H20 H N N 446 XQP H21 H N N 447 XQP H22 H N N 448 XQP H3 H N N 449 ZN ZN ZN N N 450 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 XQP O5 C13 sing N N 376 XQP C12 C13 doub Y N 377 XQP C12 C11 sing Y N 378 XQP C13 C14 sing Y N 379 XQP C11 C10 doub Y N 380 XQP C14 C15 doub Y N 381 XQP C10 C15 sing Y N 382 XQP C10 C9 sing N N 383 XQP C7 O3 sing N N 384 XQP O4 C8 doub N N 385 XQP O3 C6 sing N N 386 XQP C8 C9 sing N N 387 XQP C8 N2 sing N N 388 XQP C9 C16 sing N N 389 XQP N2 C6 sing N N 390 XQP C6 C5 sing N N 391 XQP C6 C1 sing N N 392 XQP C16 O7 doub N N 393 XQP C16 O6 sing N N 394 XQP C5 O2 sing N N 395 XQP C5 N1 sing N N 396 XQP O10 C1 doub N N 397 XQP C1 O1 sing N N 398 XQP O2 C4 sing N N 399 XQP N1 C2 sing N N 400 XQP C4 C3 sing N N 401 XQP C2 C3 doub N N 402 XQP C2 C20 sing N N 403 XQP O8 C20 doub N N 404 XQP C3 C17 sing N N 405 XQP C20 O9 sing N N 406 XQP N4 N3 sing Y N 407 XQP N4 N5 doub Y N 408 XQP N3 C18 doub Y N 409 XQP N5 N6 sing Y N 410 XQP C17 S1 sing N N 411 XQP C18 N6 sing Y N 412 XQP C18 S1 sing N N 413 XQP N6 C19 sing N N 414 XQP O1 H1 sing N N 415 XQP N2 H2 sing N N 416 XQP C5 H4 sing N N 417 XQP C7 H5 sing N N 418 XQP C7 H6 sing N N 419 XQP C7 H7 sing N N 420 XQP C9 H8 sing N N 421 XQP C11 H9 sing N N 422 XQP C12 H10 sing N N 423 XQP C14 H11 sing N N 424 XQP C15 H12 sing N N 425 XQP C17 H13 sing N N 426 XQP C17 H14 sing N N 427 XQP C19 H15 sing N N 428 XQP C19 H16 sing N N 429 XQP C19 H17 sing N N 430 XQP C4 H18 sing N N 431 XQP C4 H19 sing N N 432 XQP O5 H20 sing N N 433 XQP O6 H21 sing N N 434 XQP O9 H22 sing N N 435 XQP N1 H3 sing N N 436 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 XQP ? ? XQP ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 ;(2R)-2-[(R)-carboxy{[(2R)-2-carboxy-2-(4-hydroxyphenyl)acetyl]amino}methoxymethyl]-5-{[(1-methyl-1H-tetrazol-5-yl)sulfanyl]methyl}-3,6-dihydro-2H-1,3-oxazine-4-carboxylic acid ; XQP 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7L52 _pdbx_initial_refinement_model.details ? # _pdbx_serial_crystallography_data_reduction.diffrn_id 1 _pdbx_serial_crystallography_data_reduction.frames_total 19316 _pdbx_serial_crystallography_data_reduction.xfel_pulse_events ? _pdbx_serial_crystallography_data_reduction.frame_hits ? _pdbx_serial_crystallography_data_reduction.crystal_hits 7816 _pdbx_serial_crystallography_data_reduction.droplet_hits ? _pdbx_serial_crystallography_data_reduction.frames_failed_index ? _pdbx_serial_crystallography_data_reduction.frames_indexed 583 _pdbx_serial_crystallography_data_reduction.lattices_indexed ? _pdbx_serial_crystallography_data_reduction.xfel_run_numbers ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description 'Nylon Mesh' _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _pdbx_serial_crystallography_sample_delivery_fixed_target.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery_fixed_target.description 'ALEX mesh holder' _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_holding 'nylon mesh' _pdbx_serial_crystallography_sample_delivery_fixed_target.support_base 'xyz stage' _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_unit_size ? _pdbx_serial_crystallography_sample_delivery_fixed_target.crystals_per_unit ? _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_solvent 'buffer 0.0075 Tris, 0.05 M KCl, 0.75 mM TCEP, 2.5 mM ZnCl2, 0.075 M sodium malonate pH 8.0, 10% (w/v) PEG3350' _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_dehydration_prevention ? _pdbx_serial_crystallography_sample_delivery_fixed_target.motion_control 'SmarAct Motors viaPMAC start/stop raster over area' _pdbx_serial_crystallography_sample_delivery_fixed_target.velocity_horizontal ? _pdbx_serial_crystallography_sample_delivery_fixed_target.velocity_vertical ? _pdbx_serial_crystallography_sample_delivery_fixed_target.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details tetramer # _space_group.name_H-M_alt 'P 64 2 2' _space_group.name_Hall 'P 64 2 (x,y,z+1/6)' _space_group.IT_number 181 _space_group.crystal_system hexagonal _space_group.id 1 #