data_7N6K # _entry.id 7N6K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7N6K pdb_00007n6k 10.2210/pdb7n6k/pdb WWPDB D_1000257429 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2021-06-23 _pdbx_database_PDB_obs_spr.pdb_id 7N6K _pdbx_database_PDB_obs_spr.replace_pdb_id 7JML _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '7HN9 contains the same protein but in complex with another peptide' _pdbx_database_related.db_id 7JN9 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7N6K _pdbx_database_status.recvd_initial_deposition_date 2021-06-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jansen, R.M.' 1 0000-0003-4666-9976 'Ozden, C.' 2 0000-0002-5673-878X 'Gierasch, L.M.' 3 0000-0002-5706-115X 'Garman, S.C.' 4 0000-0001-9912-2670 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 118 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Selective promiscuity in the binding of E. coli Hsp70 to an unfolded protein.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2016962118 _citation.pdbx_database_id_PubMed 34625496 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clerico, E.M.' 1 0000-0002-4433-8842 primary 'Pozhidaeva, A.K.' 2 0000-0001-8602-1790 primary 'Jansen, R.M.' 3 0000-0003-4666-9976 primary 'Ozden, C.' 4 0000-0002-5673-878X primary 'Tilitsky, J.M.' 5 0000-0001-8555-398X primary 'Gierasch, L.M.' 6 0000-0002-5706-115X # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7N6K _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.763 _cell.length_a_esd ? _cell.length_b 94.773 _cell.length_b_esd ? _cell.length_c 117.109 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7N6K _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chaperone protein DnaK' 23820.777 1 ? ? ? ? 2 polymer syn 'Alkaline phosphatase peptide' 1111.382 1 3.1.3.1 'I6R, L14S, F15R' ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 13 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'HSP70,Heat shock 70 kDa protein,Heat shock protein 70' 2 APase # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRG MPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRK QVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA ; ;VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRG MPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRK QVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA ; A ? 2 'polypeptide(L)' no no RALALLPLSR RALALLPLSR B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 LEU n 1 4 LEU n 1 5 ASP n 1 6 VAL n 1 7 THR n 1 8 PRO n 1 9 LEU n 1 10 SER n 1 11 LEU n 1 12 GLY n 1 13 ILE n 1 14 GLU n 1 15 THR n 1 16 MET n 1 17 GLY n 1 18 GLY n 1 19 VAL n 1 20 MET n 1 21 THR n 1 22 THR n 1 23 LEU n 1 24 ILE n 1 25 ALA n 1 26 LYS n 1 27 ASN n 1 28 THR n 1 29 THR n 1 30 ILE n 1 31 PRO n 1 32 THR n 1 33 LYS n 1 34 HIS n 1 35 SER n 1 36 GLN n 1 37 VAL n 1 38 PHE n 1 39 SER n 1 40 THR n 1 41 ALA n 1 42 GLU n 1 43 ASP n 1 44 ASN n 1 45 GLN n 1 46 SER n 1 47 ALA n 1 48 VAL n 1 49 THR n 1 50 ILE n 1 51 HIS n 1 52 VAL n 1 53 LEU n 1 54 GLN n 1 55 GLY n 1 56 GLU n 1 57 ARG n 1 58 LYS n 1 59 ARG n 1 60 ALA n 1 61 ALA n 1 62 ASP n 1 63 ASN n 1 64 LYS n 1 65 SER n 1 66 LEU n 1 67 GLY n 1 68 GLN n 1 69 PHE n 1 70 ASN n 1 71 LEU n 1 72 ASP n 1 73 GLY n 1 74 ILE n 1 75 ASN n 1 76 PRO n 1 77 ALA n 1 78 PRO n 1 79 ARG n 1 80 GLY n 1 81 MET n 1 82 PRO n 1 83 GLN n 1 84 ILE n 1 85 GLU n 1 86 VAL n 1 87 THR n 1 88 PHE n 1 89 ASP n 1 90 ILE n 1 91 ASP n 1 92 ALA n 1 93 ASP n 1 94 GLY n 1 95 ILE n 1 96 LEU n 1 97 HIS n 1 98 VAL n 1 99 SER n 1 100 ALA n 1 101 LYS n 1 102 ASP n 1 103 LYS n 1 104 ASN n 1 105 SER n 1 106 GLY n 1 107 LYS n 1 108 GLU n 1 109 GLN n 1 110 LYS n 1 111 ILE n 1 112 THR n 1 113 ILE n 1 114 LYS n 1 115 ALA n 1 116 SER n 1 117 SER n 1 118 GLY n 1 119 LEU n 1 120 ASN n 1 121 GLU n 1 122 ASP n 1 123 GLU n 1 124 ILE n 1 125 GLN n 1 126 LYS n 1 127 MET n 1 128 VAL n 1 129 ARG n 1 130 ASP n 1 131 ALA n 1 132 GLU n 1 133 ALA n 1 134 ASN n 1 135 ALA n 1 136 GLU n 1 137 ALA n 1 138 ASP n 1 139 ARG n 1 140 LYS n 1 141 PHE n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 VAL n 1 146 GLN n 1 147 THR n 1 148 ARG n 1 149 ASN n 1 150 GLN n 1 151 GLY n 1 152 ASP n 1 153 HIS n 1 154 LEU n 1 155 LEU n 1 156 HIS n 1 157 SER n 1 158 THR n 1 159 ARG n 1 160 LYS n 1 161 GLN n 1 162 VAL n 1 163 GLU n 1 164 GLU n 1 165 ALA n 1 166 GLY n 1 167 ASP n 1 168 LYS n 1 169 LEU n 1 170 PRO n 1 171 ALA n 1 172 ASP n 1 173 ASP n 1 174 LYS n 1 175 THR n 1 176 ALA n 1 177 ILE n 1 178 GLU n 1 179 SER n 1 180 ALA n 1 181 LEU n 1 182 THR n 1 183 ALA n 1 184 LEU n 1 185 GLU n 1 186 THR n 1 187 ALA n 1 188 LEU n 1 189 LYS n 1 190 GLY n 1 191 GLU n 1 192 ASP n 1 193 LYS n 1 194 ALA n 1 195 ALA n 1 196 ILE n 1 197 GLU n 1 198 ALA n 1 199 LYS n 1 200 MET n 1 201 GLN n 1 202 GLU n 1 203 LEU n 1 204 ALA n 1 205 GLN n 1 206 VAL n 1 207 SER n 1 208 GLN n 1 209 LYS n 1 210 LEU n 1 211 MET n 1 212 GLU n 1 213 ILE n 1 214 ALA n 1 215 GLN n 1 216 GLN n 1 217 GLN n 1 218 HIS n 1 219 ALA n 2 1 ARG n 2 2 ALA n 2 3 LEU n 2 4 ALA n 2 5 LEU n 2 6 LEU n 2 7 PRO n 2 8 LEU n 2 9 SER n 2 10 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 219 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dnaK, groP, grpF, seg, b0014, JW0013' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Escherichia coli (strain K12)' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 83333 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP DNAK_ECOLI P0A6Y8 ? 1 ;VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRG MPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRK QVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA ; 389 2 UNP PPB_ECOLI P00634 ? 2 IALALLPLLF 6 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7N6K A 1 ? 219 ? P0A6Y8 389 ? 607 ? 389 607 2 2 7N6K B 1 ? 10 ? P00634 6 ? 15 ? -16 -7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 7N6K ARG B 1 ? UNP P00634 ILE 6 'engineered mutation' -16 1 2 7N6K SER B 9 ? UNP P00634 LEU 14 'engineered mutation' -8 2 2 7N6K ARG B 10 ? UNP P00634 PHE 15 'engineered mutation' -7 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7N6K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.6 M (NH4)2SO4, 0.1 M K3PO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details '100 K throughout the collection' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Rigaku VariMax HF' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 R 200K-A' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-09-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7N6K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.540 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6943 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.100 _reflns.pdbx_Rmerge_I_obs 0.161 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.635 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.185 _reflns.pdbx_Rpim_I_all 0.117 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 21502 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.540 2.580 ? ? ? ? ? ? 313 89.900 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.700 ? 1.315 ? ? ? ? ? 1 1 0.307 ? ? ? ? ? ? ? ? ? ? 2.580 2.630 ? ? ? ? ? ? 343 97.400 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.000 ? 1.488 ? ? ? 0.989 ? 2 1 0.234 ? ? ? ? ? ? ? ? ? ? 2.630 2.680 ? ? ? ? ? ? 355 95.400 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.100 ? 1.402 ? ? ? ? ? 3 1 0.341 ? ? ? ? ? ? ? ? ? ? 2.680 2.740 ? ? ? ? ? ? 321 97.600 ? ? ? ? 0.945 ? ? ? ? ? ? ? ? 3.100 ? 1.181 ? ? ? 0.611 ? 4 1 0.862 ? ? ? ? ? ? ? ? ? ? 2.740 2.800 ? ? ? ? ? ? 348 96.100 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.100 ? 1.242 ? ? ? 0.862 ? 5 1 0.487 ? ? ? ? ? ? ? ? ? ? 2.800 2.860 ? ? ? ? ? ? 344 96.900 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.200 ? 1.315 ? ? ? 0.687 ? 6 1 0.527 ? ? ? ? ? ? ? ? ? ? 2.860 2.930 ? ? ? ? ? ? 335 96.300 ? ? ? ? 0.693 ? ? ? ? ? ? ? ? 3.100 ? 1.269 ? ? 0.827 0.443 ? 7 1 0.594 ? ? ? ? ? ? ? ? ? ? 2.930 3.010 ? ? ? ? ? ? 341 98.600 ? ? ? ? 0.557 ? ? ? ? ? ? ? ? 3.200 ? 1.356 ? ? 0.666 0.356 ? 8 1 0.723 ? ? ? ? ? ? ? ? ? ? 3.010 3.100 ? ? ? ? ? ? 350 98.300 ? ? ? ? 0.430 ? ? ? ? ? ? ? ? 3.200 ? 1.426 ? ? 0.511 0.270 ? 9 1 0.836 ? ? ? ? ? ? ? ? ? ? 3.100 3.200 ? ? ? ? ? ? 343 99.100 ? ? ? ? 0.348 ? ? ? ? ? ? ? ? 3.100 ? 1.492 ? ? 0.415 0.221 ? 10 1 0.926 ? ? ? ? ? ? ? ? ? ? 3.200 3.310 ? ? ? ? ? ? 341 97.200 ? ? ? ? 0.274 ? ? ? ? ? ? ? ? 3.200 ? 1.423 ? ? 0.326 0.172 ? 11 1 0.928 ? ? ? ? ? ? ? ? ? ? 3.310 3.450 ? ? ? ? ? ? 351 96.700 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 3.200 ? 1.527 ? ? 0.266 0.141 ? 12 1 0.941 ? ? ? ? ? ? ? ? ? ? 3.450 3.600 ? ? ? ? ? ? 349 97.500 ? ? ? ? 0.207 ? ? ? ? ? ? ? ? 3.300 ? 1.516 ? ? 0.246 0.130 ? 13 1 0.936 ? ? ? ? ? ? ? ? ? ? 3.600 3.790 ? ? ? ? ? ? 347 98.300 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? 3.200 ? 1.676 ? ? 0.188 0.098 ? 14 1 0.958 ? ? ? ? ? ? ? ? ? ? 3.790 4.030 ? ? ? ? ? ? 354 98.100 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 3.200 ? 1.604 ? ? 0.156 0.083 ? 15 1 0.971 ? ? ? ? ? ? ? ? ? ? 4.030 4.340 ? ? ? ? ? ? 351 97.200 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 3.100 ? 1.748 ? ? 0.133 0.072 ? 16 1 0.980 ? ? ? ? ? ? ? ? ? ? 4.340 4.780 ? ? ? ? ? ? 367 98.700 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 3.200 ? 2.251 ? ? 0.122 0.064 ? 17 1 0.981 ? ? ? ? ? ? ? ? ? ? 4.780 5.470 ? ? ? ? ? ? 350 95.900 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 3.100 ? 1.826 ? ? 0.130 0.070 ? 18 1 0.978 ? ? ? ? ? ? ? ? ? ? 5.470 6.890 ? ? ? ? ? ? 364 96.800 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 3.100 ? 1.934 ? ? 0.146 0.078 ? 19 1 0.983 ? ? ? ? ? ? ? ? ? ? 6.890 50.000 ? ? ? ? ? ? 376 91.300 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 2.600 ? 3.946 ? ? 0.102 0.057 ? 20 1 0.986 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 2.8800 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.0300 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -2.8500 _refine.B_iso_max 99.530 _refine.B_iso_mean 44.0830 _refine.B_iso_min 23.530 _refine.correlation_coeff_Fo_to_Fc 0.9470 _refine.correlation_coeff_Fo_to_Fc_free 0.9100 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7N6K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5500 _refine.ls_d_res_low 30.5200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6606 _refine.ls_number_reflns_R_free 336 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.6300 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2128 _refine.ls_R_factor_R_free 0.3065 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2082 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1DKZ _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4030 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 19.5800 _refine.overall_SU_ML 0.3830 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5500 _refine_hist.d_res_low 30.5200 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1656 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 222 _refine_hist.pdbx_B_iso_mean_ligand 86.34 _refine_hist.pdbx_B_iso_mean_solvent 35.29 _refine_hist.pdbx_number_atoms_protein 1633 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 1654 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1552 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.563 1.637 2234 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.216 1.579 3619 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.478 5.000 220 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.762 25.797 69 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.721 15.000 300 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.370 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.055 0.200 238 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1837 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 269 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5530 _refine_ls_shell.d_res_low 2.6190 _refine_ls_shell.number_reflns_all 480 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 19 _refine_ls_shell.number_reflns_R_work 461 _refine_ls_shell.percent_reflns_obs 92.8400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4500 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3540 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7N6K _struct.title 'Crystal structure of the substrate-binding domain of E. coli DnaK in complex with the peptide RALALLPLSR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7N6K _struct_keywords.text 'Complex, Molecular chaperone, Protein/Peptide, CHAPERONE, CHAPERONE-HYDROLASE complex' _struct_keywords.pdbx_keywords CHAPERONE/HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 59 ? ASN A 63 ? ARG A 447 ASN A 451 5 ? 5 HELX_P HELX_P2 AA2 ASN A 120 ? ASN A 134 ? ASN A 508 ASN A 522 1 ? 15 HELX_P HELX_P3 AA3 ASN A 134 ? GLY A 166 ? ASN A 522 GLY A 554 1 ? 33 HELX_P HELX_P4 AA4 ASP A 167 ? LEU A 169 ? ASP A 555 LEU A 557 5 ? 3 HELX_P HELX_P5 AA5 PRO A 170 ? LYS A 189 ? PRO A 558 LYS A 577 1 ? 20 HELX_P HELX_P6 AA6 ASP A 192 ? SER A 207 ? ASP A 580 SER A 595 1 ? 16 HELX_P HELX_P7 AA7 SER A 207 ? GLN A 216 ? SER A 595 GLN A 604 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 30 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 418 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 31 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 419 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.59 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 19 ? ILE A 24 ? VAL A 407 ILE A 412 AA1 2 LEU A 11 ? THR A 15 ? LEU A 399 THR A 403 AA1 3 VAL A 48 ? GLN A 54 ? VAL A 436 GLN A 442 AA1 4 LYS A 64 ? LEU A 71 ? LYS A 452 LEU A 459 AA2 1 GLU A 108 ? ILE A 113 ? GLU A 496 ILE A 501 AA2 2 LEU A 96 ? ASP A 102 ? LEU A 484 ASP A 490 AA2 3 ILE A 84 ? ILE A 90 ? ILE A 472 ILE A 478 AA2 4 THR A 32 ? THR A 40 ? THR A 420 THR A 428 AA2 5 ALA B 4 ? LEU B 5 ? ALA B -13 LEU B -12 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 23 ? O LEU A 411 N LEU A 11 ? N LEU A 399 AA1 2 3 N GLY A 12 ? N GLY A 400 O LEU A 53 ? O LEU A 441 AA1 3 4 N GLN A 54 ? N GLN A 442 O LYS A 64 ? O LYS A 452 AA2 1 2 O ILE A 113 ? O ILE A 501 N LEU A 96 ? N LEU A 484 AA2 2 3 O HIS A 97 ? O HIS A 485 N ASP A 89 ? N ASP A 477 AA2 3 4 O VAL A 86 ? O VAL A 474 N GLN A 36 ? N GLN A 424 AA2 4 5 N SER A 39 ? N SER A 427 O LEU B 5 ? O LEU B -12 # _atom_sites.entry_id 7N6K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026481 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010552 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008539 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 389 389 VAL VAL A . n A 1 2 LEU 2 390 390 LEU LEU A . n A 1 3 LEU 3 391 391 LEU LEU A . n A 1 4 LEU 4 392 392 LEU LEU A . n A 1 5 ASP 5 393 393 ASP ASP A . n A 1 6 VAL 6 394 394 VAL VAL A . n A 1 7 THR 7 395 395 THR THR A . n A 1 8 PRO 8 396 396 PRO PRO A . n A 1 9 LEU 9 397 397 LEU LEU A . n A 1 10 SER 10 398 398 SER SER A . n A 1 11 LEU 11 399 399 LEU LEU A . n A 1 12 GLY 12 400 400 GLY GLY A . n A 1 13 ILE 13 401 401 ILE ILE A . n A 1 14 GLU 14 402 402 GLU GLU A . n A 1 15 THR 15 403 403 THR THR A . n A 1 16 MET 16 404 404 MET MET A . n A 1 17 GLY 17 405 405 GLY GLY A . n A 1 18 GLY 18 406 406 GLY GLY A . n A 1 19 VAL 19 407 407 VAL VAL A . n A 1 20 MET 20 408 408 MET MET A . n A 1 21 THR 21 409 409 THR THR A . n A 1 22 THR 22 410 410 THR THR A . n A 1 23 LEU 23 411 411 LEU LEU A . n A 1 24 ILE 24 412 412 ILE ILE A . n A 1 25 ALA 25 413 413 ALA ALA A . n A 1 26 LYS 26 414 414 LYS LYS A . n A 1 27 ASN 27 415 415 ASN ASN A . n A 1 28 THR 28 416 416 THR THR A . n A 1 29 THR 29 417 417 THR THR A . n A 1 30 ILE 30 418 418 ILE ILE A . n A 1 31 PRO 31 419 419 PRO PRO A . n A 1 32 THR 32 420 420 THR THR A . n A 1 33 LYS 33 421 421 LYS LYS A . n A 1 34 HIS 34 422 422 HIS HIS A . n A 1 35 SER 35 423 423 SER SER A . n A 1 36 GLN 36 424 424 GLN GLN A . n A 1 37 VAL 37 425 425 VAL VAL A . n A 1 38 PHE 38 426 426 PHE PHE A . n A 1 39 SER 39 427 427 SER SER A . n A 1 40 THR 40 428 428 THR THR A . n A 1 41 ALA 41 429 429 ALA ALA A . n A 1 42 GLU 42 430 430 GLU GLU A . n A 1 43 ASP 43 431 431 ASP ASP A . n A 1 44 ASN 44 432 432 ASN ASN A . n A 1 45 GLN 45 433 433 GLN GLN A . n A 1 46 SER 46 434 434 SER SER A . n A 1 47 ALA 47 435 435 ALA ALA A . n A 1 48 VAL 48 436 436 VAL VAL A . n A 1 49 THR 49 437 437 THR THR A . n A 1 50 ILE 50 438 438 ILE ILE A . n A 1 51 HIS 51 439 439 HIS HIS A . n A 1 52 VAL 52 440 440 VAL VAL A . n A 1 53 LEU 53 441 441 LEU LEU A . n A 1 54 GLN 54 442 442 GLN GLN A . n A 1 55 GLY 55 443 443 GLY GLY A . n A 1 56 GLU 56 444 444 GLU GLU A . n A 1 57 ARG 57 445 445 ARG ARG A . n A 1 58 LYS 58 446 446 LYS LYS A . n A 1 59 ARG 59 447 447 ARG ARG A . n A 1 60 ALA 60 448 448 ALA ALA A . n A 1 61 ALA 61 449 449 ALA ALA A . n A 1 62 ASP 62 450 450 ASP ASP A . n A 1 63 ASN 63 451 451 ASN ASN A . n A 1 64 LYS 64 452 452 LYS LYS A . n A 1 65 SER 65 453 453 SER SER A . n A 1 66 LEU 66 454 454 LEU LEU A . n A 1 67 GLY 67 455 455 GLY GLY A . n A 1 68 GLN 68 456 456 GLN GLN A . n A 1 69 PHE 69 457 457 PHE PHE A . n A 1 70 ASN 70 458 458 ASN ASN A . n A 1 71 LEU 71 459 459 LEU LEU A . n A 1 72 ASP 72 460 460 ASP ASP A . n A 1 73 GLY 73 461 461 GLY GLY A . n A 1 74 ILE 74 462 462 ILE ILE A . n A 1 75 ASN 75 463 463 ASN ASN A . n A 1 76 PRO 76 464 464 PRO PRO A . n A 1 77 ALA 77 465 465 ALA ALA A . n A 1 78 PRO 78 466 466 PRO PRO A . n A 1 79 ARG 79 467 467 ARG ARG A . n A 1 80 GLY 80 468 468 GLY GLY A . n A 1 81 MET 81 469 469 MET MET A . n A 1 82 PRO 82 470 470 PRO PRO A . n A 1 83 GLN 83 471 471 GLN GLN A . n A 1 84 ILE 84 472 472 ILE ILE A . n A 1 85 GLU 85 473 473 GLU GLU A . n A 1 86 VAL 86 474 474 VAL VAL A . n A 1 87 THR 87 475 475 THR THR A . n A 1 88 PHE 88 476 476 PHE PHE A . n A 1 89 ASP 89 477 477 ASP ASP A . n A 1 90 ILE 90 478 478 ILE ILE A . n A 1 91 ASP 91 479 479 ASP ASP A . n A 1 92 ALA 92 480 480 ALA ALA A . n A 1 93 ASP 93 481 481 ASP ASP A . n A 1 94 GLY 94 482 482 GLY GLY A . n A 1 95 ILE 95 483 483 ILE ILE A . n A 1 96 LEU 96 484 484 LEU LEU A . n A 1 97 HIS 97 485 485 HIS HIS A . n A 1 98 VAL 98 486 486 VAL VAL A . n A 1 99 SER 99 487 487 SER SER A . n A 1 100 ALA 100 488 488 ALA ALA A . n A 1 101 LYS 101 489 489 LYS LYS A . n A 1 102 ASP 102 490 490 ASP ASP A . n A 1 103 LYS 103 491 491 LYS LYS A . n A 1 104 ASN 104 492 492 ASN ASN A . n A 1 105 SER 105 493 493 SER SER A . n A 1 106 GLY 106 494 494 GLY GLY A . n A 1 107 LYS 107 495 495 LYS LYS A . n A 1 108 GLU 108 496 496 GLU GLU A . n A 1 109 GLN 109 497 497 GLN GLN A . n A 1 110 LYS 110 498 498 LYS LYS A . n A 1 111 ILE 111 499 499 ILE ILE A . n A 1 112 THR 112 500 500 THR THR A . n A 1 113 ILE 113 501 501 ILE ILE A . n A 1 114 LYS 114 502 502 LYS LYS A . n A 1 115 ALA 115 503 503 ALA ALA A . n A 1 116 SER 116 504 504 SER SER A . n A 1 117 SER 117 505 505 SER SER A . n A 1 118 GLY 118 506 506 GLY GLY A . n A 1 119 LEU 119 507 507 LEU LEU A . n A 1 120 ASN 120 508 508 ASN ASN A . n A 1 121 GLU 121 509 509 GLU GLU A . n A 1 122 ASP 122 510 510 ASP ASP A . n A 1 123 GLU 123 511 511 GLU GLU A . n A 1 124 ILE 124 512 512 ILE ILE A . n A 1 125 GLN 125 513 513 GLN GLN A . n A 1 126 LYS 126 514 514 LYS LYS A . n A 1 127 MET 127 515 515 MET MET A . n A 1 128 VAL 128 516 516 VAL VAL A . n A 1 129 ARG 129 517 517 ARG ARG A . n A 1 130 ASP 130 518 518 ASP ASP A . n A 1 131 ALA 131 519 519 ALA ALA A . n A 1 132 GLU 132 520 520 GLU GLU A . n A 1 133 ALA 133 521 521 ALA ALA A . n A 1 134 ASN 134 522 522 ASN ASN A . n A 1 135 ALA 135 523 523 ALA ALA A . n A 1 136 GLU 136 524 524 GLU GLU A . n A 1 137 ALA 137 525 525 ALA ALA A . n A 1 138 ASP 138 526 526 ASP ASP A . n A 1 139 ARG 139 527 527 ARG ARG A . n A 1 140 LYS 140 528 528 LYS LYS A . n A 1 141 PHE 141 529 529 PHE PHE A . n A 1 142 GLU 142 530 530 GLU GLU A . n A 1 143 GLU 143 531 531 GLU GLU A . n A 1 144 LEU 144 532 532 LEU LEU A . n A 1 145 VAL 145 533 533 VAL VAL A . n A 1 146 GLN 146 534 534 GLN GLN A . n A 1 147 THR 147 535 535 THR THR A . n A 1 148 ARG 148 536 536 ARG ARG A . n A 1 149 ASN 149 537 537 ASN ASN A . n A 1 150 GLN 150 538 538 GLN GLN A . n A 1 151 GLY 151 539 539 GLY GLY A . n A 1 152 ASP 152 540 540 ASP ASP A . n A 1 153 HIS 153 541 541 HIS HIS A . n A 1 154 LEU 154 542 542 LEU LEU A . n A 1 155 LEU 155 543 543 LEU LEU A . n A 1 156 HIS 156 544 544 HIS HIS A . n A 1 157 SER 157 545 545 SER SER A . n A 1 158 THR 158 546 546 THR THR A . n A 1 159 ARG 159 547 547 ARG ARG A . n A 1 160 LYS 160 548 548 LYS LYS A . n A 1 161 GLN 161 549 549 GLN GLN A . n A 1 162 VAL 162 550 550 VAL VAL A . n A 1 163 GLU 163 551 551 GLU GLU A . n A 1 164 GLU 164 552 552 GLU GLU A . n A 1 165 ALA 165 553 553 ALA ALA A . n A 1 166 GLY 166 554 554 GLY GLY A . n A 1 167 ASP 167 555 555 ASP ASP A . n A 1 168 LYS 168 556 556 LYS LYS A . n A 1 169 LEU 169 557 557 LEU LEU A . n A 1 170 PRO 170 558 558 PRO PRO A . n A 1 171 ALA 171 559 559 ALA ALA A . n A 1 172 ASP 172 560 560 ASP ASP A . n A 1 173 ASP 173 561 561 ASP ASP A . n A 1 174 LYS 174 562 562 LYS LYS A . n A 1 175 THR 175 563 563 THR THR A . n A 1 176 ALA 176 564 564 ALA ALA A . n A 1 177 ILE 177 565 565 ILE ILE A . n A 1 178 GLU 178 566 566 GLU GLU A . n A 1 179 SER 179 567 567 SER SER A . n A 1 180 ALA 180 568 568 ALA ALA A . n A 1 181 LEU 181 569 569 LEU LEU A . n A 1 182 THR 182 570 570 THR THR A . n A 1 183 ALA 183 571 571 ALA ALA A . n A 1 184 LEU 184 572 572 LEU LEU A . n A 1 185 GLU 185 573 573 GLU GLU A . n A 1 186 THR 186 574 574 THR THR A . n A 1 187 ALA 187 575 575 ALA ALA A . n A 1 188 LEU 188 576 576 LEU LEU A . n A 1 189 LYS 189 577 577 LYS LYS A . n A 1 190 GLY 190 578 578 GLY GLY A . n A 1 191 GLU 191 579 579 GLU GLU A . n A 1 192 ASP 192 580 580 ASP ASP A . n A 1 193 LYS 193 581 581 LYS LYS A . n A 1 194 ALA 194 582 582 ALA ALA A . n A 1 195 ALA 195 583 583 ALA ALA A . n A 1 196 ILE 196 584 584 ILE ILE A . n A 1 197 GLU 197 585 585 GLU GLU A . n A 1 198 ALA 198 586 586 ALA ALA A . n A 1 199 LYS 199 587 587 LYS LYS A . n A 1 200 MET 200 588 588 MET MET A . n A 1 201 GLN 201 589 589 GLN GLN A . n A 1 202 GLU 202 590 590 GLU GLU A . n A 1 203 LEU 203 591 591 LEU LEU A . n A 1 204 ALA 204 592 592 ALA ALA A . n A 1 205 GLN 205 593 593 GLN GLN A . n A 1 206 VAL 206 594 594 VAL VAL A . n A 1 207 SER 207 595 595 SER SER A . n A 1 208 GLN 208 596 596 GLN GLN A . n A 1 209 LYS 209 597 597 LYS LYS A . n A 1 210 LEU 210 598 598 LEU LEU A . n A 1 211 MET 211 599 599 MET MET A . n A 1 212 GLU 212 600 600 GLU GLU A . n A 1 213 ILE 213 601 601 ILE ILE A . n A 1 214 ALA 214 602 602 ALA ALA A . n A 1 215 GLN 215 603 603 GLN GLN A . n A 1 216 GLN 216 604 604 GLN GLN A . n A 1 217 GLN 217 605 ? ? ? A . n A 1 218 HIS 218 606 ? ? ? A . n A 1 219 ALA 219 607 ? ? ? A . n B 2 1 ARG 1 -16 ? ? ? B . n B 2 2 ALA 2 -15 -16 ALA ALA B . n B 2 3 LEU 3 -14 -15 LEU LEU B . n B 2 4 ALA 4 -13 -14 ALA ALA B . n B 2 5 LEU 5 -12 -13 LEU LEU B . n B 2 6 LEU 6 -11 -12 LEU LEU B . n B 2 7 PRO 7 -10 -11 PRO PRO B . n B 2 8 LEU 8 -9 ? ? ? B . n B 2 9 SER 9 -8 ? ? ? B . n B 2 10 ARG 10 -7 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 701 1 SO4 SO4 A . D 3 SO4 1 702 2 SO4 SO4 A . E 4 HOH 1 801 2 HOH HOH A . E 4 HOH 2 802 6 HOH HOH A . E 4 HOH 3 803 11 HOH HOH A . E 4 HOH 4 804 3 HOH HOH A . E 4 HOH 5 805 1 HOH HOH A . E 4 HOH 6 806 7 HOH HOH A . E 4 HOH 7 807 12 HOH HOH A . E 4 HOH 8 808 8 HOH HOH A . E 4 HOH 9 809 10 HOH HOH A . E 4 HOH 10 810 9 HOH HOH A . E 4 HOH 11 811 14 HOH HOH A . E 4 HOH 12 812 4 HOH HOH A . E 4 HOH 13 813 13 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1230 ? 1 MORE -27 ? 1 'SSA (A^2)' 12400 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SO4 _pdbx_struct_special_symmetry.auth_seq_id 702 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id SO4 _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-23 2 'Structure model' 2 0 2021-07-14 3 'Structure model' 2 1 2021-10-20 4 'Structure model' 2 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Polymer sequence' 7 2 'Structure model' 'Structure summary' 8 3 'Structure model' 'Database references' 9 4 'Structure model' 'Data collection' 10 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' entity_poly 3 2 'Structure model' pdbx_poly_seq_scheme 4 2 'Structure model' pdbx_struct_sheet_hbond 5 2 'Structure model' pdbx_unobs_or_zero_occ_residues 6 2 'Structure model' pdbx_validate_torsion 7 2 'Structure model' struct_ref_seq 8 2 'Structure model' struct_ref_seq_dif 9 2 'Structure model' struct_sheet_range 10 3 'Structure model' citation 11 3 'Structure model' citation_author 12 3 'Structure model' database_2 13 4 'Structure model' chem_comp_atom 14 4 'Structure model' chem_comp_bond 15 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.auth_asym_id' 2 2 'Structure model' '_atom_site.auth_seq_id' 3 2 'Structure model' '_entity_poly.pdbx_strand_id' 4 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_seq_num' 5 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_strand_id' 6 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_asym_id' 7 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 8 2 'Structure model' '_pdbx_unobs_or_zero_occ_residues.auth_asym_id' 9 2 'Structure model' '_pdbx_unobs_or_zero_occ_residues.auth_seq_id' 10 2 'Structure model' '_pdbx_validate_torsion.auth_asym_id' 11 2 'Structure model' '_pdbx_validate_torsion.auth_seq_id' 12 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 13 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 14 2 'Structure model' '_struct_ref_seq.pdbx_strand_id' 15 2 'Structure model' '_struct_ref_seq_dif.pdbx_auth_seq_num' 16 2 'Structure model' '_struct_ref_seq_dif.pdbx_pdb_strand_id' 17 2 'Structure model' '_struct_sheet_range.beg_auth_asym_id' 18 2 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 19 2 'Structure model' '_struct_sheet_range.end_auth_asym_id' 20 2 'Structure model' '_struct_sheet_range.end_auth_seq_id' 21 3 'Structure model' '_citation.country' 22 3 'Structure model' '_citation.journal_abbrev' 23 3 'Structure model' '_citation.journal_id_ASTM' 24 3 'Structure model' '_citation.journal_id_CSD' 25 3 'Structure model' '_citation.journal_id_ISSN' 26 3 'Structure model' '_citation.journal_volume' 27 3 'Structure model' '_citation.pdbx_database_id_DOI' 28 3 'Structure model' '_citation.pdbx_database_id_PubMed' 29 3 'Structure model' '_citation.title' 30 3 'Structure model' '_citation.year' 31 3 'Structure model' '_database_2.pdbx_DOI' 32 3 'Structure model' '_database_2.pdbx_database_accession' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 2 ? 'data scaling' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Oct. 31, 2020' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.27 5 # _pdbx_entry_details.entry_id 7N6K _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 467 ? ? -38.23 134.72 2 1 ASN A 522 ? ? -99.46 42.51 3 1 GLU A 524 ? ? -63.44 -71.51 4 1 ALA A 559 ? ? -26.27 -57.63 5 1 THR A 563 ? ? -28.92 -50.32 6 1 LEU B -14 ? ? 79.47 142.90 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 391 ? CD1 ? A LEU 3 CD1 2 1 Y 1 A LEU 391 ? CD2 ? A LEU 3 CD2 3 1 Y 1 A ILE 418 ? CD1 ? A ILE 30 CD1 4 1 Y 1 A GLU 430 ? OE1 ? A GLU 42 OE1 5 1 Y 1 A LYS 446 ? NZ ? A LYS 58 NZ 6 1 Y 1 A ARG 467 ? NH2 ? A ARG 79 NH2 7 1 Y 1 A LYS 489 ? CD ? A LYS 101 CD 8 1 Y 1 A LYS 489 ? CE ? A LYS 101 CE 9 1 Y 1 A LYS 489 ? NZ ? A LYS 101 NZ 10 1 Y 1 A LYS 495 ? CD ? A LYS 107 CD 11 1 Y 1 A LYS 495 ? CE ? A LYS 107 CE 12 1 Y 1 A LYS 495 ? NZ ? A LYS 107 NZ 13 1 Y 1 A ASP 510 ? OD1 ? A ASP 122 OD1 14 1 Y 1 A ASP 510 ? OD2 ? A ASP 122 OD2 15 1 Y 1 A GLN 513 ? CD ? A GLN 125 CD 16 1 Y 1 A GLN 513 ? OE1 ? A GLN 125 OE1 17 1 Y 1 A GLN 513 ? NE2 ? A GLN 125 NE2 18 1 Y 1 A ARG 517 ? CB ? A ARG 129 CB 19 1 Y 1 A ARG 517 ? CG ? A ARG 129 CG 20 1 Y 1 A ARG 517 ? CD ? A ARG 129 CD 21 1 Y 1 A ARG 517 ? NE ? A ARG 129 NE 22 1 Y 1 A ARG 517 ? CZ ? A ARG 129 CZ 23 1 Y 1 A ARG 517 ? NH1 ? A ARG 129 NH1 24 1 Y 1 A ARG 517 ? NH2 ? A ARG 129 NH2 25 1 Y 1 A ASN 522 ? OD1 ? A ASN 134 OD1 26 1 Y 1 A ASN 522 ? ND2 ? A ASN 134 ND2 27 1 Y 1 A GLU 524 ? CG ? A GLU 136 CG 28 1 Y 1 A GLU 524 ? CD ? A GLU 136 CD 29 1 Y 1 A GLU 524 ? OE1 ? A GLU 136 OE1 30 1 Y 1 A GLU 524 ? OE2 ? A GLU 136 OE2 31 1 Y 1 A ARG 527 ? NH2 ? A ARG 139 NH2 32 1 Y 1 A LYS 528 ? CD ? A LYS 140 CD 33 1 Y 1 A LYS 528 ? CE ? A LYS 140 CE 34 1 Y 1 A LYS 528 ? NZ ? A LYS 140 NZ 35 1 Y 1 A LYS 548 ? CD ? A LYS 160 CD 36 1 Y 1 A LYS 548 ? CE ? A LYS 160 CE 37 1 Y 1 A LYS 548 ? NZ ? A LYS 160 NZ 38 1 Y 1 A GLU 552 ? CD ? A GLU 164 CD 39 1 Y 1 A GLU 552 ? OE1 ? A GLU 164 OE1 40 1 Y 1 A GLU 552 ? OE2 ? A GLU 164 OE2 41 1 Y 1 A LYS 577 ? CD ? A LYS 189 CD 42 1 Y 1 A LYS 577 ? CE ? A LYS 189 CE 43 1 Y 1 A GLU 600 ? OE1 ? A GLU 212 OE1 44 1 Y 1 A GLU 600 ? OE2 ? A GLU 212 OE2 45 1 Y 1 A GLN 603 ? NE2 ? A GLN 215 NE2 46 1 Y 1 A GLN 604 ? CG ? A GLN 216 CG 47 1 Y 1 A GLN 604 ? CD ? A GLN 216 CD 48 1 Y 1 A GLN 604 ? OE1 ? A GLN 216 OE1 49 1 Y 1 A GLN 604 ? NE2 ? A GLN 216 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 605 ? A GLN 217 2 1 Y 1 A HIS 606 ? A HIS 218 3 1 Y 1 A ALA 607 ? A ALA 219 4 1 Y 1 B ARG -16 ? B ARG 1 5 1 Y 1 B LEU -9 ? B LEU 8 6 1 Y 1 B SER -8 ? B SER 9 7 1 Y 1 B ARG -7 ? B ARG 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 VAL N N N N 312 VAL CA C N S 313 VAL C C N N 314 VAL O O N N 315 VAL CB C N N 316 VAL CG1 C N N 317 VAL CG2 C N N 318 VAL OXT O N N 319 VAL H H N N 320 VAL H2 H N N 321 VAL HA H N N 322 VAL HB H N N 323 VAL HG11 H N N 324 VAL HG12 H N N 325 VAL HG13 H N N 326 VAL HG21 H N N 327 VAL HG22 H N N 328 VAL HG23 H N N 329 VAL HXT H N N 330 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 VAL N CA sing N N 297 VAL N H sing N N 298 VAL N H2 sing N N 299 VAL CA C sing N N 300 VAL CA CB sing N N 301 VAL CA HA sing N N 302 VAL C O doub N N 303 VAL C OXT sing N N 304 VAL CB CG1 sing N N 305 VAL CB CG2 sing N N 306 VAL CB HB sing N N 307 VAL CG1 HG11 sing N N 308 VAL CG1 HG12 sing N N 309 VAL CG1 HG13 sing N N 310 VAL CG2 HG21 sing N N 311 VAL CG2 HG22 sing N N 312 VAL CG2 HG23 sing N N 313 VAL OXT HXT sing N N 314 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number '5 R35 GM118161' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1DKZ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #