data_7MSU # _entry.id 7MSU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7MSU pdb_00007msu 10.2210/pdb7msu/pdb WWPDB D_1000256838 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2021-06-16 _pdbx_database_PDB_obs_spr.pdb_id 7MSU _pdbx_database_PDB_obs_spr.replace_pdb_id 7LJ6 _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '7M1T contains both the TMD and CBS-pair domain complexed with Mg2+-ATP' 7M1T unspecified PDB '7M1U contains both the TMD and CBS-pair domain with R235L mutation' 7M1U unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7MSU _pdbx_database_status.recvd_initial_deposition_date 2021-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, Y.S.' 1 0000-0002-0793-2391 'Gehring, K.' 2 0000-0001-6500-1184 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 4028 _citation.page_last 4028 _citation.title 'Crystal structure of an archaeal CorB magnesium transporter.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-24282-7 _citation.pdbx_database_id_PubMed 34188059 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, Y.S.' 1 0000-0002-0793-2391 primary 'Kozlov, G.' 2 0000-0002-7742-6558 primary 'Moeller, B.E.' 3 ? primary 'Rohaim, A.' 4 ? primary 'Fakih, R.' 5 ? primary 'Roux, B.' 6 0000-0002-5254-2712 primary 'Burke, J.E.' 7 0000-0001-7904-9859 primary 'Gehring, K.' 8 0000-0001-6500-1184 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7MSU _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.100 _cell.length_a_esd ? _cell.length_b 52.100 _cell.length_b_esd ? _cell.length_c 112.284 _cell.length_c_esd ? _cell.volume 304784.812 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7MSU _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall 'P 4w 2c' _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hemolysin, contains CBS domains' 15212.321 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 5 water nat water 18.015 56 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DTTAREVMTPRVDVVMIEDTATLESALAIFNETGFSRIPVYHERIDNIVGLLNVKDVFSAVFRQQTSATIRDLMYEPYFI PESKKIDELLKELQVKKQHMAVVLDEYGSFAGIVTVEDMLEELVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;DTTAREVMTPRVDVVMIEDTATLESALAIFNETGFSRIPVYHERIDNIVGLLNVKDVFSAVFRQQTSATIRDLMYEPYFI PESKKIDELLKELQVKKQHMAVVLDEYGSFAGIVTVEDMLEELVLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 THR n 1 3 THR n 1 4 ALA n 1 5 ARG n 1 6 GLU n 1 7 VAL n 1 8 MET n 1 9 THR n 1 10 PRO n 1 11 ARG n 1 12 VAL n 1 13 ASP n 1 14 VAL n 1 15 VAL n 1 16 MET n 1 17 ILE n 1 18 GLU n 1 19 ASP n 1 20 THR n 1 21 ALA n 1 22 THR n 1 23 LEU n 1 24 GLU n 1 25 SER n 1 26 ALA n 1 27 LEU n 1 28 ALA n 1 29 ILE n 1 30 PHE n 1 31 ASN n 1 32 GLU n 1 33 THR n 1 34 GLY n 1 35 PHE n 1 36 SER n 1 37 ARG n 1 38 ILE n 1 39 PRO n 1 40 VAL n 1 41 TYR n 1 42 HIS n 1 43 GLU n 1 44 ARG n 1 45 ILE n 1 46 ASP n 1 47 ASN n 1 48 ILE n 1 49 VAL n 1 50 GLY n 1 51 LEU n 1 52 LEU n 1 53 ASN n 1 54 VAL n 1 55 LYS n 1 56 ASP n 1 57 VAL n 1 58 PHE n 1 59 SER n 1 60 ALA n 1 61 VAL n 1 62 PHE n 1 63 ARG n 1 64 GLN n 1 65 GLN n 1 66 THR n 1 67 SER n 1 68 ALA n 1 69 THR n 1 70 ILE n 1 71 ARG n 1 72 ASP n 1 73 LEU n 1 74 MET n 1 75 TYR n 1 76 GLU n 1 77 PRO n 1 78 TYR n 1 79 PHE n 1 80 ILE n 1 81 PRO n 1 82 GLU n 1 83 SER n 1 84 LYS n 1 85 LYS n 1 86 ILE n 1 87 ASP n 1 88 GLU n 1 89 LEU n 1 90 LEU n 1 91 LYS n 1 92 GLU n 1 93 LEU n 1 94 GLN n 1 95 VAL n 1 96 LYS n 1 97 LYS n 1 98 GLN n 1 99 HIS n 1 100 MET n 1 101 ALA n 1 102 VAL n 1 103 VAL n 1 104 LEU n 1 105 ASP n 1 106 GLU n 1 107 TYR n 1 108 GLY n 1 109 SER n 1 110 PHE n 1 111 ALA n 1 112 GLY n 1 113 ILE n 1 114 VAL n 1 115 THR n 1 116 VAL n 1 117 GLU n 1 118 ASP n 1 119 MET n 1 120 LEU n 1 121 GLU n 1 122 GLU n 1 123 LEU n 1 124 VAL n 1 125 LEU n 1 126 GLU n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 132 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SAMN04488571_101329 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanoculleus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2200 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1G8XA46_9EURY _struct_ref.pdbx_db_accession A0A1G8XA46 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DTTAREVMTPRVDVVMIEDTATLESALAIFNETGFSRIPVYHERIDNIVGLLNVKDVFSAVFRQQTSATIRDLMYEPYFI PESKKIDELLKELQVKKQHMAVVLDEYGSFAGIVTVEDMLEELV ; _struct_ref.pdbx_align_begin 199 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7MSU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1G8XA46 _struct_ref_seq.db_align_beg 199 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 322 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 199 _struct_ref_seq.pdbx_auth_seq_align_end 322 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7MSU LEU A 125 ? UNP A0A1G8XA46 ? ? 'expression tag' 323 1 1 7MSU GLU A 126 ? UNP A0A1G8XA46 ? ? 'expression tag' 324 2 1 7MSU HIS A 127 ? UNP A0A1G8XA46 ? ? 'expression tag' 325 3 1 7MSU HIS A 128 ? UNP A0A1G8XA46 ? ? 'expression tag' 326 4 1 7MSU HIS A 129 ? UNP A0A1G8XA46 ? ? 'expression tag' 327 5 1 7MSU HIS A 130 ? UNP A0A1G8XA46 ? ? 'expression tag' 328 6 1 7MSU HIS A 131 ? UNP A0A1G8XA46 ? ? 'expression tag' 329 7 1 7MSU HIS A 132 ? UNP A0A1G8XA46 ? ? 'expression tag' 330 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7MSU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MOPS, pH 7.0; 9% PEG 8000; 20 mM MgCl2, 5 mM ATP' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double-crystal, Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00003 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00003 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 24.01 _reflns.entry_id 7MSU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.05 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11974 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 22 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 38.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.09 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 294 _reflns_shell.percent_possible_all 97.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.721 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 34.90 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7MSU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.07 _refine.ls_d_res_low 38.19 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11970 _refine.ls_number_reflns_R_free 601 _refine.ls_number_reflns_R_work 11369 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 66.89 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2083 _refine.ls_R_factor_R_free 0.2517 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2060 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5YZ2 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.2179 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2655 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.07 _refine_hist.d_res_low 38.19 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 1023 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 930 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0017 ? 978 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5419 ? 1335 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0540 ? 164 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0034 ? 164 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.0210 ? 341 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.07 2.28 . . 67 1281 30.09 . . . 0.2763 . 0.2531 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.28 2.61 . . 119 2260 53.34 . . . 0.3464 . 0.2481 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.61 3.29 . . 183 3575 84.18 . . . 0.2229 . 0.2148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.29 38.19 . . 232 4253 99.93 . . . 0.2439 . 0.1898 . . . . . . . . . . . # _struct.entry_id 7MSU _struct.title 'Crystal structure of an archaeal CNNM, MtCorB, CBS-pair domain in complex with Mg2+-ATP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7MSU _struct_keywords.text 'CorB, CNNM, DUF21, magnesium transporter, METAL TRANSPORT, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? MET A 8 ? THR A 201 MET A 206 1 ? 6 HELX_P HELX_P2 AA2 VAL A 12 ? VAL A 14 ? VAL A 210 VAL A 212 5 ? 3 HELX_P HELX_P3 AA3 THR A 22 ? GLY A 34 ? THR A 220 GLY A 232 1 ? 13 HELX_P HELX_P4 AA4 VAL A 54 ? ALA A 60 ? VAL A 252 ALA A 258 1 ? 7 HELX_P HELX_P5 AA5 THR A 69 ? MET A 74 ? THR A 267 MET A 272 1 ? 6 HELX_P HELX_P6 AA6 LYS A 85 ? LYS A 97 ? LYS A 283 LYS A 295 1 ? 13 HELX_P HELX_P7 AA7 VAL A 116 ? GLU A 121 ? VAL A 314 GLU A 319 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C MG . MG ? ? ? 1_555 E ATP . O1A ? ? A MG 402 A ATP 404 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc2 metalc ? ? C MG . MG ? ? ? 1_555 E ATP . O1G ? ? A MG 402 A ATP 404 1_555 ? ? ? ? ? ? ? 2.127 ? ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 E ATP . O1B ? ? A MG 402 A ATP 404 1_555 ? ? ? ? ? ? ? 2.308 ? ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 502 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 525 1_555 ? ? ? ? ? ? ? 2.010 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 532 1_555 ? ? ? ? ? ? ? 2.166 ? ? metalc7 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 520 1_555 ? ? ? ? ? ? ? 2.141 ? ? metalc8 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 520 5_455 ? ? ? ? ? ? ? 2.141 ? ? metalc9 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 522 1_555 ? ? ? ? ? ? ? 1.944 ? ? metalc10 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 522 5_455 ? ? ? ? ? ? ? 1.944 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 544 1_555 ? ? ? ? ? ? ? 1.957 ? ? metalc12 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 544 5_455 ? ? ? ? ? ? ? 1.957 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 9 ? PRO A 10 ? THR A 207 PRO A 208 AA1 2 PHE A 110 ? THR A 115 ? PHE A 308 THR A 313 AA1 3 MET A 100 ? LEU A 104 ? MET A 298 LEU A 302 AA1 4 PHE A 79 ? PRO A 81 ? PHE A 277 PRO A 279 AA2 1 ILE A 17 ? GLU A 18 ? ILE A 215 GLU A 216 AA2 2 ARG A 37 ? TYR A 41 ? ARG A 235 TYR A 239 AA2 3 ILE A 48 ? ASN A 53 ? ILE A 246 ASN A 251 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 9 ? N THR A 207 O ILE A 113 ? O ILE A 311 AA1 2 3 O ALA A 111 ? O ALA A 309 N VAL A 103 ? N VAL A 301 AA1 3 4 O LEU A 104 ? O LEU A 302 N ILE A 80 ? N ILE A 278 AA2 1 2 N ILE A 17 ? N ILE A 215 O TYR A 41 ? O TYR A 239 AA2 2 3 N VAL A 40 ? N VAL A 238 O GLY A 50 ? O GLY A 248 # _atom_sites.entry_id 7MSU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019194 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019194 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008906 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 199 199 ASP ASP A . n A 1 2 THR 2 200 200 THR THR A . n A 1 3 THR 3 201 201 THR THR A . n A 1 4 ALA 4 202 202 ALA ALA A . n A 1 5 ARG 5 203 203 ARG ARG A . n A 1 6 GLU 6 204 204 GLU GLU A . n A 1 7 VAL 7 205 205 VAL VAL A . n A 1 8 MET 8 206 206 MET MET A . n A 1 9 THR 9 207 207 THR THR A . n A 1 10 PRO 10 208 208 PRO PRO A . n A 1 11 ARG 11 209 209 ARG ARG A . n A 1 12 VAL 12 210 210 VAL VAL A . n A 1 13 ASP 13 211 211 ASP ASP A . n A 1 14 VAL 14 212 212 VAL VAL A . n A 1 15 VAL 15 213 213 VAL VAL A . n A 1 16 MET 16 214 214 MET MET A . n A 1 17 ILE 17 215 215 ILE ILE A . n A 1 18 GLU 18 216 216 GLU GLU A . n A 1 19 ASP 19 217 217 ASP ASP A . n A 1 20 THR 20 218 218 THR THR A . n A 1 21 ALA 21 219 219 ALA ALA A . n A 1 22 THR 22 220 220 THR THR A . n A 1 23 LEU 23 221 221 LEU LEU A . n A 1 24 GLU 24 222 222 GLU GLU A . n A 1 25 SER 25 223 223 SER SER A . n A 1 26 ALA 26 224 224 ALA ALA A . n A 1 27 LEU 27 225 225 LEU LEU A . n A 1 28 ALA 28 226 226 ALA ALA A . n A 1 29 ILE 29 227 227 ILE ILE A . n A 1 30 PHE 30 228 228 PHE PHE A . n A 1 31 ASN 31 229 229 ASN ASN A . n A 1 32 GLU 32 230 230 GLU GLU A . n A 1 33 THR 33 231 231 THR THR A . n A 1 34 GLY 34 232 232 GLY GLY A . n A 1 35 PHE 35 233 233 PHE PHE A . n A 1 36 SER 36 234 234 SER SER A . n A 1 37 ARG 37 235 235 ARG ARG A . n A 1 38 ILE 38 236 236 ILE ILE A . n A 1 39 PRO 39 237 237 PRO PRO A . n A 1 40 VAL 40 238 238 VAL VAL A . n A 1 41 TYR 41 239 239 TYR TYR A . n A 1 42 HIS 42 240 240 HIS HIS A . n A 1 43 GLU 43 241 241 GLU GLU A . n A 1 44 ARG 44 242 242 ARG ARG A . n A 1 45 ILE 45 243 243 ILE ILE A . n A 1 46 ASP 46 244 244 ASP ASP A . n A 1 47 ASN 47 245 245 ASN ASN A . n A 1 48 ILE 48 246 246 ILE ILE A . n A 1 49 VAL 49 247 247 VAL VAL A . n A 1 50 GLY 50 248 248 GLY GLY A . n A 1 51 LEU 51 249 249 LEU LEU A . n A 1 52 LEU 52 250 250 LEU LEU A . n A 1 53 ASN 53 251 251 ASN ASN A . n A 1 54 VAL 54 252 252 VAL VAL A . n A 1 55 LYS 55 253 253 LYS LYS A . n A 1 56 ASP 56 254 254 ASP ASP A . n A 1 57 VAL 57 255 255 VAL VAL A . n A 1 58 PHE 58 256 256 PHE PHE A . n A 1 59 SER 59 257 257 SER SER A . n A 1 60 ALA 60 258 258 ALA ALA A . n A 1 61 VAL 61 259 259 VAL VAL A . n A 1 62 PHE 62 260 ? ? ? A . n A 1 63 ARG 63 261 261 ARG ARG A . n A 1 64 GLN 64 262 262 GLN GLN A . n A 1 65 GLN 65 263 263 GLN GLN A . n A 1 66 THR 66 264 264 THR THR A . n A 1 67 SER 67 265 265 SER SER A . n A 1 68 ALA 68 266 266 ALA ALA A . n A 1 69 THR 69 267 267 THR THR A . n A 1 70 ILE 70 268 268 ILE ILE A . n A 1 71 ARG 71 269 269 ARG ARG A . n A 1 72 ASP 72 270 270 ASP ASP A . n A 1 73 LEU 73 271 271 LEU LEU A . n A 1 74 MET 74 272 272 MET MET A . n A 1 75 TYR 75 273 273 TYR TYR A . n A 1 76 GLU 76 274 274 GLU GLU A . n A 1 77 PRO 77 275 275 PRO PRO A . n A 1 78 TYR 78 276 276 TYR TYR A . n A 1 79 PHE 79 277 277 PHE PHE A . n A 1 80 ILE 80 278 278 ILE ILE A . n A 1 81 PRO 81 279 279 PRO PRO A . n A 1 82 GLU 82 280 280 GLU GLU A . n A 1 83 SER 83 281 281 SER SER A . n A 1 84 LYS 84 282 282 LYS LYS A . n A 1 85 LYS 85 283 283 LYS LYS A . n A 1 86 ILE 86 284 284 ILE ILE A . n A 1 87 ASP 87 285 285 ASP ASP A . n A 1 88 GLU 88 286 286 GLU GLU A . n A 1 89 LEU 89 287 287 LEU LEU A . n A 1 90 LEU 90 288 288 LEU LEU A . n A 1 91 LYS 91 289 289 LYS LYS A . n A 1 92 GLU 92 290 290 GLU GLU A . n A 1 93 LEU 93 291 291 LEU LEU A . n A 1 94 GLN 94 292 292 GLN GLN A . n A 1 95 VAL 95 293 293 VAL VAL A . n A 1 96 LYS 96 294 294 LYS LYS A . n A 1 97 LYS 97 295 295 LYS LYS A . n A 1 98 GLN 98 296 296 GLN GLN A . n A 1 99 HIS 99 297 297 HIS HIS A . n A 1 100 MET 100 298 298 MET MET A . n A 1 101 ALA 101 299 299 ALA ALA A . n A 1 102 VAL 102 300 300 VAL VAL A . n A 1 103 VAL 103 301 301 VAL VAL A . n A 1 104 LEU 104 302 302 LEU LEU A . n A 1 105 ASP 105 303 303 ASP ASP A . n A 1 106 GLU 106 304 304 GLU GLU A . n A 1 107 TYR 107 305 305 TYR TYR A . n A 1 108 GLY 108 306 306 GLY GLY A . n A 1 109 SER 109 307 307 SER SER A . n A 1 110 PHE 110 308 308 PHE PHE A . n A 1 111 ALA 111 309 309 ALA ALA A . n A 1 112 GLY 112 310 310 GLY GLY A . n A 1 113 ILE 113 311 311 ILE ILE A . n A 1 114 VAL 114 312 312 VAL VAL A . n A 1 115 THR 115 313 313 THR THR A . n A 1 116 VAL 116 314 314 VAL VAL A . n A 1 117 GLU 117 315 315 GLU GLU A . n A 1 118 ASP 118 316 316 ASP ASP A . n A 1 119 MET 119 317 317 MET MET A . n A 1 120 LEU 120 318 318 LEU LEU A . n A 1 121 GLU 121 319 319 GLU GLU A . n A 1 122 GLU 122 320 320 GLU GLU A . n A 1 123 LEU 123 321 321 LEU LEU A . n A 1 124 VAL 124 322 322 VAL VAL A . n A 1 125 LEU 125 323 ? ? ? A . n A 1 126 GLU 126 324 ? ? ? A . n A 1 127 HIS 127 325 ? ? ? A . n A 1 128 HIS 128 326 ? ? ? A . n A 1 129 HIS 129 327 ? ? ? A . n A 1 130 HIS 130 328 ? ? ? A . n A 1 131 HIS 131 329 ? ? ? A . n A 1 132 HIS 132 330 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 401 401 EDO EDO A . C 3 MG 1 402 1 MG MG A . D 3 MG 1 403 2 MG MG A . E 4 ATP 1 404 1 ATP ATP A . F 5 HOH 1 501 9 HOH HOH A . F 5 HOH 2 502 3 HOH HOH A . F 5 HOH 3 503 10 HOH HOH A . F 5 HOH 4 504 49 HOH HOH A . F 5 HOH 5 505 23 HOH HOH A . F 5 HOH 6 506 25 HOH HOH A . F 5 HOH 7 507 30 HOH HOH A . F 5 HOH 8 508 1 HOH HOH A . F 5 HOH 9 509 17 HOH HOH A . F 5 HOH 10 510 19 HOH HOH A . F 5 HOH 11 511 16 HOH HOH A . F 5 HOH 12 512 24 HOH HOH A . F 5 HOH 13 513 12 HOH HOH A . F 5 HOH 14 514 15 HOH HOH A . F 5 HOH 15 515 20 HOH HOH A . F 5 HOH 16 516 39 HOH HOH A . F 5 HOH 17 517 14 HOH HOH A . F 5 HOH 18 518 7 HOH HOH A . F 5 HOH 19 519 31 HOH HOH A . F 5 HOH 20 520 2 HOH HOH A . F 5 HOH 21 521 4 HOH HOH A . F 5 HOH 22 522 46 HOH HOH A . F 5 HOH 23 523 5 HOH HOH A . F 5 HOH 24 524 13 HOH HOH A . F 5 HOH 25 525 6 HOH HOH A . F 5 HOH 26 526 21 HOH HOH A . F 5 HOH 27 527 34 HOH HOH A . F 5 HOH 28 528 22 HOH HOH A . F 5 HOH 29 529 54 HOH HOH A . F 5 HOH 30 530 33 HOH HOH A . F 5 HOH 31 531 37 HOH HOH A . F 5 HOH 32 532 11 HOH HOH A . F 5 HOH 33 533 40 HOH HOH A . F 5 HOH 34 534 8 HOH HOH A . F 5 HOH 35 535 29 HOH HOH A . F 5 HOH 36 536 18 HOH HOH A . F 5 HOH 37 537 47 HOH HOH A . F 5 HOH 38 538 43 HOH HOH A . F 5 HOH 39 539 36 HOH HOH A . F 5 HOH 40 540 48 HOH HOH A . F 5 HOH 41 541 27 HOH HOH A . F 5 HOH 42 542 56 HOH HOH A . F 5 HOH 43 543 44 HOH HOH A . F 5 HOH 44 544 53 HOH HOH A . F 5 HOH 45 545 38 HOH HOH A . F 5 HOH 46 546 32 HOH HOH A . F 5 HOH 47 547 55 HOH HOH A . F 5 HOH 48 548 45 HOH HOH A . F 5 HOH 49 549 35 HOH HOH A . F 5 HOH 50 550 26 HOH HOH A . F 5 HOH 51 551 28 HOH HOH A . F 5 HOH 52 552 42 HOH HOH A . F 5 HOH 53 553 50 HOH HOH A . F 5 HOH 54 554 52 HOH HOH A . F 5 HOH 55 555 57 HOH HOH A . F 5 HOH 56 556 41 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 403 ? D MG . 2 1 A HOH 529 ? F HOH . 3 1 A HOH 553 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O1A ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1G ? E ATP . ? A ATP 404 ? 1_555 99.5 ? 2 O1A ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1B ? E ATP . ? A ATP 404 ? 1_555 91.1 ? 3 O1G ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1B ? E ATP . ? A ATP 404 ? 1_555 91.9 ? 4 O1A ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 502 ? 1_555 88.8 ? 5 O1G ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 502 ? 1_555 92.9 ? 6 O1B ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 502 ? 1_555 175.2 ? 7 O1A ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 89.2 ? 8 O1G ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 171.2 ? 9 O1B ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 88.7 ? 10 O ? F HOH . ? A HOH 502 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 86.4 ? 11 O1A ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 168.8 ? 12 O1G ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 91.5 ? 13 O1B ? E ATP . ? A ATP 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 86.8 ? 14 O ? F HOH . ? A HOH 502 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 92.4 ? 15 O ? F HOH . ? A HOH 525 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 532 ? 1_555 79.8 ? 16 O ? F HOH . ? A HOH 520 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 520 ? 5_455 175.9 ? 17 O ? F HOH . ? A HOH 520 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 522 ? 1_555 90.7 ? 18 O ? F HOH . ? A HOH 520 ? 5_455 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 522 ? 1_555 87.0 ? 19 O ? F HOH . ? A HOH 520 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 522 ? 5_455 87.0 ? 20 O ? F HOH . ? A HOH 520 ? 5_455 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 522 ? 5_455 90.7 ? 21 O ? F HOH . ? A HOH 522 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 522 ? 5_455 112.0 ? 22 O ? F HOH . ? A HOH 520 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 1_555 95.8 ? 23 O ? F HOH . ? A HOH 520 ? 5_455 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 1_555 87.4 ? 24 O ? F HOH . ? A HOH 522 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 1_555 86.0 ? 25 O ? F HOH . ? A HOH 522 ? 5_455 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 1_555 161.7 ? 26 O ? F HOH . ? A HOH 520 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 5_455 87.4 ? 27 O ? F HOH . ? A HOH 520 ? 5_455 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 5_455 95.8 ? 28 O ? F HOH . ? A HOH 522 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 5_455 161.7 ? 29 O ? F HOH . ? A HOH 522 ? 5_455 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 5_455 86.0 ? 30 O ? F HOH . ? A HOH 544 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 544 ? 5_455 76.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-16 2 'Structure model' 1 1 2021-07-07 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+1/4 3 y,-x,z+3/4 4 x,-y,-z+1/2 5 -x,y,-z 6 -x,-y,z+1/2 7 y,x,-z+3/4 8 -y,-x,-z+1/4 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -12.4148336107 _pdbx_refine_tls.origin_y -9.85326114007 _pdbx_refine_tls.origin_z -3.16444258 _pdbx_refine_tls.T[1][1] 0.137857412517 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0261138735591 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0695205941717 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.399779513185 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0301408973382 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.23487970648 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.549112507789 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0576008462619 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.120351226288 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.281037031875 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.252917614052 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.44528882517 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.140530210982 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.00990749859315 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.173888610292 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0798853692139 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0194215750072 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.124491983986 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.126667644096 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.042129524262 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.00549688255522 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 199 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id F _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id S _pdbx_refine_tls_group.end_auth_seq_id 57 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v720 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v720 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 4 # _pdbx_entry_details.entry_id 7MSU _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 505 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 548 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 234 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 253 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 241 ? ? 69.08 -66.54 2 1 ASN A 245 ? ? -105.63 76.35 3 1 SER A 265 ? ? -85.84 34.46 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 556 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance . _pdbx_distant_solvent_atoms.neighbor_ligand_distance 5.94 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 199 ? CG ? A ASP 1 CG 2 1 Y 1 A ASP 199 ? OD1 ? A ASP 1 OD1 3 1 Y 1 A ASP 199 ? OD2 ? A ASP 1 OD2 4 1 Y 1 A GLU 222 ? CG ? A GLU 24 CG 5 1 Y 1 A GLU 222 ? CD ? A GLU 24 CD 6 1 Y 1 A GLU 222 ? OE1 ? A GLU 24 OE1 7 1 Y 1 A GLU 222 ? OE2 ? A GLU 24 OE2 8 1 Y 1 A GLU 230 ? CG ? A GLU 32 CG 9 1 Y 1 A GLU 230 ? CD ? A GLU 32 CD 10 1 Y 1 A GLU 230 ? OE1 ? A GLU 32 OE1 11 1 Y 1 A GLU 230 ? OE2 ? A GLU 32 OE2 12 1 Y 1 A PHE 256 ? CG ? A PHE 58 CG 13 1 Y 1 A PHE 256 ? CD1 ? A PHE 58 CD1 14 1 Y 1 A PHE 256 ? CD2 ? A PHE 58 CD2 15 1 Y 1 A PHE 256 ? CE1 ? A PHE 58 CE1 16 1 Y 1 A PHE 256 ? CE2 ? A PHE 58 CE2 17 1 Y 1 A PHE 256 ? CZ ? A PHE 58 CZ 18 1 Y 1 A ARG 261 ? CG ? A ARG 63 CG 19 1 Y 1 A ARG 261 ? CD ? A ARG 63 CD 20 1 Y 1 A ARG 261 ? NE ? A ARG 63 NE 21 1 Y 1 A ARG 261 ? CZ ? A ARG 63 CZ 22 1 Y 1 A ARG 261 ? NH1 ? A ARG 63 NH1 23 1 Y 1 A ARG 261 ? NH2 ? A ARG 63 NH2 24 1 Y 1 A GLN 262 ? CG ? A GLN 64 CG 25 1 Y 1 A GLN 262 ? CD ? A GLN 64 CD 26 1 Y 1 A GLN 262 ? OE1 ? A GLN 64 OE1 27 1 Y 1 A GLN 262 ? NE2 ? A GLN 64 NE2 28 1 Y 1 A GLN 263 ? CG ? A GLN 65 CG 29 1 Y 1 A GLN 263 ? CD ? A GLN 65 CD 30 1 Y 1 A GLN 263 ? OE1 ? A GLN 65 OE1 31 1 Y 1 A GLN 263 ? NE2 ? A GLN 65 NE2 32 1 Y 1 A THR 264 ? OG1 ? A THR 66 OG1 33 1 Y 1 A THR 264 ? CG2 ? A THR 66 CG2 34 1 Y 1 A LYS 289 ? CG ? A LYS 91 CG 35 1 Y 1 A LYS 289 ? CD ? A LYS 91 CD 36 1 Y 1 A LYS 289 ? CE ? A LYS 91 CE 37 1 Y 1 A LYS 289 ? NZ ? A LYS 91 NZ 38 1 Y 1 A LYS 295 ? CG ? A LYS 97 CG 39 1 Y 1 A LYS 295 ? CD ? A LYS 97 CD 40 1 Y 1 A LYS 295 ? CE ? A LYS 97 CE 41 1 Y 1 A LYS 295 ? NZ ? A LYS 97 NZ 42 1 Y 1 A GLN 296 ? CG ? A GLN 98 CG 43 1 Y 1 A GLN 296 ? CD ? A GLN 98 CD 44 1 Y 1 A GLN 296 ? OE1 ? A GLN 98 OE1 45 1 Y 1 A GLN 296 ? NE2 ? A GLN 98 NE2 46 1 Y 1 A LEU 321 ? CG ? A LEU 123 CG 47 1 Y 1 A LEU 321 ? CD1 ? A LEU 123 CD1 48 1 Y 1 A LEU 321 ? CD2 ? A LEU 123 CD2 49 1 Y 1 A VAL 322 ? CG1 ? A VAL 124 CG1 50 1 Y 1 A VAL 322 ? CG2 ? A VAL 124 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PHE 260 ? A PHE 62 2 1 Y 1 A LEU 323 ? A LEU 125 3 1 Y 1 A GLU 324 ? A GLU 126 4 1 Y 1 A HIS 325 ? A HIS 127 5 1 Y 1 A HIS 326 ? A HIS 128 6 1 Y 1 A HIS 327 ? A HIS 129 7 1 Y 1 A HIS 328 ? A HIS 130 8 1 Y 1 A HIS 329 ? A HIS 131 9 1 Y 1 A HIS 330 ? A HIS 132 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 ATP PG P N N 74 ATP O1G O N N 75 ATP O2G O N N 76 ATP O3G O N N 77 ATP PB P N R 78 ATP O1B O N N 79 ATP O2B O N N 80 ATP O3B O N N 81 ATP PA P N R 82 ATP O1A O N N 83 ATP O2A O N N 84 ATP O3A O N N 85 ATP "O5'" O N N 86 ATP "C5'" C N N 87 ATP "C4'" C N R 88 ATP "O4'" O N N 89 ATP "C3'" C N S 90 ATP "O3'" O N N 91 ATP "C2'" C N R 92 ATP "O2'" O N N 93 ATP "C1'" C N R 94 ATP N9 N Y N 95 ATP C8 C Y N 96 ATP N7 N Y N 97 ATP C5 C Y N 98 ATP C6 C Y N 99 ATP N6 N N N 100 ATP N1 N Y N 101 ATP C2 C Y N 102 ATP N3 N Y N 103 ATP C4 C Y N 104 ATP HOG2 H N N 105 ATP HOG3 H N N 106 ATP HOB2 H N N 107 ATP HOA2 H N N 108 ATP "H5'1" H N N 109 ATP "H5'2" H N N 110 ATP "H4'" H N N 111 ATP "H3'" H N N 112 ATP "HO3'" H N N 113 ATP "H2'" H N N 114 ATP "HO2'" H N N 115 ATP "H1'" H N N 116 ATP H8 H N N 117 ATP HN61 H N N 118 ATP HN62 H N N 119 ATP H2 H N N 120 EDO C1 C N N 121 EDO O1 O N N 122 EDO C2 C N N 123 EDO O2 O N N 124 EDO H11 H N N 125 EDO H12 H N N 126 EDO HO1 H N N 127 EDO H21 H N N 128 EDO H22 H N N 129 EDO HO2 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 MG MG MG N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 ATP PG O1G doub N N 70 ATP PG O2G sing N N 71 ATP PG O3G sing N N 72 ATP PG O3B sing N N 73 ATP O2G HOG2 sing N N 74 ATP O3G HOG3 sing N N 75 ATP PB O1B doub N N 76 ATP PB O2B sing N N 77 ATP PB O3B sing N N 78 ATP PB O3A sing N N 79 ATP O2B HOB2 sing N N 80 ATP PA O1A doub N N 81 ATP PA O2A sing N N 82 ATP PA O3A sing N N 83 ATP PA "O5'" sing N N 84 ATP O2A HOA2 sing N N 85 ATP "O5'" "C5'" sing N N 86 ATP "C5'" "C4'" sing N N 87 ATP "C5'" "H5'1" sing N N 88 ATP "C5'" "H5'2" sing N N 89 ATP "C4'" "O4'" sing N N 90 ATP "C4'" "C3'" sing N N 91 ATP "C4'" "H4'" sing N N 92 ATP "O4'" "C1'" sing N N 93 ATP "C3'" "O3'" sing N N 94 ATP "C3'" "C2'" sing N N 95 ATP "C3'" "H3'" sing N N 96 ATP "O3'" "HO3'" sing N N 97 ATP "C2'" "O2'" sing N N 98 ATP "C2'" "C1'" sing N N 99 ATP "C2'" "H2'" sing N N 100 ATP "O2'" "HO2'" sing N N 101 ATP "C1'" N9 sing N N 102 ATP "C1'" "H1'" sing N N 103 ATP N9 C8 sing Y N 104 ATP N9 C4 sing Y N 105 ATP C8 N7 doub Y N 106 ATP C8 H8 sing N N 107 ATP N7 C5 sing Y N 108 ATP C5 C6 sing Y N 109 ATP C5 C4 doub Y N 110 ATP C6 N6 sing N N 111 ATP C6 N1 doub Y N 112 ATP N6 HN61 sing N N 113 ATP N6 HN62 sing N N 114 ATP N1 C2 sing Y N 115 ATP C2 N3 doub Y N 116 ATP C2 H2 sing N N 117 ATP N3 C4 sing Y N 118 EDO C1 O1 sing N N 119 EDO C1 C2 sing N N 120 EDO C1 H11 sing N N 121 EDO C1 H12 sing N N 122 EDO O1 HO1 sing N N 123 EDO C2 O2 sing N N 124 EDO C2 H21 sing N N 125 EDO C2 H22 sing N N 126 EDO O2 HO2 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number RGPIN-2020-07195 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 'MAGNESIUM ION' MG 4 "ADENOSINE-5'-TRIPHOSPHATE" ATP 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5YZ2 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 41 2 2' _space_group.name_Hall 'P 4w 2c' _space_group.IT_number 91 _space_group.crystal_system tetragonal _space_group.id 1 #