data_7MS3 # _entry.id 7MS3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7MS3 pdb_00007ms3 10.2210/pdb7ms3/pdb WWPDB D_1000256779 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7MS3 _pdbx_database_status.recvd_initial_deposition_date 2021-05-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nayebi, G.H.' 1 0000-0002-3172-6627 'Geiger, J.H.' 2 0000-0002-9443-4488 'Draths, K.' 3 0000-0001-7852-1090 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 3879 _citation.page_last 3886 _citation.title 'Cg10062 Catalysis Forges a Link between Acetylenecarboxylic Acid and Bacterial Metabolism.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.1c00524 _citation.pdbx_database_id_PubMed 34910871 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mathes Hewage, A.' 1 ? primary 'Nayebi Gavgani, H.' 2 0000-0002-3172-6627 primary 'Chi, D.' 3 ? primary 'Qiu, B.' 4 ? primary 'Geiger, J.H.' 5 ? primary 'Draths, K.' 6 0000-0001-7852-1090 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7MS3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 146.551 _cell.length_a_esd ? _cell.length_b 146.551 _cell.length_b_esd ? _cell.length_c 146.551 _cell.length_c_esd ? _cell.volume 3147504.493 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7MS3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall 'P 4bd 2ab 3' _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '4-oxalocrotonate tautomerase' 18952.133 1 ? R73A ? ? 2 non-polymer syn '3-HYDROXY-PROPANOIC ACID' 90.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cis-3-chloroacrylic acid dehalogenase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGATEKQKEE LLLRLTQEIALILGIPNEEVWVYITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSEENLYFQGLEHHH HHH ; _entity_poly.pdbx_seq_one_letter_code_can ;PTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGATEKQKEE LLLRLTQEIALILGIPNEEVWVYITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSEENLYFQGLEHHH HHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 THR n 1 3 TYR n 1 4 THR n 1 5 CYS n 1 6 TRP n 1 7 SER n 1 8 GLN n 1 9 ARG n 1 10 ILE n 1 11 ARG n 1 12 ILE n 1 13 SER n 1 14 ARG n 1 15 GLU n 1 16 ALA n 1 17 LYS n 1 18 GLN n 1 19 ARG n 1 20 ILE n 1 21 ALA n 1 22 GLU n 1 23 ALA n 1 24 ILE n 1 25 THR n 1 26 ASP n 1 27 ALA n 1 28 HIS n 1 29 HIS n 1 30 GLU n 1 31 LEU n 1 32 ALA n 1 33 HIS n 1 34 ALA n 1 35 PRO n 1 36 LYS n 1 37 TYR n 1 38 LEU n 1 39 VAL n 1 40 GLN n 1 41 VAL n 1 42 ILE n 1 43 PHE n 1 44 ASN n 1 45 GLU n 1 46 VAL n 1 47 GLU n 1 48 PRO n 1 49 ASP n 1 50 SER n 1 51 TYR n 1 52 PHE n 1 53 ILE n 1 54 ALA n 1 55 ALA n 1 56 GLN n 1 57 SER n 1 58 ALA n 1 59 SER n 1 60 GLU n 1 61 ASN n 1 62 HIS n 1 63 ILE n 1 64 TRP n 1 65 VAL n 1 66 GLN n 1 67 ALA n 1 68 THR n 1 69 ILE n 1 70 ARG n 1 71 SER n 1 72 GLY n 1 73 ALA n 1 74 THR n 1 75 GLU n 1 76 LYS n 1 77 GLN n 1 78 LYS n 1 79 GLU n 1 80 GLU n 1 81 LEU n 1 82 LEU n 1 83 LEU n 1 84 ARG n 1 85 LEU n 1 86 THR n 1 87 GLN n 1 88 GLU n 1 89 ILE n 1 90 ALA n 1 91 LEU n 1 92 ILE n 1 93 LEU n 1 94 GLY n 1 95 ILE n 1 96 PRO n 1 97 ASN n 1 98 GLU n 1 99 GLU n 1 100 VAL n 1 101 TRP n 1 102 VAL n 1 103 TYR n 1 104 ILE n 1 105 THR n 1 106 GLU n 1 107 ILE n 1 108 PRO n 1 109 GLY n 1 110 SER n 1 111 ASN n 1 112 MET n 1 113 THR n 1 114 GLU n 1 115 TYR n 1 116 GLY n 1 117 ARG n 1 118 LEU n 1 119 LEU n 1 120 MET n 1 121 GLU n 1 122 PRO n 1 123 GLY n 1 124 GLU n 1 125 GLU n 1 126 GLU n 1 127 LYS n 1 128 TRP n 1 129 PHE n 1 130 ASN n 1 131 SER n 1 132 LEU n 1 133 PRO n 1 134 GLU n 1 135 GLY n 1 136 LEU n 1 137 ARG n 1 138 GLU n 1 139 ARG n 1 140 LEU n 1 141 THR n 1 142 GLU n 1 143 LEU n 1 144 GLU n 1 145 GLY n 1 146 SER n 1 147 SER n 1 148 GLU n 1 149 GLU n 1 150 ASN n 1 151 LEU n 1 152 TYR n 1 153 PHE n 1 154 GLN n 1 155 GLY n 1 156 LEU n 1 157 GLU n 1 158 HIS n 1 159 HIS n 1 160 HIS n 1 161 HIS n 1 162 HIS n 1 163 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name 'Brevibacterium saccharolyticum' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'APT58_00490, AUO95_07180, CS176_0056, FM102_14895, KaCgl_17770, KbCgl_30240' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Corynebacterium glutamicum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1718 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0S2T163_CORGT _struct_ref.pdbx_db_accession A0A0S2T163 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEE LLLRLTQEIALILGIPNEEVWVYITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSE ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7MS3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0S2T163 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7MS3 ALA A 73 ? UNP A0A0S2T163 ARG 74 'engineered mutation' 73 1 1 7MS3 GLU A 149 ? UNP A0A0S2T163 ? ? 'expression tag' 149 2 1 7MS3 ASN A 150 ? UNP A0A0S2T163 ? ? 'expression tag' 150 3 1 7MS3 LEU A 151 ? UNP A0A0S2T163 ? ? 'expression tag' 151 4 1 7MS3 TYR A 152 ? UNP A0A0S2T163 ? ? 'expression tag' 152 5 1 7MS3 PHE A 153 ? UNP A0A0S2T163 ? ? 'expression tag' 153 6 1 7MS3 GLN A 154 ? UNP A0A0S2T163 ? ? 'expression tag' 154 7 1 7MS3 GLY A 155 ? UNP A0A0S2T163 ? ? 'expression tag' 155 8 1 7MS3 LEU A 156 ? UNP A0A0S2T163 ? ? 'expression tag' 156 9 1 7MS3 GLU A 157 ? UNP A0A0S2T163 ? ? 'expression tag' 157 10 1 7MS3 HIS A 158 ? UNP A0A0S2T163 ? ? 'expression tag' 158 11 1 7MS3 HIS A 159 ? UNP A0A0S2T163 ? ? 'expression tag' 159 12 1 7MS3 HIS A 160 ? UNP A0A0S2T163 ? ? 'expression tag' 160 13 1 7MS3 HIS A 161 ? UNP A0A0S2T163 ? ? 'expression tag' 161 14 1 7MS3 HIS A 162 ? UNP A0A0S2T163 ? ? 'expression tag' 162 15 1 7MS3 HIS A 163 ? UNP A0A0S2T163 ? ? 'expression tag' 163 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3OH non-polymer . '3-HYDROXY-PROPANOIC ACID' ? 'C3 H6 O3' 90.078 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7MS3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 6.92 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 82.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM ammonium fluoride, 10% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-06-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7MS3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.00 _reflns.d_resolution_low 35.54 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11178 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.69 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.2 _reflns.pdbx_Rmerge_I_obs 0.171 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.180 _reflns.pdbx_Rpim_I_all 0.055 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.10 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1086 _reflns_shell.percent_possible_all 99.91 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.65 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.45 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7MS3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 35.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11174 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.669 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2558 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2035 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 7MS0' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1168 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1174 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 35.54 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0122 ? 1207 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2112 ? 1640 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0646 ? 182 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0071 ? 212 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 30.0671 ? 449 ? f_dihedral_angle_d ? ? # _struct.entry_id 7MS3 _struct.title 'Crystal structure of R73A mutant of Cg10062 with a covalent intermediate of the hydration of acetylenecarboxylic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7MS3 _struct_keywords.text 'tautomerase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 13 ? LEU A 31 ? SER A 13 LEU A 31 1 ? 19 HELX_P HELX_P2 AA2 PRO A 35 ? VAL A 39 ? PRO A 35 VAL A 39 5 ? 5 HELX_P HELX_P3 AA3 GLU A 47 ? SER A 50 ? GLU A 47 SER A 50 5 ? 4 HELX_P HELX_P4 AA4 THR A 74 ? GLY A 94 ? THR A 74 GLY A 94 1 ? 21 HELX_P HELX_P5 AA5 PRO A 96 ? GLU A 98 ? PRO A 96 GLU A 98 5 ? 3 HELX_P HELX_P6 AA6 PRO A 108 ? ASN A 111 ? PRO A 108 ASN A 111 5 ? 4 HELX_P HELX_P7 AA7 GLU A 124 ? SER A 131 ? GLU A 124 SER A 131 1 ? 8 HELX_P HELX_P8 AA8 PRO A 133 ? GLU A 142 ? PRO A 133 GLU A 142 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id PRO _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 3OH _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C3 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id PRO _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 3OH _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.373 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 40 ? VAL A 46 ? GLN A 40 VAL A 46 AA1 2 THR A 2 ? GLN A 8 ? THR A 2 GLN A 8 AA1 3 ILE A 63 ? ARG A 70 ? ILE A 63 ARG A 70 AA1 4 VAL A 100 ? ILE A 107 ? VAL A 100 ILE A 107 AA2 1 PHE A 52 ? ILE A 53 ? PHE A 52 ILE A 53 AA2 2 GLN A 56 ? SER A 57 ? GLN A 56 SER A 57 AA3 1 THR A 113 ? GLU A 114 ? THR A 113 GLU A 114 AA3 2 ARG A 117 ? LEU A 118 ? ARG A 117 LEU A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASN A 44 ? O ASN A 44 N CYS A 5 ? N CYS A 5 AA1 2 3 N TRP A 6 ? N TRP A 6 O TRP A 64 ? O TRP A 64 AA1 3 4 N ALA A 67 ? N ALA A 67 O TYR A 103 ? O TYR A 103 AA2 1 2 N ILE A 53 ? N ILE A 53 O GLN A 56 ? O GLN A 56 AA3 1 2 N GLU A 114 ? N GLU A 114 O ARG A 117 ? O ARG A 117 # _atom_sites.entry_id 7MS3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006824 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006824 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006824 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _database_PDB_caveat.text 'Numerous protein backbone atoms are modeled with zero occupancy.' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLY 145 145 ? ? ? A . n A 1 146 SER 146 146 ? ? ? A . n A 1 147 SER 147 147 ? ? ? A . n A 1 148 GLU 148 148 ? ? ? A . n A 1 149 GLU 149 149 ? ? ? A . n A 1 150 ASN 150 150 ? ? ? A . n A 1 151 LEU 151 151 ? ? ? A . n A 1 152 TYR 152 152 ? ? ? A . n A 1 153 PHE 153 153 ? ? ? A . n A 1 154 GLN 154 154 ? ? ? A . n A 1 155 GLY 155 155 ? ? ? A . n A 1 156 LEU 156 156 ? ? ? A . n A 1 157 GLU 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n A 1 159 HIS 159 159 ? ? ? A . n A 1 160 HIS 160 160 ? ? ? A . n A 1 161 HIS 161 161 ? ? ? A . n A 1 162 HIS 162 162 ? ? ? A . n A 1 163 HIS 163 163 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 3OH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id 3OH _pdbx_nonpoly_scheme.auth_mon_id 3OH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9130 ? 1 MORE -44 ? 1 'SSA (A^2)' 17230 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-02 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/4,-z+1/4,y+3/4 3 x+3/4,z+1/4,-y+1/4 4 z+3/4,y+1/4,-x+1/4 5 -z+1/4,y+3/4,x+1/4 6 -y+1/4,x+3/4,z+1/4 7 y+1/4,-x+1/4,z+3/4 8 z,x,y 9 y,z,x 10 -y+1/2,-z,x+1/2 11 z+1/2,-x+1/2,-y 12 -y,z+1/2,-x+1/2 13 -z+1/2,-x,y+1/2 14 -z,x+1/2,-y+1/2 15 y+1/2,-z+1/2,-x 16 x+1/2,-y+1/2,-z 17 -x,y+1/2,-z+1/2 18 -x+1/2,-y,z+1/2 19 y+3/4,x+1/4,-z+1/4 20 -y+3/4,-x+3/4,-z+3/4 21 z+1/4,-y+1/4,x+3/4 22 -z+3/4,-y+3/4,-x+3/4 23 -x+1/4,z+3/4,y+1/4 24 -x+3/4,-z+3/4,-y+3/4 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 7MS3 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 N A PRO 1 ? ? C2 A 3OH 201 ? ? 1.98 2 1 OE2 A GLU 114 ? ? O3 A 3OH 201 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 10 ? ? 49.47 -2.18 2 1 LEU A 31 ? ? -96.89 -82.44 3 1 ALA A 32 ? ? -69.50 82.74 4 1 HIS A 33 ? ? -49.97 89.28 5 1 GLU A 124 ? ? -94.19 39.84 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A PRO 1 ? CA ? A PRO 1 CA 2 1 Y 0 A THR 2 ? N B A THR 2 N 3 1 Y 0 A THR 2 ? CB A A THR 2 CB 4 1 Y 0 A ARG 9 ? C ? A ARG 9 C 5 1 Y 0 A ARG 9 ? NE ? A ARG 9 NE 6 1 Y 0 A ARG 9 ? CZ ? A ARG 9 CZ 7 1 Y 0 A ILE 10 ? CA ? A ILE 10 CA 8 1 Y 0 A ARG 11 ? CZ ? A ARG 11 CZ 9 1 Y 1 A ARG 14 ? CG ? A ARG 14 CG 10 1 Y 1 A ARG 14 ? CD ? A ARG 14 CD 11 1 Y 1 A ARG 14 ? NE ? A ARG 14 NE 12 1 Y 1 A ARG 14 ? CZ ? A ARG 14 CZ 13 1 Y 1 A ARG 14 ? NH1 ? A ARG 14 NH1 14 1 Y 1 A ARG 14 ? NH2 ? A ARG 14 NH2 15 1 Y 0 A GLU 15 ? C ? A GLU 15 C 16 1 Y 0 A GLU 22 ? C ? A GLU 22 C 17 1 Y 0 A GLU 22 ? CD ? A GLU 22 CD 18 1 Y 0 A GLU 30 ? CD ? A GLU 30 CD 19 1 Y 0 A LEU 31 ? O ? A LEU 31 O 20 1 Y 0 A ALA 32 ? N ? A ALA 32 N 21 1 Y 0 A ALA 32 ? O ? A ALA 32 O 22 1 Y 0 A HIS 33 ? C ? A HIS 33 C 23 1 Y 0 A HIS 33 ? CG ? A HIS 33 CG 24 1 Y 0 A GLU 45 ? CD ? A GLU 45 CD 25 1 Y 0 A ALA 54 ? C ? A ALA 54 C 26 1 Y 0 A GLN 56 ? CD ? A GLN 56 CD 27 1 Y 0 A ALA 58 ? C ? A ALA 58 C 28 1 Y 0 A GLN 66 ? CD ? A GLN 66 CD 29 1 Y 0 A ARG 70 ? CZ ? A ARG 70 CZ 30 1 Y 0 A ALA 73 ? C ? A ALA 73 C 31 1 Y 0 A GLU 75 ? CD ? A GLU 75 CD 32 1 Y 0 A LYS 76 ? CA ? A LYS 76 CA 33 1 Y 0 A LYS 76 ? CG ? A LYS 76 CG 34 1 Y 0 A GLN 77 ? C ? A GLN 77 C 35 1 Y 0 A GLN 87 ? C ? A GLN 87 C 36 1 Y 0 A GLN 87 ? CD ? A GLN 87 CD 37 1 Y 0 A GLU 88 ? CD ? A GLU 88 CD 38 1 Y 0 A ASN 97 ? CG ? A ASN 97 CG 39 1 Y 0 A GLU 98 ? CD ? A GLU 98 CD 40 1 Y 0 A GLU 106 ? CD ? A GLU 106 CD 41 1 Y 0 A GLY 109 ? C ? A GLY 109 C 42 1 Y 0 A ARG 117 ? CZ ? A ARG 117 CZ 43 1 Y 0 A LEU 119 ? C ? A LEU 119 C 44 1 Y 0 A GLU 121 ? CD ? A GLU 121 CD 45 1 Y 0 A GLU 124 ? CD ? A GLU 124 CD 46 1 Y 0 A GLU 125 ? CD ? A GLU 125 CD 47 1 Y 0 A GLU 126 ? CA ? A GLU 126 CA 48 1 Y 0 A GLU 126 ? CD ? A GLU 126 CD 49 1 Y 0 A ASN 130 ? CG ? A ASN 130 CG 50 1 Y 0 A LEU 132 ? C ? A LEU 132 C 51 1 Y 0 A PRO 133 ? C ? A PRO 133 C 52 1 Y 0 A LEU 136 ? CG ? A LEU 136 CG 53 1 Y 0 A GLU 138 ? CD ? A GLU 138 CD 54 1 Y 0 A ARG 139 ? CG ? A ARG 139 CG 55 1 Y 0 A ARG 139 ? CZ ? A ARG 139 CZ 56 1 Y 0 A GLU 142 ? CG ? A GLU 142 CG 57 1 Y 0 A GLU 142 ? CD ? A GLU 142 CD 58 1 Y 0 A GLU 144 ? CD ? A GLU 144 CD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 145 ? A GLY 145 2 1 Y 1 A SER 146 ? A SER 146 3 1 Y 1 A SER 147 ? A SER 147 4 1 Y 1 A GLU 148 ? A GLU 148 5 1 Y 1 A GLU 149 ? A GLU 149 6 1 Y 1 A ASN 150 ? A ASN 150 7 1 Y 1 A LEU 151 ? A LEU 151 8 1 Y 1 A TYR 152 ? A TYR 152 9 1 Y 1 A PHE 153 ? A PHE 153 10 1 Y 1 A GLN 154 ? A GLN 154 11 1 Y 1 A GLY 155 ? A GLY 155 12 1 Y 1 A LEU 156 ? A LEU 156 13 1 Y 1 A GLU 157 ? A GLU 157 14 1 Y 1 A HIS 158 ? A HIS 158 15 1 Y 1 A HIS 159 ? A HIS 159 16 1 Y 1 A HIS 160 ? A HIS 160 17 1 Y 1 A HIS 161 ? A HIS 161 18 1 Y 1 A HIS 162 ? A HIS 162 19 1 Y 1 A HIS 163 ? A HIS 163 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 3OH C1 C N N 1 3OH O1 O N N 2 3OH O2 O N N 3 3OH C2 C N N 4 3OH C3 C N N 5 3OH O3 O N N 6 3OH HO2 H N N 7 3OH H21 H N N 8 3OH H22 H N N 9 3OH H31 H N N 10 3OH H32 H N N 11 3OH HO3 H N N 12 ALA N N N N 13 ALA CA C N S 14 ALA C C N N 15 ALA O O N N 16 ALA CB C N N 17 ALA OXT O N N 18 ALA H H N N 19 ALA H2 H N N 20 ALA HA H N N 21 ALA HB1 H N N 22 ALA HB2 H N N 23 ALA HB3 H N N 24 ALA HXT H N N 25 ARG N N N N 26 ARG CA C N S 27 ARG C C N N 28 ARG O O N N 29 ARG CB C N N 30 ARG CG C N N 31 ARG CD C N N 32 ARG NE N N N 33 ARG CZ C N N 34 ARG NH1 N N N 35 ARG NH2 N N N 36 ARG OXT O N N 37 ARG H H N N 38 ARG H2 H N N 39 ARG HA H N N 40 ARG HB2 H N N 41 ARG HB3 H N N 42 ARG HG2 H N N 43 ARG HG3 H N N 44 ARG HD2 H N N 45 ARG HD3 H N N 46 ARG HE H N N 47 ARG HH11 H N N 48 ARG HH12 H N N 49 ARG HH21 H N N 50 ARG HH22 H N N 51 ARG HXT H N N 52 ASN N N N N 53 ASN CA C N S 54 ASN C C N N 55 ASN O O N N 56 ASN CB C N N 57 ASN CG C N N 58 ASN OD1 O N N 59 ASN ND2 N N N 60 ASN OXT O N N 61 ASN H H N N 62 ASN H2 H N N 63 ASN HA H N N 64 ASN HB2 H N N 65 ASN HB3 H N N 66 ASN HD21 H N N 67 ASN HD22 H N N 68 ASN HXT H N N 69 ASP N N N N 70 ASP CA C N S 71 ASP C C N N 72 ASP O O N N 73 ASP CB C N N 74 ASP CG C N N 75 ASP OD1 O N N 76 ASP OD2 O N N 77 ASP OXT O N N 78 ASP H H N N 79 ASP H2 H N N 80 ASP HA H N N 81 ASP HB2 H N N 82 ASP HB3 H N N 83 ASP HD2 H N N 84 ASP HXT H N N 85 CYS N N N N 86 CYS CA C N R 87 CYS C C N N 88 CYS O O N N 89 CYS CB C N N 90 CYS SG S N N 91 CYS OXT O N N 92 CYS H H N N 93 CYS H2 H N N 94 CYS HA H N N 95 CYS HB2 H N N 96 CYS HB3 H N N 97 CYS HG H N N 98 CYS HXT H N N 99 GLN N N N N 100 GLN CA C N S 101 GLN C C N N 102 GLN O O N N 103 GLN CB C N N 104 GLN CG C N N 105 GLN CD C N N 106 GLN OE1 O N N 107 GLN NE2 N N N 108 GLN OXT O N N 109 GLN H H N N 110 GLN H2 H N N 111 GLN HA H N N 112 GLN HB2 H N N 113 GLN HB3 H N N 114 GLN HG2 H N N 115 GLN HG3 H N N 116 GLN HE21 H N N 117 GLN HE22 H N N 118 GLN HXT H N N 119 GLU N N N N 120 GLU CA C N S 121 GLU C C N N 122 GLU O O N N 123 GLU CB C N N 124 GLU CG C N N 125 GLU CD C N N 126 GLU OE1 O N N 127 GLU OE2 O N N 128 GLU OXT O N N 129 GLU H H N N 130 GLU H2 H N N 131 GLU HA H N N 132 GLU HB2 H N N 133 GLU HB3 H N N 134 GLU HG2 H N N 135 GLU HG3 H N N 136 GLU HE2 H N N 137 GLU HXT H N N 138 GLY N N N N 139 GLY CA C N N 140 GLY C C N N 141 GLY O O N N 142 GLY OXT O N N 143 GLY H H N N 144 GLY H2 H N N 145 GLY HA2 H N N 146 GLY HA3 H N N 147 GLY HXT H N N 148 HIS N N N N 149 HIS CA C N S 150 HIS C C N N 151 HIS O O N N 152 HIS CB C N N 153 HIS CG C Y N 154 HIS ND1 N Y N 155 HIS CD2 C Y N 156 HIS CE1 C Y N 157 HIS NE2 N Y N 158 HIS OXT O N N 159 HIS H H N N 160 HIS H2 H N N 161 HIS HA H N N 162 HIS HB2 H N N 163 HIS HB3 H N N 164 HIS HD1 H N N 165 HIS HD2 H N N 166 HIS HE1 H N N 167 HIS HE2 H N N 168 HIS HXT H N N 169 ILE N N N N 170 ILE CA C N S 171 ILE C C N N 172 ILE O O N N 173 ILE CB C N S 174 ILE CG1 C N N 175 ILE CG2 C N N 176 ILE CD1 C N N 177 ILE OXT O N N 178 ILE H H N N 179 ILE H2 H N N 180 ILE HA H N N 181 ILE HB H N N 182 ILE HG12 H N N 183 ILE HG13 H N N 184 ILE HG21 H N N 185 ILE HG22 H N N 186 ILE HG23 H N N 187 ILE HD11 H N N 188 ILE HD12 H N N 189 ILE HD13 H N N 190 ILE HXT H N N 191 LEU N N N N 192 LEU CA C N S 193 LEU C C N N 194 LEU O O N N 195 LEU CB C N N 196 LEU CG C N N 197 LEU CD1 C N N 198 LEU CD2 C N N 199 LEU OXT O N N 200 LEU H H N N 201 LEU H2 H N N 202 LEU HA H N N 203 LEU HB2 H N N 204 LEU HB3 H N N 205 LEU HG H N N 206 LEU HD11 H N N 207 LEU HD12 H N N 208 LEU HD13 H N N 209 LEU HD21 H N N 210 LEU HD22 H N N 211 LEU HD23 H N N 212 LEU HXT H N N 213 LYS N N N N 214 LYS CA C N S 215 LYS C C N N 216 LYS O O N N 217 LYS CB C N N 218 LYS CG C N N 219 LYS CD C N N 220 LYS CE C N N 221 LYS NZ N N N 222 LYS OXT O N N 223 LYS H H N N 224 LYS H2 H N N 225 LYS HA H N N 226 LYS HB2 H N N 227 LYS HB3 H N N 228 LYS HG2 H N N 229 LYS HG3 H N N 230 LYS HD2 H N N 231 LYS HD3 H N N 232 LYS HE2 H N N 233 LYS HE3 H N N 234 LYS HZ1 H N N 235 LYS HZ2 H N N 236 LYS HZ3 H N N 237 LYS HXT H N N 238 MET N N N N 239 MET CA C N S 240 MET C C N N 241 MET O O N N 242 MET CB C N N 243 MET CG C N N 244 MET SD S N N 245 MET CE C N N 246 MET OXT O N N 247 MET H H N N 248 MET H2 H N N 249 MET HA H N N 250 MET HB2 H N N 251 MET HB3 H N N 252 MET HG2 H N N 253 MET HG3 H N N 254 MET HE1 H N N 255 MET HE2 H N N 256 MET HE3 H N N 257 MET HXT H N N 258 PHE N N N N 259 PHE CA C N S 260 PHE C C N N 261 PHE O O N N 262 PHE CB C N N 263 PHE CG C Y N 264 PHE CD1 C Y N 265 PHE CD2 C Y N 266 PHE CE1 C Y N 267 PHE CE2 C Y N 268 PHE CZ C Y N 269 PHE OXT O N N 270 PHE H H N N 271 PHE H2 H N N 272 PHE HA H N N 273 PHE HB2 H N N 274 PHE HB3 H N N 275 PHE HD1 H N N 276 PHE HD2 H N N 277 PHE HE1 H N N 278 PHE HE2 H N N 279 PHE HZ H N N 280 PHE HXT H N N 281 PRO N N N N 282 PRO CA C N S 283 PRO C C N N 284 PRO O O N N 285 PRO CB C N N 286 PRO CG C N N 287 PRO CD C N N 288 PRO OXT O N N 289 PRO H H N N 290 PRO HA H N N 291 PRO HB2 H N N 292 PRO HB3 H N N 293 PRO HG2 H N N 294 PRO HG3 H N N 295 PRO HD2 H N N 296 PRO HD3 H N N 297 PRO HXT H N N 298 SER N N N N 299 SER CA C N S 300 SER C C N N 301 SER O O N N 302 SER CB C N N 303 SER OG O N N 304 SER OXT O N N 305 SER H H N N 306 SER H2 H N N 307 SER HA H N N 308 SER HB2 H N N 309 SER HB3 H N N 310 SER HG H N N 311 SER HXT H N N 312 THR N N N N 313 THR CA C N S 314 THR C C N N 315 THR O O N N 316 THR CB C N R 317 THR OG1 O N N 318 THR CG2 C N N 319 THR OXT O N N 320 THR H H N N 321 THR H2 H N N 322 THR HA H N N 323 THR HB H N N 324 THR HG1 H N N 325 THR HG21 H N N 326 THR HG22 H N N 327 THR HG23 H N N 328 THR HXT H N N 329 TRP N N N N 330 TRP CA C N S 331 TRP C C N N 332 TRP O O N N 333 TRP CB C N N 334 TRP CG C Y N 335 TRP CD1 C Y N 336 TRP CD2 C Y N 337 TRP NE1 N Y N 338 TRP CE2 C Y N 339 TRP CE3 C Y N 340 TRP CZ2 C Y N 341 TRP CZ3 C Y N 342 TRP CH2 C Y N 343 TRP OXT O N N 344 TRP H H N N 345 TRP H2 H N N 346 TRP HA H N N 347 TRP HB2 H N N 348 TRP HB3 H N N 349 TRP HD1 H N N 350 TRP HE1 H N N 351 TRP HE3 H N N 352 TRP HZ2 H N N 353 TRP HZ3 H N N 354 TRP HH2 H N N 355 TRP HXT H N N 356 TYR N N N N 357 TYR CA C N S 358 TYR C C N N 359 TYR O O N N 360 TYR CB C N N 361 TYR CG C Y N 362 TYR CD1 C Y N 363 TYR CD2 C Y N 364 TYR CE1 C Y N 365 TYR CE2 C Y N 366 TYR CZ C Y N 367 TYR OH O N N 368 TYR OXT O N N 369 TYR H H N N 370 TYR H2 H N N 371 TYR HA H N N 372 TYR HB2 H N N 373 TYR HB3 H N N 374 TYR HD1 H N N 375 TYR HD2 H N N 376 TYR HE1 H N N 377 TYR HE2 H N N 378 TYR HH H N N 379 TYR HXT H N N 380 VAL N N N N 381 VAL CA C N S 382 VAL C C N N 383 VAL O O N N 384 VAL CB C N N 385 VAL CG1 C N N 386 VAL CG2 C N N 387 VAL OXT O N N 388 VAL H H N N 389 VAL H2 H N N 390 VAL HA H N N 391 VAL HB H N N 392 VAL HG11 H N N 393 VAL HG12 H N N 394 VAL HG13 H N N 395 VAL HG21 H N N 396 VAL HG22 H N N 397 VAL HG23 H N N 398 VAL HXT H N N 399 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 3OH C1 O1 doub N N 1 3OH C1 O2 sing N N 2 3OH C1 C2 sing N N 3 3OH O2 HO2 sing N N 4 3OH C2 C3 sing N N 5 3OH C2 H21 sing N N 6 3OH C2 H22 sing N N 7 3OH C3 O3 sing N N 8 3OH C3 H31 sing N N 9 3OH C3 H32 sing N N 10 3OH O3 HO3 sing N N 11 ALA N CA sing N N 12 ALA N H sing N N 13 ALA N H2 sing N N 14 ALA CA C sing N N 15 ALA CA CB sing N N 16 ALA CA HA sing N N 17 ALA C O doub N N 18 ALA C OXT sing N N 19 ALA CB HB1 sing N N 20 ALA CB HB2 sing N N 21 ALA CB HB3 sing N N 22 ALA OXT HXT sing N N 23 ARG N CA sing N N 24 ARG N H sing N N 25 ARG N H2 sing N N 26 ARG CA C sing N N 27 ARG CA CB sing N N 28 ARG CA HA sing N N 29 ARG C O doub N N 30 ARG C OXT sing N N 31 ARG CB CG sing N N 32 ARG CB HB2 sing N N 33 ARG CB HB3 sing N N 34 ARG CG CD sing N N 35 ARG CG HG2 sing N N 36 ARG CG HG3 sing N N 37 ARG CD NE sing N N 38 ARG CD HD2 sing N N 39 ARG CD HD3 sing N N 40 ARG NE CZ sing N N 41 ARG NE HE sing N N 42 ARG CZ NH1 sing N N 43 ARG CZ NH2 doub N N 44 ARG NH1 HH11 sing N N 45 ARG NH1 HH12 sing N N 46 ARG NH2 HH21 sing N N 47 ARG NH2 HH22 sing N N 48 ARG OXT HXT sing N N 49 ASN N CA sing N N 50 ASN N H sing N N 51 ASN N H2 sing N N 52 ASN CA C sing N N 53 ASN CA CB sing N N 54 ASN CA HA sing N N 55 ASN C O doub N N 56 ASN C OXT sing N N 57 ASN CB CG sing N N 58 ASN CB HB2 sing N N 59 ASN CB HB3 sing N N 60 ASN CG OD1 doub N N 61 ASN CG ND2 sing N N 62 ASN ND2 HD21 sing N N 63 ASN ND2 HD22 sing N N 64 ASN OXT HXT sing N N 65 ASP N CA sing N N 66 ASP N H sing N N 67 ASP N H2 sing N N 68 ASP CA C sing N N 69 ASP CA CB sing N N 70 ASP CA HA sing N N 71 ASP C O doub N N 72 ASP C OXT sing N N 73 ASP CB CG sing N N 74 ASP CB HB2 sing N N 75 ASP CB HB3 sing N N 76 ASP CG OD1 doub N N 77 ASP CG OD2 sing N N 78 ASP OD2 HD2 sing N N 79 ASP OXT HXT sing N N 80 CYS N CA sing N N 81 CYS N H sing N N 82 CYS N H2 sing N N 83 CYS CA C sing N N 84 CYS CA CB sing N N 85 CYS CA HA sing N N 86 CYS C O doub N N 87 CYS C OXT sing N N 88 CYS CB SG sing N N 89 CYS CB HB2 sing N N 90 CYS CB HB3 sing N N 91 CYS SG HG sing N N 92 CYS OXT HXT sing N N 93 GLN N CA sing N N 94 GLN N H sing N N 95 GLN N H2 sing N N 96 GLN CA C sing N N 97 GLN CA CB sing N N 98 GLN CA HA sing N N 99 GLN C O doub N N 100 GLN C OXT sing N N 101 GLN CB CG sing N N 102 GLN CB HB2 sing N N 103 GLN CB HB3 sing N N 104 GLN CG CD sing N N 105 GLN CG HG2 sing N N 106 GLN CG HG3 sing N N 107 GLN CD OE1 doub N N 108 GLN CD NE2 sing N N 109 GLN NE2 HE21 sing N N 110 GLN NE2 HE22 sing N N 111 GLN OXT HXT sing N N 112 GLU N CA sing N N 113 GLU N H sing N N 114 GLU N H2 sing N N 115 GLU CA C sing N N 116 GLU CA CB sing N N 117 GLU CA HA sing N N 118 GLU C O doub N N 119 GLU C OXT sing N N 120 GLU CB CG sing N N 121 GLU CB HB2 sing N N 122 GLU CB HB3 sing N N 123 GLU CG CD sing N N 124 GLU CG HG2 sing N N 125 GLU CG HG3 sing N N 126 GLU CD OE1 doub N N 127 GLU CD OE2 sing N N 128 GLU OE2 HE2 sing N N 129 GLU OXT HXT sing N N 130 GLY N CA sing N N 131 GLY N H sing N N 132 GLY N H2 sing N N 133 GLY CA C sing N N 134 GLY CA HA2 sing N N 135 GLY CA HA3 sing N N 136 GLY C O doub N N 137 GLY C OXT sing N N 138 GLY OXT HXT sing N N 139 HIS N CA sing N N 140 HIS N H sing N N 141 HIS N H2 sing N N 142 HIS CA C sing N N 143 HIS CA CB sing N N 144 HIS CA HA sing N N 145 HIS C O doub N N 146 HIS C OXT sing N N 147 HIS CB CG sing N N 148 HIS CB HB2 sing N N 149 HIS CB HB3 sing N N 150 HIS CG ND1 sing Y N 151 HIS CG CD2 doub Y N 152 HIS ND1 CE1 doub Y N 153 HIS ND1 HD1 sing N N 154 HIS CD2 NE2 sing Y N 155 HIS CD2 HD2 sing N N 156 HIS CE1 NE2 sing Y N 157 HIS CE1 HE1 sing N N 158 HIS NE2 HE2 sing N N 159 HIS OXT HXT sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 3OH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 3OH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '3-HYDROXY-PROPANOIC ACID' _pdbx_entity_nonpoly.comp_id 3OH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7MS0 _pdbx_initial_refinement_model.details 'PDB entry 7MS0' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.crystal_system cubic _space_group.name_H-M_alt 'P 41 3 2' _space_group.IT_number 213 _space_group.name_Hall 'P 4bd 2ab 3' _space_group.id 1 #