data_7LWE # _entry.id 7LWE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7LWE pdb_00007lwe 10.2210/pdb7lwe/pdb WWPDB D_1000255088 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7LWE _pdbx_database_status.recvd_initial_deposition_date 2021-03-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kuntz, D.A.' 1 0000-0003-3584-4804 'Prive, G.G.' 2 0000-0002-0712-4319 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 199 _citation.page_last 210 _citation.title 'Discovery of OICR12694: A Novel, Potent, Selective, and Orally Bioavailable BCL6 BTB Inhibitor.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.2c00502 _citation.pdbx_database_id_PubMed 36793435 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mamai, A.' 1 ? primary 'Chau, A.M.' 2 ? primary 'Wilson, B.J.' 3 ? primary 'Watson, I.D.' 4 ? primary 'Joseph, B.B.' 5 ? primary 'Subramanian, P.R.' 6 ? primary 'Morshed, M.M.' 7 ? primary 'Morin, J.A.' 8 ? primary 'Prakesch, M.A.' 9 ? primary 'Lu, T.' 10 ? primary 'Connolly, P.' 11 ? primary 'Kuntz, D.A.' 12 ? primary 'Pomroy, N.C.' 13 ? primary 'Poda, G.' 14 ? primary 'Nguyen, K.' 15 ? primary 'Marcellus, R.' 16 ? primary 'Strathdee, G.' 17 ? primary 'Theriault, B.' 18 ? primary 'Subramaniam, R.' 19 ? primary 'Mohammed, M.' 20 ? primary 'Abibi, A.' 21 ? primary 'Chan, M.' 22 ? primary 'Winston, J.' 23 ? primary 'Kiyota, T.' 24 ? primary 'Undzys, E.' 25 ? primary 'Aman, A.' 26 ? primary 'Austin, N.' 27 ? primary 'Du Jardin, M.' 28 ? primary 'Packman, K.' 29 ? primary 'Phillippar, U.' 30 ? primary 'Attar, R.' 31 ? primary 'Edwards, J.' 32 ? primary ;O'Meara, J. ; 33 ? primary 'Uehling, D.E.' 34 ? primary 'Al-Awar, R.' 35 ? primary 'Prive, G.G.' 36 ? primary 'Isaac, M.B.' 37 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 104.875 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7LWE _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.606 _cell.length_a_esd ? _cell.length_b 72.113 _cell.length_b_esd ? _cell.length_c 55.044 _cell.length_c_esd ? _cell.volume 117415.835 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7LWE _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'B-cell lymphoma 6 protein' 14802.160 1 ? 'C8Q, C67R, C84N' 'BTB domain, residues 1-129' ? 2 non-polymer syn 'N-(3-chloropyridin-4-yl)-2-(3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)acetamide' 317.730 1 ? ? ? ? 3 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 4 non-polymer syn 'ACETATE ION' 59.044 2 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 148 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BCL-6,B-cell lymphoma 5 protein,BCL-5,Protein LAZ-3,Zinc finger and BTB domain-containing protein 27,Zinc finger protein 51' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASPADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINP EGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE ; _entity_poly.pdbx_seq_one_letter_code_can ;MASPADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINP EGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 PRO n 1 5 ALA n 1 6 ASP n 1 7 SER n 1 8 GLN n 1 9 ILE n 1 10 GLN n 1 11 PHE n 1 12 THR n 1 13 ARG n 1 14 HIS n 1 15 ALA n 1 16 SER n 1 17 ASP n 1 18 VAL n 1 19 LEU n 1 20 LEU n 1 21 ASN n 1 22 LEU n 1 23 ASN n 1 24 ARG n 1 25 LEU n 1 26 ARG n 1 27 SER n 1 28 ARG n 1 29 ASP n 1 30 ILE n 1 31 LEU n 1 32 THR n 1 33 ASP n 1 34 VAL n 1 35 VAL n 1 36 ILE n 1 37 VAL n 1 38 VAL n 1 39 SER n 1 40 ARG n 1 41 GLU n 1 42 GLN n 1 43 PHE n 1 44 ARG n 1 45 ALA n 1 46 HIS n 1 47 LYS n 1 48 THR n 1 49 VAL n 1 50 LEU n 1 51 MET n 1 52 ALA n 1 53 CYS n 1 54 SER n 1 55 GLY n 1 56 LEU n 1 57 PHE n 1 58 TYR n 1 59 SER n 1 60 ILE n 1 61 PHE n 1 62 THR n 1 63 ASP n 1 64 GLN n 1 65 LEU n 1 66 LYS n 1 67 ARG n 1 68 ASN n 1 69 LEU n 1 70 SER n 1 71 VAL n 1 72 ILE n 1 73 ASN n 1 74 LEU n 1 75 ASP n 1 76 PRO n 1 77 GLU n 1 78 ILE n 1 79 ASN n 1 80 PRO n 1 81 GLU n 1 82 GLY n 1 83 PHE n 1 84 ASN n 1 85 ILE n 1 86 LEU n 1 87 LEU n 1 88 ASP n 1 89 PHE n 1 90 MET n 1 91 TYR n 1 92 THR n 1 93 SER n 1 94 ARG n 1 95 LEU n 1 96 ASN n 1 97 LEU n 1 98 ARG n 1 99 GLU n 1 100 GLY n 1 101 ASN n 1 102 ILE n 1 103 MET n 1 104 ALA n 1 105 VAL n 1 106 MET n 1 107 ALA n 1 108 THR n 1 109 ALA n 1 110 MET n 1 111 TYR n 1 112 LEU n 1 113 GLN n 1 114 MET n 1 115 GLU n 1 116 HIS n 1 117 VAL n 1 118 VAL n 1 119 ASP n 1 120 THR n 1 121 CYS n 1 122 ARG n 1 123 LYS n 1 124 PHE n 1 125 ILE n 1 126 LYS n 1 127 ALA n 1 128 SER n 1 129 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 129 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL6, BCL5, LAZ3, ZBTB27, ZNF51' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BCL6_HUMAN _struct_ref.pdbx_db_accession P41182 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEINP EGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7LWE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P41182 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 129 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7LWE GLN A 8 ? UNP P41182 CYS 8 'engineered mutation' 8 1 1 7LWE ARG A 67 ? UNP P41182 CYS 67 'engineered mutation' 67 2 1 7LWE ASN A 84 ? UNP P41182 CYS 84 'engineered mutation' 84 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YND non-polymer . 'N-(3-chloropyridin-4-yl)-2-(3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)acetamide' ? 'C14 H12 Cl N5 O2' 317.730 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7LWE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2 M Ammonium sulfate, 0.1 M citrate pH 5.6 with 0.5 mM compound' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-10-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 11.92 _reflns.entry_id 7LWE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.17 _reflns.d_resolution_low 53.2 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 37874 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.65 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.0 _reflns.pdbx_Rmerge_I_obs 0.023 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.031 _reflns.pdbx_Rpim_I_all 0.017 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.17 _reflns_shell.d_res_low 1.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4717 _reflns_shell.percent_possible_all 82.73 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.147 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.204 _reflns_shell.pdbx_Rpim_I_all 0.135 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.90 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 17.84 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7LWE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.17 _refine.ls_d_res_low 29.85 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 37866 _refine.ls_number_reflns_R_free 1864 _refine.ls_number_reflns_R_work 36002 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.65 _refine.ls_percent_reflns_R_free 4.92 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1162 _refine.ls_R_factor_R_free 0.1313 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1154 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3LBZ _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 11.0778 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0606 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.17 _refine_hist.d_res_low 29.85 _refine_hist.number_atoms_solvent 148 _refine_hist.number_atoms_total 1192 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1010 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0162 ? 1122 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.5108 ? 1522 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0872 ? 176 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0070 ? 196 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.8458 ? 424 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.17 1.20 . . 110 2147 75.03 . . . 0.1826 . 0.1556 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.20 1.23 . . 137 2595 91.71 . . . 0.1938 . 0.1413 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.23 1.27 . . 137 2862 99.21 . . . 0.1517 . 0.1299 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.27 1.32 . . 161 2828 99.77 . . . 0.1376 . 0.1168 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.32 1.37 . . 159 2841 99.77 . . . 0.1344 . 0.1087 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.37 1.43 . . 153 2843 99.80 . . . 0.1311 . 0.0984 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.43 1.51 . . 155 2851 99.27 . . . 0.1193 . 0.0941 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.51 1.60 . . 131 2851 99.37 . . . 0.1112 . 0.0918 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.60 1.73 . . 152 2824 99.30 . . . 0.1120 . 0.0917 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.73 1.90 . . 134 2862 99.24 . . . 0.1377 . 0.0955 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.90 2.18 . . 150 2853 98.85 . . . 0.1276 . 0.0980 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.18 2.74 . . 145 2816 98.44 . . . 0.1190 . 0.1121 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.74 29.85 . . 140 2829 96.71 . . . 0.1380 . 0.1401 . . . . . . . . . . . # _struct.entry_id 7LWE _struct.title 'Crystal structure of the BCL6 BTB domain in complex with OICR-7629' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7LWE _struct_keywords.text 'immunity, inflammatory response, transcription repressor, TRANSCRIPTION-INHIBITOR complex' _struct_keywords.pdbx_keywords TRANSCRIPTION/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 4 ? GLN A 8 ? PRO A 4 GLN A 8 5 ? 5 HELX_P HELX_P2 AA2 ARG A 13 ? ARG A 28 ? ARG A 13 ARG A 28 1 ? 16 HELX_P HELX_P3 AA3 HIS A 46 ? SER A 54 ? HIS A 46 SER A 54 1 ? 9 HELX_P HELX_P4 AA4 SER A 54 ? ASP A 63 ? SER A 54 ASP A 63 1 ? 10 HELX_P HELX_P5 AA5 ASN A 79 ? SER A 93 ? ASN A 79 SER A 93 1 ? 15 HELX_P HELX_P6 AA6 ASN A 101 ? GLN A 113 ? ASN A 101 GLN A 113 1 ? 13 HELX_P HELX_P7 AA7 MET A 114 ? SER A 128 ? MET A 114 SER A 128 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 41 ? ALA A 45 ? GLU A 41 ALA A 45 AA1 2 VAL A 34 ? VAL A 38 ? VAL A 34 VAL A 38 AA1 3 VAL A 71 ? ASN A 73 ? VAL A 71 ASN A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 43 ? O PHE A 43 N ILE A 36 ? N ILE A 36 AA1 2 3 N VAL A 37 ? N VAL A 37 O ILE A 72 ? O ILE A 72 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A YND 201 ? 14 'binding site for residue YND A 201' AC2 Software A FMT 202 ? 5 'binding site for residue FMT A 202' AC3 Software A ACT 203 ? 4 'binding site for residue ACT A 203' AC4 Software A ACT 204 ? 3 'binding site for residue ACT A 204' AC5 Software A CL 205 ? 4 'binding site for residue CL A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ASN A 21 ? ASN A 21 . ? 2_455 ? 2 AC1 14 ARG A 24 ? ARG A 24 . ? 2_455 ? 3 AC1 14 LEU A 25 ? LEU A 25 . ? 2_455 ? 4 AC1 14 MET A 51 ? MET A 51 . ? 1_555 ? 5 AC1 14 ALA A 52 ? ALA A 52 . ? 1_555 ? 6 AC1 14 CYS A 53 ? CYS A 53 . ? 1_555 ? 7 AC1 14 GLY A 55 ? GLY A 55 . ? 1_555 ? 8 AC1 14 TYR A 58 ? TYR A 58 . ? 1_555 ? 9 AC1 14 GLN A 113 ? GLN A 113 . ? 1_555 ? 10 AC1 14 GLU A 115 ? GLU A 115 . ? 1_555 ? 11 AC1 14 ACT D . ? ACT A 203 . ? 1_555 ? 12 AC1 14 HOH G . ? HOH A 322 . ? 1_555 ? 13 AC1 14 HOH G . ? HOH A 336 . ? 1_555 ? 14 AC1 14 HOH G . ? HOH A 375 . ? 1_455 ? 15 AC2 5 HIS A 14 ? HIS A 14 . ? 1_555 ? 16 AC2 5 PHE A 89 ? PHE A 89 . ? 2_455 ? 17 AC2 5 HOH G . ? HOH A 340 . ? 1_555 ? 18 AC2 5 HOH G . ? HOH A 369 . ? 2_455 ? 19 AC2 5 HOH G . ? HOH A 399 . ? 2_455 ? 20 AC3 4 TYR A 58 ? TYR A 58 . ? 1_555 ? 21 AC3 4 YND B . ? YND A 201 . ? 1_555 ? 22 AC3 4 HOH G . ? HOH A 351 . ? 1_455 ? 23 AC3 4 HOH G . ? HOH A 413 . ? 1_555 ? 24 AC4 3 ILE A 9 ? ILE A 9 . ? 2_455 ? 25 AC4 3 PHE A 11 ? PHE A 11 . ? 2_455 ? 26 AC4 3 THR A 120 ? THR A 120 . ? 1_555 ? 27 AC5 4 LEU A 31 ? LEU A 31 . ? 2_455 ? 28 AC5 4 ARG A 67 ? ARG A 67 . ? 1_555 ? 29 AC5 4 HOH G . ? HOH A 393 . ? 2_455 ? 30 AC5 4 HOH G . ? HOH A 424 . ? 1_555 ? # _atom_sites.entry_id 7LWE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.032673 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008678 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013867 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018797 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 4.31557 2.79156 1.86576 ? 8.03600 32.36470 0.29580 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLU 129 129 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 YND 1 201 201 YND 629 A . C 3 FMT 1 202 202 FMT FMT A . D 4 ACT 1 203 203 ACT ACT A . E 4 ACT 1 204 204 ACT ACT A . F 5 CL 1 205 205 CL CL A . G 6 HOH 1 301 444 HOH HOH A . G 6 HOH 2 302 331 HOH HOH A . G 6 HOH 3 303 426 HOH HOH A . G 6 HOH 4 304 381 HOH HOH A . G 6 HOH 5 305 361 HOH HOH A . G 6 HOH 6 306 439 HOH HOH A . G 6 HOH 7 307 315 HOH HOH A . G 6 HOH 8 308 382 HOH HOH A . G 6 HOH 9 309 450 HOH HOH A . G 6 HOH 10 310 414 HOH HOH A . G 6 HOH 11 311 358 HOH HOH A . G 6 HOH 12 312 322 HOH HOH A . G 6 HOH 13 313 405 HOH HOH A . G 6 HOH 14 314 415 HOH HOH A . G 6 HOH 15 315 398 HOH HOH A . G 6 HOH 16 316 321 HOH HOH A . G 6 HOH 17 317 401 HOH HOH A . G 6 HOH 18 318 396 HOH HOH A . G 6 HOH 19 319 303 HOH HOH A . G 6 HOH 20 320 448 HOH HOH A . G 6 HOH 21 321 384 HOH HOH A . G 6 HOH 22 322 430 HOH HOH A . G 6 HOH 23 323 344 HOH HOH A . G 6 HOH 24 324 403 HOH HOH A . G 6 HOH 25 325 428 HOH HOH A . G 6 HOH 26 326 437 HOH HOH A . G 6 HOH 27 327 345 HOH HOH A . G 6 HOH 28 328 349 HOH HOH A . G 6 HOH 29 329 379 HOH HOH A . G 6 HOH 30 330 376 HOH HOH A . G 6 HOH 31 331 357 HOH HOH A . G 6 HOH 32 332 362 HOH HOH A . G 6 HOH 33 333 340 HOH HOH A . G 6 HOH 34 334 335 HOH HOH A . G 6 HOH 35 335 394 HOH HOH A . G 6 HOH 36 336 442 HOH HOH A . G 6 HOH 37 337 305 HOH HOH A . G 6 HOH 38 338 408 HOH HOH A . G 6 HOH 39 339 332 HOH HOH A . G 6 HOH 40 340 423 HOH HOH A . G 6 HOH 41 341 310 HOH HOH A . G 6 HOH 42 342 313 HOH HOH A . G 6 HOH 43 343 355 HOH HOH A . G 6 HOH 44 344 375 HOH HOH A . G 6 HOH 45 345 360 HOH HOH A . G 6 HOH 46 346 429 HOH HOH A . G 6 HOH 47 347 370 HOH HOH A . G 6 HOH 48 348 417 HOH HOH A . G 6 HOH 49 349 438 HOH HOH A . G 6 HOH 50 350 334 HOH HOH A . G 6 HOH 51 351 432 HOH HOH A . G 6 HOH 52 352 301 HOH HOH A . G 6 HOH 53 353 308 HOH HOH A . G 6 HOH 54 354 309 HOH HOH A . G 6 HOH 55 355 307 HOH HOH A . G 6 HOH 56 356 431 HOH HOH A . G 6 HOH 57 357 422 HOH HOH A . G 6 HOH 58 358 393 HOH HOH A . G 6 HOH 59 359 338 HOH HOH A . G 6 HOH 60 360 326 HOH HOH A . G 6 HOH 61 361 333 HOH HOH A . G 6 HOH 62 362 320 HOH HOH A . G 6 HOH 63 363 373 HOH HOH A . G 6 HOH 64 364 304 HOH HOH A . G 6 HOH 65 365 416 HOH HOH A . G 6 HOH 66 366 390 HOH HOH A . G 6 HOH 67 367 395 HOH HOH A . G 6 HOH 68 368 339 HOH HOH A . G 6 HOH 69 369 352 HOH HOH A . G 6 HOH 70 370 343 HOH HOH A . G 6 HOH 71 371 441 HOH HOH A . G 6 HOH 72 372 312 HOH HOH A . G 6 HOH 73 373 402 HOH HOH A . G 6 HOH 74 374 330 HOH HOH A . G 6 HOH 75 375 324 HOH HOH A . G 6 HOH 76 376 420 HOH HOH A . G 6 HOH 77 377 436 HOH HOH A . G 6 HOH 78 378 374 HOH HOH A . G 6 HOH 79 379 404 HOH HOH A . G 6 HOH 80 380 400 HOH HOH A . G 6 HOH 81 381 302 HOH HOH A . G 6 HOH 82 382 445 HOH HOH A . G 6 HOH 83 383 369 HOH HOH A . G 6 HOH 84 384 364 HOH HOH A . G 6 HOH 85 385 359 HOH HOH A . G 6 HOH 86 386 356 HOH HOH A . G 6 HOH 87 387 365 HOH HOH A . G 6 HOH 88 388 433 HOH HOH A . G 6 HOH 89 389 354 HOH HOH A . G 6 HOH 90 390 317 HOH HOH A . G 6 HOH 91 391 397 HOH HOH A . G 6 HOH 92 392 424 HOH HOH A . G 6 HOH 93 393 366 HOH HOH A . G 6 HOH 94 394 378 HOH HOH A . G 6 HOH 95 395 341 HOH HOH A . G 6 HOH 96 396 418 HOH HOH A . G 6 HOH 97 397 372 HOH HOH A . G 6 HOH 98 398 387 HOH HOH A . G 6 HOH 99 399 351 HOH HOH A . G 6 HOH 100 400 386 HOH HOH A . G 6 HOH 101 401 407 HOH HOH A . G 6 HOH 102 402 336 HOH HOH A . G 6 HOH 103 403 314 HOH HOH A . G 6 HOH 104 404 406 HOH HOH A . G 6 HOH 105 405 353 HOH HOH A . G 6 HOH 106 406 412 HOH HOH A . G 6 HOH 107 407 419 HOH HOH A . G 6 HOH 108 408 427 HOH HOH A . G 6 HOH 109 409 421 HOH HOH A . G 6 HOH 110 410 327 HOH HOH A . G 6 HOH 111 411 399 HOH HOH A . G 6 HOH 112 412 367 HOH HOH A . G 6 HOH 113 413 325 HOH HOH A . G 6 HOH 114 414 337 HOH HOH A . G 6 HOH 115 415 383 HOH HOH A . G 6 HOH 116 416 319 HOH HOH A . G 6 HOH 117 417 385 HOH HOH A . G 6 HOH 118 418 377 HOH HOH A . G 6 HOH 119 419 391 HOH HOH A . G 6 HOH 120 420 323 HOH HOH A . G 6 HOH 121 421 380 HOH HOH A . G 6 HOH 122 422 434 HOH HOH A . G 6 HOH 123 423 316 HOH HOH A . G 6 HOH 124 424 368 HOH HOH A . G 6 HOH 125 425 346 HOH HOH A . G 6 HOH 126 426 411 HOH HOH A . G 6 HOH 127 427 347 HOH HOH A . G 6 HOH 128 428 342 HOH HOH A . G 6 HOH 129 429 447 HOH HOH A . G 6 HOH 130 430 413 HOH HOH A . G 6 HOH 131 431 328 HOH HOH A . G 6 HOH 132 432 449 HOH HOH A . G 6 HOH 133 433 388 HOH HOH A . G 6 HOH 134 434 306 HOH HOH A . G 6 HOH 135 435 440 HOH HOH A . G 6 HOH 136 436 329 HOH HOH A . G 6 HOH 137 437 350 HOH HOH A . G 6 HOH 138 438 318 HOH HOH A . G 6 HOH 139 439 443 HOH HOH A . G 6 HOH 140 440 389 HOH HOH A . G 6 HOH 141 441 371 HOH HOH A . G 6 HOH 142 442 363 HOH HOH A . G 6 HOH 143 443 410 HOH HOH A . G 6 HOH 144 444 392 HOH HOH A . G 6 HOH 145 445 425 HOH HOH A . G 6 HOH 146 446 435 HOH HOH A . G 6 HOH 147 447 348 HOH HOH A . G 6 HOH 148 448 409 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5450 ? 1 MORE -55 ? 1 'SSA (A^2)' 12820 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -30.6060000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 343 ? G HOH . 2 1 A HOH 389 ? G HOH . 3 1 A HOH 418 ? G HOH . 4 1 A HOH 444 ? G HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-09 2 'Structure model' 1 1 2023-01-25 3 'Structure model' 1 2 2023-03-01 4 'Structure model' 1 3 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation_author.name' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7LWE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 39 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 53.29 _pdbx_validate_torsion.psi -120.15 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 6 ? CG ? A ASP 6 CG 2 1 Y 1 A ASP 6 ? OD1 ? A ASP 6 OD1 3 1 Y 1 A ASP 6 ? OD2 ? A ASP 6 OD2 4 1 Y 1 A GLU 99 ? CD ? A GLU 99 CD 5 1 Y 1 A GLU 99 ? OE1 ? A GLU 99 OE1 6 1 Y 1 A GLU 99 ? OE2 ? A GLU 99 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 129 ? A GLU 129 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CL CL CL N N 81 CYS N N N N 82 CYS CA C N R 83 CYS C C N N 84 CYS O O N N 85 CYS CB C N N 86 CYS SG S N N 87 CYS OXT O N N 88 CYS H H N N 89 CYS H2 H N N 90 CYS HA H N N 91 CYS HB2 H N N 92 CYS HB3 H N N 93 CYS HG H N N 94 CYS HXT H N N 95 FMT C C N N 96 FMT O1 O N N 97 FMT O2 O N N 98 FMT H H N N 99 FMT HO2 H N N 100 GLN N N N N 101 GLN CA C N S 102 GLN C C N N 103 GLN O O N N 104 GLN CB C N N 105 GLN CG C N N 106 GLN CD C N N 107 GLN OE1 O N N 108 GLN NE2 N N N 109 GLN OXT O N N 110 GLN H H N N 111 GLN H2 H N N 112 GLN HA H N N 113 GLN HB2 H N N 114 GLN HB3 H N N 115 GLN HG2 H N N 116 GLN HG3 H N N 117 GLN HE21 H N N 118 GLN HE22 H N N 119 GLN HXT H N N 120 GLU N N N N 121 GLU CA C N S 122 GLU C C N N 123 GLU O O N N 124 GLU CB C N N 125 GLU CG C N N 126 GLU CD C N N 127 GLU OE1 O N N 128 GLU OE2 O N N 129 GLU OXT O N N 130 GLU H H N N 131 GLU H2 H N N 132 GLU HA H N N 133 GLU HB2 H N N 134 GLU HB3 H N N 135 GLU HG2 H N N 136 GLU HG3 H N N 137 GLU HE2 H N N 138 GLU HXT H N N 139 GLY N N N N 140 GLY CA C N N 141 GLY C C N N 142 GLY O O N N 143 GLY OXT O N N 144 GLY H H N N 145 GLY H2 H N N 146 GLY HA2 H N N 147 GLY HA3 H N N 148 GLY HXT H N N 149 HIS N N N N 150 HIS CA C N S 151 HIS C C N N 152 HIS O O N N 153 HIS CB C N N 154 HIS CG C Y N 155 HIS ND1 N Y N 156 HIS CD2 C Y N 157 HIS CE1 C Y N 158 HIS NE2 N Y N 159 HIS OXT O N N 160 HIS H H N N 161 HIS H2 H N N 162 HIS HA H N N 163 HIS HB2 H N N 164 HIS HB3 H N N 165 HIS HD1 H N N 166 HIS HD2 H N N 167 HIS HE1 H N N 168 HIS HE2 H N N 169 HIS HXT H N N 170 HOH O O N N 171 HOH H1 H N N 172 HOH H2 H N N 173 ILE N N N N 174 ILE CA C N S 175 ILE C C N N 176 ILE O O N N 177 ILE CB C N S 178 ILE CG1 C N N 179 ILE CG2 C N N 180 ILE CD1 C N N 181 ILE OXT O N N 182 ILE H H N N 183 ILE H2 H N N 184 ILE HA H N N 185 ILE HB H N N 186 ILE HG12 H N N 187 ILE HG13 H N N 188 ILE HG21 H N N 189 ILE HG22 H N N 190 ILE HG23 H N N 191 ILE HD11 H N N 192 ILE HD12 H N N 193 ILE HD13 H N N 194 ILE HXT H N N 195 LEU N N N N 196 LEU CA C N S 197 LEU C C N N 198 LEU O O N N 199 LEU CB C N N 200 LEU CG C N N 201 LEU CD1 C N N 202 LEU CD2 C N N 203 LEU OXT O N N 204 LEU H H N N 205 LEU H2 H N N 206 LEU HA H N N 207 LEU HB2 H N N 208 LEU HB3 H N N 209 LEU HG H N N 210 LEU HD11 H N N 211 LEU HD12 H N N 212 LEU HD13 H N N 213 LEU HD21 H N N 214 LEU HD22 H N N 215 LEU HD23 H N N 216 LEU HXT H N N 217 LYS N N N N 218 LYS CA C N S 219 LYS C C N N 220 LYS O O N N 221 LYS CB C N N 222 LYS CG C N N 223 LYS CD C N N 224 LYS CE C N N 225 LYS NZ N N N 226 LYS OXT O N N 227 LYS H H N N 228 LYS H2 H N N 229 LYS HA H N N 230 LYS HB2 H N N 231 LYS HB3 H N N 232 LYS HG2 H N N 233 LYS HG3 H N N 234 LYS HD2 H N N 235 LYS HD3 H N N 236 LYS HE2 H N N 237 LYS HE3 H N N 238 LYS HZ1 H N N 239 LYS HZ2 H N N 240 LYS HZ3 H N N 241 LYS HXT H N N 242 MET N N N N 243 MET CA C N S 244 MET C C N N 245 MET O O N N 246 MET CB C N N 247 MET CG C N N 248 MET SD S N N 249 MET CE C N N 250 MET OXT O N N 251 MET H H N N 252 MET H2 H N N 253 MET HA H N N 254 MET HB2 H N N 255 MET HB3 H N N 256 MET HG2 H N N 257 MET HG3 H N N 258 MET HE1 H N N 259 MET HE2 H N N 260 MET HE3 H N N 261 MET HXT H N N 262 PHE N N N N 263 PHE CA C N S 264 PHE C C N N 265 PHE O O N N 266 PHE CB C N N 267 PHE CG C Y N 268 PHE CD1 C Y N 269 PHE CD2 C Y N 270 PHE CE1 C Y N 271 PHE CE2 C Y N 272 PHE CZ C Y N 273 PHE OXT O N N 274 PHE H H N N 275 PHE H2 H N N 276 PHE HA H N N 277 PHE HB2 H N N 278 PHE HB3 H N N 279 PHE HD1 H N N 280 PHE HD2 H N N 281 PHE HE1 H N N 282 PHE HE2 H N N 283 PHE HZ H N N 284 PHE HXT H N N 285 PRO N N N N 286 PRO CA C N S 287 PRO C C N N 288 PRO O O N N 289 PRO CB C N N 290 PRO CG C N N 291 PRO CD C N N 292 PRO OXT O N N 293 PRO H H N N 294 PRO HA H N N 295 PRO HB2 H N N 296 PRO HB3 H N N 297 PRO HG2 H N N 298 PRO HG3 H N N 299 PRO HD2 H N N 300 PRO HD3 H N N 301 PRO HXT H N N 302 SER N N N N 303 SER CA C N S 304 SER C C N N 305 SER O O N N 306 SER CB C N N 307 SER OG O N N 308 SER OXT O N N 309 SER H H N N 310 SER H2 H N N 311 SER HA H N N 312 SER HB2 H N N 313 SER HB3 H N N 314 SER HG H N N 315 SER HXT H N N 316 THR N N N N 317 THR CA C N S 318 THR C C N N 319 THR O O N N 320 THR CB C N R 321 THR OG1 O N N 322 THR CG2 C N N 323 THR OXT O N N 324 THR H H N N 325 THR H2 H N N 326 THR HA H N N 327 THR HB H N N 328 THR HG1 H N N 329 THR HG21 H N N 330 THR HG22 H N N 331 THR HG23 H N N 332 THR HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 YND C1 C N N 377 YND N N Y N 378 YND CA C N N 379 YND C C N N 380 YND O O N N 381 YND CAD C Y N 382 YND CAE C Y N 383 YND CAF C Y N 384 YND CAG C Y N 385 YND CAH C N N 386 YND CAI C Y N 387 YND CAP C Y N 388 YND CAQ C Y N 389 YND CAR C N N 390 YND CAS C Y N 391 YND CAT C Y N 392 YND NAK N Y N 393 YND NAL N N N 394 YND NAM N N N 395 YND NAN N N N 396 YND OAB O N N 397 YND CLAC CL N N 398 YND H1 H N N 399 YND H2 H N N 400 YND H3 H N N 401 YND HA2 H N N 402 YND HA1 H N N 403 YND HAD H N N 404 YND HAE H N N 405 YND HAF H N N 406 YND HAG H N N 407 YND HAH H N N 408 YND HAI H N N 409 YND HNA H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 FMT C O1 doub N N 89 FMT C O2 sing N N 90 FMT C H sing N N 91 FMT O2 HO2 sing N N 92 GLN N CA sing N N 93 GLN N H sing N N 94 GLN N H2 sing N N 95 GLN CA C sing N N 96 GLN CA CB sing N N 97 GLN CA HA sing N N 98 GLN C O doub N N 99 GLN C OXT sing N N 100 GLN CB CG sing N N 101 GLN CB HB2 sing N N 102 GLN CB HB3 sing N N 103 GLN CG CD sing N N 104 GLN CG HG2 sing N N 105 GLN CG HG3 sing N N 106 GLN CD OE1 doub N N 107 GLN CD NE2 sing N N 108 GLN NE2 HE21 sing N N 109 GLN NE2 HE22 sing N N 110 GLN OXT HXT sing N N 111 GLU N CA sing N N 112 GLU N H sing N N 113 GLU N H2 sing N N 114 GLU CA C sing N N 115 GLU CA CB sing N N 116 GLU CA HA sing N N 117 GLU C O doub N N 118 GLU C OXT sing N N 119 GLU CB CG sing N N 120 GLU CB HB2 sing N N 121 GLU CB HB3 sing N N 122 GLU CG CD sing N N 123 GLU CG HG2 sing N N 124 GLU CG HG3 sing N N 125 GLU CD OE1 doub N N 126 GLU CD OE2 sing N N 127 GLU OE2 HE2 sing N N 128 GLU OXT HXT sing N N 129 GLY N CA sing N N 130 GLY N H sing N N 131 GLY N H2 sing N N 132 GLY CA C sing N N 133 GLY CA HA2 sing N N 134 GLY CA HA3 sing N N 135 GLY C O doub N N 136 GLY C OXT sing N N 137 GLY OXT HXT sing N N 138 HIS N CA sing N N 139 HIS N H sing N N 140 HIS N H2 sing N N 141 HIS CA C sing N N 142 HIS CA CB sing N N 143 HIS CA HA sing N N 144 HIS C O doub N N 145 HIS C OXT sing N N 146 HIS CB CG sing N N 147 HIS CB HB2 sing N N 148 HIS CB HB3 sing N N 149 HIS CG ND1 sing Y N 150 HIS CG CD2 doub Y N 151 HIS ND1 CE1 doub Y N 152 HIS ND1 HD1 sing N N 153 HIS CD2 NE2 sing Y N 154 HIS CD2 HD2 sing N N 155 HIS CE1 NE2 sing Y N 156 HIS CE1 HE1 sing N N 157 HIS NE2 HE2 sing N N 158 HIS OXT HXT sing N N 159 HOH O H1 sing N N 160 HOH O H2 sing N N 161 ILE N CA sing N N 162 ILE N H sing N N 163 ILE N H2 sing N N 164 ILE CA C sing N N 165 ILE CA CB sing N N 166 ILE CA HA sing N N 167 ILE C O doub N N 168 ILE C OXT sing N N 169 ILE CB CG1 sing N N 170 ILE CB CG2 sing N N 171 ILE CB HB sing N N 172 ILE CG1 CD1 sing N N 173 ILE CG1 HG12 sing N N 174 ILE CG1 HG13 sing N N 175 ILE CG2 HG21 sing N N 176 ILE CG2 HG22 sing N N 177 ILE CG2 HG23 sing N N 178 ILE CD1 HD11 sing N N 179 ILE CD1 HD12 sing N N 180 ILE CD1 HD13 sing N N 181 ILE OXT HXT sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 VAL N CA sing N N 340 VAL N H sing N N 341 VAL N H2 sing N N 342 VAL CA C sing N N 343 VAL CA CB sing N N 344 VAL CA HA sing N N 345 VAL C O doub N N 346 VAL C OXT sing N N 347 VAL CB CG1 sing N N 348 VAL CB CG2 sing N N 349 VAL CB HB sing N N 350 VAL CG1 HG11 sing N N 351 VAL CG1 HG12 sing N N 352 VAL CG1 HG13 sing N N 353 VAL CG2 HG21 sing N N 354 VAL CG2 HG22 sing N N 355 VAL CG2 HG23 sing N N 356 VAL OXT HXT sing N N 357 YND CLAC CAP sing N N 358 YND CAI NAK doub Y N 359 YND CAI CAP sing Y N 360 YND NAK CAD sing Y N 361 YND CAP CAQ doub Y N 362 YND CAD CAE doub Y N 363 YND CAQ CAE sing Y N 364 YND CAQ NAM sing N N 365 YND NAM C sing N N 366 YND C O doub N N 367 YND C CA sing N N 368 YND CA N sing N N 369 YND CAG N sing Y N 370 YND CAG CAF doub Y N 371 YND N CAT sing Y N 372 YND CAF CAS sing Y N 373 YND CAT CAS doub Y N 374 YND CAT NAL sing N N 375 YND CAS CAR sing N N 376 YND NAL CAH doub N N 377 YND CAR OAB doub N N 378 YND CAR NAN sing N N 379 YND CAH NAN sing N N 380 YND NAN C1 sing N N 381 YND C1 H1 sing N N 382 YND C1 H2 sing N N 383 YND C1 H3 sing N N 384 YND CA HA2 sing N N 385 YND CA HA1 sing N N 386 YND CAD HAD sing N N 387 YND CAE HAE sing N N 388 YND CAF HAF sing N N 389 YND CAG HAG sing N N 390 YND CAH HAH sing N N 391 YND CAI HAI sing N N 392 YND NAM HNA sing N N 393 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id YND _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id YND _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(3-chloropyridin-4-yl)-2-(3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)acetamide' YND 3 'FORMIC ACID' FMT 4 'ACETATE ION' ACT 5 'CHLORIDE ION' CL 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3LBZ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details 'BTB_POZ domains are known to form domain-swappped homo dimers' # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 #