data_7NO0 # _entry.id 7NO0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NO0 pdb_00007no0 10.2210/pdb7no0/pdb WWPDB D_1292114059 ? ? EMDB EMD-12485 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-21 2 'Structure model' 1 1 2021-06-09 3 'Structure model' 1 2 2024-07-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' em_3d_fitting_list 7 3 'Structure model' em_admin 8 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' 14 3 'Structure model' '_database_2.pdbx_DOI' 15 3 'Structure model' '_database_2.pdbx_database_accession' 16 3 'Structure model' '_em_3d_fitting_list.accession_code' 17 3 'Structure model' '_em_3d_fitting_list.initial_refinement_model_id' 18 3 'Structure model' '_em_3d_fitting_list.source_name' 19 3 'Structure model' '_em_3d_fitting_list.type' 20 3 'Structure model' '_em_admin.last_update' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7NO0 _pdbx_database_status.recvd_initial_deposition_date 2021-02-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Structure of the mature RSV CA lattice: T=1 CA icosahedron' _pdbx_database_related.db_id EMD-12485 _pdbx_database_related.content_type 'associated EM volume' # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Obr, M.' 1 0000-0003-1756-6564 'Ricana, C.L.' 2 ? 'Nikulin, N.' 3 ? 'Feathers, J.-P.R.' 4 ? 'Klanschnig, M.' 5 ? 'Thader, A.' 6 ? 'Johnson, M.C.' 7 ? 'Vogt, V.M.' 8 ? 'Schur, F.K.M.' 9 0000-0003-4790-8078 'Dick, R.A.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 3226 _citation.page_last 3226 _citation.title 'Structure of the mature Rous sarcoma virus lattice reveals a role for IP6 in the formation of the capsid hexamer.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-23506-0 _citation.pdbx_database_id_PubMed 34050170 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Obr, M.' 1 ? primary 'Ricana, C.L.' 2 0000-0002-9733-9136 primary 'Nikulin, N.' 3 ? primary 'Feathers, J.R.' 4 ? primary 'Klanschnig, M.' 5 ? primary 'Thader, A.' 6 ? primary 'Johnson, M.C.' 7 ? primary 'Vogt, V.M.' 8 ? primary 'Schur, F.K.M.' 9 0000-0003-4790-8078 primary 'Dick, R.A.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Capsid protein p27, alternate cleaved 1' _entity.formula_weight 24773.594 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTV IAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADIMQGP SESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQKTA ; _entity_poly.pdbx_seq_one_letter_code_can ;PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTV IAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADIMQGP SESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQKTA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 VAL n 1 3 VAL n 1 4 ILE n 1 5 LYS n 1 6 THR n 1 7 GLU n 1 8 GLY n 1 9 PRO n 1 10 ALA n 1 11 TRP n 1 12 THR n 1 13 PRO n 1 14 LEU n 1 15 GLU n 1 16 PRO n 1 17 LYS n 1 18 LEU n 1 19 ILE n 1 20 THR n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ASP n 1 25 THR n 1 26 VAL n 1 27 ARG n 1 28 THR n 1 29 LYS n 1 30 GLY n 1 31 LEU n 1 32 ARG n 1 33 SER n 1 34 PRO n 1 35 ILE n 1 36 THR n 1 37 MET n 1 38 ALA n 1 39 GLU n 1 40 VAL n 1 41 GLU n 1 42 ALA n 1 43 LEU n 1 44 MET n 1 45 SER n 1 46 SER n 1 47 PRO n 1 48 LEU n 1 49 LEU n 1 50 PRO n 1 51 HIS n 1 52 ASP n 1 53 VAL n 1 54 THR n 1 55 ASN n 1 56 LEU n 1 57 MET n 1 58 ARG n 1 59 VAL n 1 60 ILE n 1 61 LEU n 1 62 GLY n 1 63 PRO n 1 64 ALA n 1 65 PRO n 1 66 TYR n 1 67 ALA n 1 68 LEU n 1 69 TRP n 1 70 MET n 1 71 ASP n 1 72 ALA n 1 73 TRP n 1 74 GLY n 1 75 VAL n 1 76 GLN n 1 77 LEU n 1 78 GLN n 1 79 THR n 1 80 VAL n 1 81 ILE n 1 82 ALA n 1 83 ALA n 1 84 ALA n 1 85 THR n 1 86 ARG n 1 87 ASP n 1 88 PRO n 1 89 ARG n 1 90 HIS n 1 91 PRO n 1 92 ALA n 1 93 ASN n 1 94 GLY n 1 95 GLN n 1 96 GLY n 1 97 ARG n 1 98 GLY n 1 99 GLU n 1 100 ARG n 1 101 THR n 1 102 ASN n 1 103 LEU n 1 104 ASN n 1 105 ARG n 1 106 LEU n 1 107 LYS n 1 108 GLY n 1 109 LEU n 1 110 ALA n 1 111 ASP n 1 112 GLY n 1 113 MET n 1 114 VAL n 1 115 GLY n 1 116 ASN n 1 117 PRO n 1 118 GLN n 1 119 GLY n 1 120 GLN n 1 121 ALA n 1 122 ALA n 1 123 LEU n 1 124 LEU n 1 125 ARG n 1 126 PRO n 1 127 GLY n 1 128 GLU n 1 129 LEU n 1 130 VAL n 1 131 ALA n 1 132 ILE n 1 133 THR n 1 134 ALA n 1 135 SER n 1 136 ALA n 1 137 LEU n 1 138 GLN n 1 139 ALA n 1 140 PHE n 1 141 ARG n 1 142 GLU n 1 143 VAL n 1 144 ALA n 1 145 ARG n 1 146 LEU n 1 147 ALA n 1 148 GLU n 1 149 PRO n 1 150 ALA n 1 151 GLY n 1 152 PRO n 1 153 TRP n 1 154 ALA n 1 155 ASP n 1 156 ILE n 1 157 MET n 1 158 GLN n 1 159 GLY n 1 160 PRO n 1 161 SER n 1 162 GLU n 1 163 SER n 1 164 PHE n 1 165 VAL n 1 166 ASP n 1 167 PHE n 1 168 ALA n 1 169 ASN n 1 170 ARG n 1 171 LEU n 1 172 ILE n 1 173 LYS n 1 174 ALA n 1 175 VAL n 1 176 GLU n 1 177 GLY n 1 178 SER n 1 179 ASP n 1 180 LEU n 1 181 PRO n 1 182 PRO n 1 183 SER n 1 184 ALA n 1 185 ARG n 1 186 ALA n 1 187 PRO n 1 188 VAL n 1 189 ILE n 1 190 ILE n 1 191 ASP n 1 192 CYS n 1 193 PHE n 1 194 ARG n 1 195 GLN n 1 196 LYS n 1 197 SER n 1 198 GLN n 1 199 PRO n 1 200 ASP n 1 201 ILE n 1 202 GLN n 1 203 GLN n 1 204 LEU n 1 205 ILE n 1 206 ARG n 1 207 THR n 1 208 ALA n 1 209 PRO n 1 210 SER n 1 211 THR n 1 212 LEU n 1 213 THR n 1 214 THR n 1 215 PRO n 1 216 GLY n 1 217 GLU n 1 218 ILE n 1 219 ILE n 1 220 LYS n 1 221 TYR n 1 222 VAL n 1 223 LEU n 1 224 ASP n 1 225 ARG n 1 226 GLN n 1 227 LYS n 1 228 THR n 1 229 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 229 _entity_src_gen.gene_src_common_name RSV-PrC _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gag _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Prague C' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rous sarcoma virus (strain Prague C)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11888 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 TRP 153 153 153 TRP TRP A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 CYS 192 192 192 CYS CYS A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 TYR 221 221 221 TYR TYR A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 GLN 226 226 226 GLN GLN A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 ALA 229 229 229 ALA ALA A . n # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version 1.17.1_3660: _software.pdbx_ordinal 1 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7NO0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7NO0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NO0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.entry_id 7NO0 _refine.pdbx_diffrn_id ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high . _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.005 ? 15170 ? f_bond_d ? ? 'ELECTRON MICROSCOPY' ? 0.677 ? 20675 ? f_angle_d ? ? 'ELECTRON MICROSCOPY' ? 16.425 ? 2085 ? f_dihedral_angle_d ? ? 'ELECTRON MICROSCOPY' ? 0.043 ? 2390 ? f_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.004 ? 2720 ? f_plane_restr ? ? # _struct.entry_id 7NO0 _struct.title 'Structure of the mature RSV CA lattice: T=1 CA icosahedron' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NO0 _struct_keywords.text 'Retrovirus, Rous sarcoma virus, capsid protein, IP6, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GAG_RSVP _struct_ref.pdbx_db_accession P03322 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTV IAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADIMQGP SESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQKTA ; _struct_ref.pdbx_align_begin 240 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NO0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03322 _struct_ref_seq.db_align_beg 240 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 468 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 229 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details 'UCSF CHIMERA 1.13.1_b41965.' _pdbx_struct_assembly.oligomeric_details 60-meric _pdbx_struct_assembly.oligomeric_count 60 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression ;1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55,56,57,58,59,60 ; _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'point symmetry operation' ? ? 0.309017 0.500000 -0.809017 277.76001 0.500000 -0.809017 -0.309017 449.42514 -0.809017 -0.309017 -0.500000 727.18515 3 'point symmetry operation' ? ? 0.000000 0.000000 -1.000000 555.52002 -1.000000 -0.000000 0.000000 555.52002 0.000000 1.000000 -0.000000 -0.00000 4 'point symmetry operation' ? ? -0.309017 0.500000 -0.809017 449.42514 0.500000 0.809017 0.309017 -171.66513 0.809017 -0.309017 -0.500000 277.76001 5 'point symmetry operation' ? ? -0.809017 0.309017 -0.500000 555.52002 -0.309017 0.500000 0.809017 -0.00000 0.500000 0.809017 -0.309017 0.00000 6 'point symmetry operation' ? ? 0.500000 0.809017 -0.309017 0.00000 0.809017 -0.309017 0.500000 -0.00000 0.309017 -0.500000 -0.809017 555.52002 7 'point symmetry operation' ? ? 0.309017 -0.500000 -0.809017 555.52002 -0.500000 -0.809017 0.309017 555.52002 -0.809017 0.309017 -0.500000 555.52002 8 'point symmetry operation' ? ? -0.309017 -0.500000 -0.809017 727.18515 0.500000 -0.809017 0.309017 277.76001 -0.809017 -0.309017 0.500000 449.42514 9 'point symmetry operation' ? ? -0.500000 0.809017 -0.309017 277.76001 -0.809017 -0.309017 0.500000 449.42514 0.309017 0.500000 0.809017 -171.66513 10 'point symmetry operation' ? ? 0.809017 0.309017 -0.500000 106.09488 0.309017 0.500000 0.809017 -171.66513 0.500000 -0.809017 0.309017 277.76001 11 'point symmetry operation' ? ? -0.000000 1.000000 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 0.00000 1.000000 -0.000000 -0.000000 0.00000 12 'point symmetry operation' ? ? 0.809017 -0.309017 -0.500000 277.76001 0.309017 -0.500000 0.809017 106.09488 -0.500000 -0.809017 -0.309017 727.18515 13 'point symmetry operation' ? ? -0.809017 -0.309017 -0.500000 727.18515 -0.309017 -0.500000 0.809017 277.76001 -0.500000 0.809017 0.309017 106.09488 14 'point symmetry operation' ? ? -0.500000 -0.809017 0.309017 555.52002 0.809017 -0.309017 0.500000 -0.00000 -0.309017 0.500000 0.809017 0.00000 15 'point symmetry operation' ? ? -0.309017 0.500000 0.809017 -0.00000 -0.500000 -0.809017 0.309017 555.52002 0.809017 -0.309017 0.500000 -0.00000 16 'point symmetry operation' ? ? 0.809017 -0.309017 0.500000 0.00000 -0.309017 0.500000 0.809017 -0.00000 -0.500000 -0.809017 0.309017 555.52002 17 'point symmetry operation' ? ? 0.809017 0.309017 0.500000 -171.66513 -0.309017 -0.500000 0.809017 277.76001 0.500000 -0.809017 -0.309017 449.42514 18 'point symmetry operation' ? ? 0.000000 -1.000000 0.000000 555.52002 0.000000 -0.000000 1.000000 -0.00000 -1.000000 0.000000 -0.000000 555.52002 19 'point symmetry operation' ? ? -0.809017 0.309017 0.500000 277.76001 0.309017 -0.500000 0.809017 106.09488 0.500000 0.809017 0.309017 -171.66513 20 'point symmetry operation' ? ? -0.000000 -0.000000 1.000000 -0.00000 1.000000 -0.000000 -0.000000 0.00000 -0.000000 1.000000 -0.000000 -0.00000 21 'point symmetry operation' ? ? 0.309017 -0.500000 0.809017 106.09488 -0.500000 -0.809017 -0.309017 727.18515 0.809017 -0.309017 -0.500000 277.76001 22 'point symmetry operation' ? ? -0.309017 -0.500000 0.809017 277.76001 -0.500000 0.809017 0.309017 106.09488 -0.809017 -0.309017 -0.500000 727.18515 23 'point symmetry operation' ? ? 0.500000 -0.809017 0.309017 277.76001 -0.809017 -0.309017 0.500000 449.42514 -0.309017 -0.500000 -0.809017 727.18515 24 'point symmetry operation' ? ? -0.809017 -0.309017 0.500000 449.42514 0.309017 0.500000 0.809017 -171.66513 -0.500000 0.809017 -0.309017 277.76001 25 'point symmetry operation' ? ? 0.309017 0.500000 0.809017 -171.66513 0.500000 -0.809017 0.309017 277.76001 0.809017 0.309017 -0.500000 106.09488 26 'point symmetry operation' ? ? 0.500000 0.809017 0.309017 -171.66513 0.809017 -0.309017 -0.500000 277.76001 -0.309017 0.500000 -0.809017 449.42514 27 'point symmetry operation' ? ? 0.500000 -0.809017 -0.309017 449.42514 -0.809017 -0.309017 -0.500000 727.18515 0.309017 0.500000 -0.809017 277.76001 28 'point symmetry operation' ? ? -1.000000 0.000000 -0.000000 555.52002 0.000000 1.000000 -0.000000 -0.00000 -0.000000 -0.000000 -1.000000 555.52002 29 'point symmetry operation' ? ? -0.500000 -0.809017 -0.309017 727.18515 -0.809017 0.309017 0.500000 277.76001 -0.309017 0.500000 -0.809017 449.42514 30 'point symmetry operation' ? ? -0.500000 0.809017 0.309017 106.09488 0.809017 0.309017 0.500000 -171.66513 0.309017 0.500000 -0.809017 277.76001 31 'point symmetry operation' ? ? 1.000000 0.000000 -0.000000 -0.00000 0.000000 -1.000000 0.000000 555.52002 -0.000000 0.000000 -1.000000 555.52002 32 'point symmetry operation' ? ? 0.309017 0.500000 -0.809017 277.76001 -0.500000 0.809017 0.309017 106.09488 0.809017 0.309017 0.500000 -171.66513 33 'point symmetry operation' ? ? -0.000000 0.000000 -1.000000 555.52002 1.000000 0.000000 0.000000 -0.00000 -0.000000 -1.000000 0.000000 555.52002 34 'point symmetry operation' ? ? -0.309017 0.500000 -0.809017 449.42514 -0.500000 -0.809017 -0.309017 727.18515 -0.809017 0.309017 0.500000 277.76001 35 'point symmetry operation' ? ? -0.809017 0.309017 -0.500000 555.52002 0.309017 -0.500000 -0.809017 555.52002 -0.500000 -0.809017 0.309017 555.52002 36 'point symmetry operation' ? ? 0.500000 0.809017 -0.309017 -0.00000 -0.809017 0.309017 -0.500000 555.52002 -0.309017 0.500000 0.809017 -0.00000 37 'point symmetry operation' ? ? 0.309017 -0.500000 -0.809017 555.52002 0.500000 0.809017 -0.309017 -0.00000 0.809017 -0.309017 0.500000 0.00000 38 'point symmetry operation' ? ? -0.309017 -0.500000 -0.809017 727.18515 -0.500000 0.809017 -0.309017 277.76001 0.809017 0.309017 -0.500000 106.09488 39 'point symmetry operation' ? ? -0.500000 0.809017 -0.309017 277.76001 0.809017 0.309017 -0.500000 106.09488 -0.309017 -0.500000 -0.809017 727.18515 40 'point symmetry operation' ? ? 0.809017 0.309017 -0.500000 106.09488 -0.309017 -0.500000 -0.809017 727.18515 -0.500000 0.809017 -0.309017 277.76001 41 'point symmetry operation' ? ? -0.000000 1.000000 -0.000000 -0.00000 0.000000 0.000000 -1.000000 555.52002 -1.000000 0.000000 0.000000 555.52002 42 'point symmetry operation' ? ? 0.809017 -0.309017 -0.500000 277.76001 -0.309017 0.500000 -0.809017 449.42514 0.500000 0.809017 0.309017 -171.66513 43 'point symmetry operation' ? ? -0.809017 -0.309017 -0.500000 727.18515 0.309017 0.500000 -0.809017 277.76001 0.500000 -0.809017 -0.309017 449.42514 44 'point symmetry operation' ? ? -0.500000 -0.809017 0.309017 555.52002 -0.809017 0.309017 -0.500000 555.52002 0.309017 -0.500000 -0.809017 555.52002 45 'point symmetry operation' ? ? -0.309017 0.500000 0.809017 0.00000 0.500000 0.809017 -0.309017 -0.00000 -0.809017 0.309017 -0.500000 555.52002 46 'point symmetry operation' ? ? 0.809017 -0.309017 0.500000 -0.00000 0.309017 -0.500000 -0.809017 555.52002 0.500000 0.809017 -0.309017 -0.00000 47 'point symmetry operation' ? ? 0.809017 0.309017 0.500000 -171.66513 0.309017 0.500000 -0.809017 277.76001 -0.500000 0.809017 0.309017 106.09488 48 'point symmetry operation' ? ? 0.000000 -1.000000 0.000000 555.52002 -0.000000 0.000000 -1.000000 555.52002 1.000000 -0.000000 0.000000 -0.00000 49 'point symmetry operation' ? ? -0.809017 0.309017 0.500000 277.76001 -0.309017 0.500000 -0.809017 449.42514 -0.500000 -0.809017 -0.309017 727.18515 50 'point symmetry operation' ? ? 0.000000 -0.000000 1.000000 -0.00000 -1.000000 0.000000 -0.000000 555.52002 0.000000 -1.000000 0.000000 555.52002 51 'point symmetry operation' ? ? 0.309017 -0.500000 0.809017 106.09488 0.500000 0.809017 0.309017 -171.66513 -0.809017 0.309017 0.500000 277.76001 52 'point symmetry operation' ? ? -0.309017 -0.500000 0.809017 277.76001 0.500000 -0.809017 -0.309017 449.42514 0.809017 0.309017 0.500000 -171.66513 53 'point symmetry operation' ? ? 0.500000 -0.809017 0.309017 277.76001 0.809017 0.309017 -0.500000 106.09488 0.309017 0.500000 0.809017 -171.66513 54 'point symmetry operation' ? ? -0.809017 -0.309017 0.500000 449.42514 -0.309017 -0.500000 -0.809017 727.18515 0.500000 -0.809017 0.309017 277.76001 55 'point symmetry operation' ? ? 0.309017 0.500000 0.809017 -171.66513 -0.500000 0.809017 -0.309017 277.76001 -0.809017 -0.309017 0.500000 449.42514 56 'point symmetry operation' ? ? 0.500000 0.809017 0.309017 -171.66513 -0.809017 0.309017 0.500000 277.76001 0.309017 -0.500000 0.809017 106.09488 57 'point symmetry operation' ? ? 0.500000 -0.809017 -0.309017 449.42514 0.809017 0.309017 0.500000 -171.66513 -0.309017 -0.500000 0.809017 277.76001 58 'point symmetry operation' ? ? -1.000000 0.000000 -0.000000 555.52002 0.000000 -1.000000 0.000000 555.52002 -0.000000 0.000000 1.000000 -0.00000 59 'point symmetry operation' ? ? -0.500000 -0.809017 -0.309017 727.18515 0.809017 -0.309017 -0.500000 277.76001 0.309017 -0.500000 0.809017 106.09488 60 'point symmetry operation' ? ? -0.500000 0.809017 0.309017 106.09488 -0.809017 -0.309017 -0.500000 727.18515 -0.309017 -0.500000 0.809017 277.76001 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 15 ? GLY A 30 ? GLU A 15 GLY A 30 1 ? 16 HELX_P HELX_P2 AA2 SER A 33 ? MET A 44 ? SER A 33 MET A 44 1 ? 12 HELX_P HELX_P3 AA3 LEU A 49 ? LEU A 61 ? LEU A 49 LEU A 61 1 ? 13 HELX_P HELX_P4 AA4 GLY A 62 ? ARG A 86 ? GLY A 62 ARG A 86 1 ? 25 HELX_P HELX_P5 AA5 GLY A 96 ? ARG A 100 ? GLY A 96 ARG A 100 5 ? 5 HELX_P HELX_P6 AA6 ASN A 102 ? LYS A 107 ? ASN A 102 LYS A 107 1 ? 6 HELX_P HELX_P7 AA7 ASN A 116 ? LEU A 124 ? ASN A 116 LEU A 124 1 ? 9 HELX_P HELX_P8 AA8 ARG A 125 ? GLU A 148 ? ARG A 125 GLU A 148 1 ? 24 HELX_P HELX_P9 AA9 PRO A 152 ? ILE A 156 ? PRO A 152 ILE A 156 5 ? 5 HELX_P HELX_P10 AB1 SER A 163 ? GLY A 177 ? SER A 163 GLY A 177 1 ? 15 HELX_P HELX_P11 AB2 PRO A 181 ? SER A 183 ? PRO A 181 SER A 183 5 ? 3 HELX_P HELX_P12 AB3 ALA A 184 ? LYS A 196 ? ALA A 184 LYS A 196 1 ? 13 HELX_P HELX_P13 AB4 GLN A 198 ? THR A 207 ? GLN A 198 THR A 207 1 ? 10 HELX_P HELX_P14 AB5 THR A 214 ? GLN A 226 ? THR A 214 GLN A 226 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? ILE A 4 ? VAL A 2 ILE A 4 AA1 2 PRO A 9 ? TRP A 11 ? PRO A 9 TRP A 11 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 3 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 3 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 10 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 197 ? ? 64.54 78.97 2 1 GLN A 198 ? ? -34.99 149.29 # _em_3d_fitting.entry_id 7NO0 _em_3d_fitting.id 1 _em_3d_fitting.details ;The CANTD and CACTD of one CA monomer of pdb 3TIR were independently placed into the EM-density using the rigid body fitting option in UCSF Chimera. Subsequently the linker connecting the two CA domains was joined in Coot. To account for the different monomer-monomer interactions in the RSV CA pentamer, the monomers were replicated according to the inherent 5-fold symmetry of the map and an additional ring of CACTDs was rigid-body fitted into the EM-densities of the surrounding CA pentamers. A map segment (defined by a mask extending 3 Angstrom around the rigid body fitted model) was extracted, and real-space coordinate refinement against the EM-density was performed using Phenix. This was iterated with manual model building in Coot, similar as described previously. In brief, secondary structure restraints and non-crystallographic symmetry (NCS) restraints were applied throughout all refinements. Each Phenix iteration consisted of 5 macro cycles, in which simulated annealing was performed in every macro cycle. Atomic displacement parameter (ADP) refinement was per formed at the end of each iteration. ; _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol 'AB INITIO MODEL' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.id 1 _em_3d_fitting_list.details ? _em_3d_fitting_list.pdb_chain_id ? _em_3d_fitting_list.pdb_chain_residue_range ? _em_3d_fitting_list.pdb_entry_id 3TIR _em_3d_fitting_list.initial_refinement_model_id 1 _em_3d_fitting_list.chain_id ? _em_3d_fitting_list.chain_residue_range ? _em_3d_fitting_list.source_name PDB _em_3d_fitting_list.type 'experimental model' _em_3d_fitting_list.accession_code 3TIR # _em_3d_reconstruction.entry_id 7NO0 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 20498 _em_3d_reconstruction.resolution 3.1 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 8 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Rous sarcoma virus - Prague C' _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type VIRUS _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 7NO0 _em_image_scans.id 1 _em_image_scans.dimension_height 4092 _em_image_scans.dimension_width 5760 _em_image_scans.frames_per_image ? _em_image_scans.image_recording_id 1 _em_image_scans.sampling_size ? _em_image_scans.scanner_model ? _em_image_scans.used_frames_per_image ? _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.details ? # _em_imaging.id 1 _em_imaging.entry_id 7NO0 _em_imaging.accelerating_voltage 200 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter 50.0 _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TECNAI ARCTICA' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_max 1500 _em_imaging.nominal_defocus_min 800 _em_imaging.nominal_magnification 63000 _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 300 _em_sample_support.grid_type C-flat-2/2 _em_sample_support.method ? _em_sample_support.film_material ? # _em_virus_entity.entity_assembly_id 1 _em_virus_entity.empty YES _em_virus_entity.enveloped NO _em_virus_entity.virus_isolate OTHER _em_virus_entity.virus_type 'VIRUS-LIKE PARTICLE' _em_virus_entity.id 1 _em_virus_entity.virus_host_category ? _em_virus_entity.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 277 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ;blot time= 2.5 s blot force= 0 ; _em_vitrification.humidity 95 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.entry_id 7NO0 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7NO0 _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 7NO0 _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry I # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _em_admin.entry_id 7NO0 _em_admin.current_status REL _em_admin.deposition_date 2021-02-25 _em_admin.deposition_site PDBE _em_admin.last_update 2024-07-10 _em_admin.map_release_date 2021-04-21 _em_admin.title 'Structure of the mature RSV CA lattice: T=1 CA icosahedron' # _em_buffer_component.buffer_id 1 _em_buffer_component.id 1 _em_buffer_component.concentration 1 _em_buffer_component.concentration_units M _em_buffer_component.formula NaPi _em_buffer_component.name 'sodium phosphate' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details 'CTF estimation and correction was performed using GCTF in the RELION wrapper' # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units ? _em_entity_assembly_molwt.value ? # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 11888 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Rous sarcoma virus - Prague C' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 469008 _em_entity_assembly_recombinant.organism 'Escherichia coli BL21(DE3)' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 50 _em_image_recording.average_exposure_time 3 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 BIOQUANTUM (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name 'GIF Bioquantum' _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.energyfilter_slit_width 20 _em_imaging_optics.phase_plate ? _em_imaging_optics.sph_aberration_corrector ? _em_imaging_optics.details ? # _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.details ;2394 micrographs were taken, from which 374 particles were manually picked and 2D classified to generate templates for auto-picking. Two rounds of auto-picking and 2D classification resulted in 150599 extracted particles. ; _em_particle_selection.method ? _em_particle_selection.num_particles_selected 150599 _em_particle_selection.reference_model ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? RELION ? 1 ? ? 2 'IMAGE ACQUISITION' ? SerialEM ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? Gctf ? 1 ? ? 5 'CTF CORRECTION' ? RELION ? 1 ? ? 6 'LAYERLINE INDEXING' ? ? ? ? ? ? 7 'DIFFRACTION INDEXING' ? ? ? ? ? ? 8 'MODEL FITTING' ? 'UCSF Chimera' ? ? 1 ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? RELION ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? RELION ? 1 ? ? 12 CLASSIFICATION ? RELION ? 1 ? ? 13 RECONSTRUCTION ? RELION ? 1 ? ? 14 'MODEL REFINEMENT' ? PHENIX ? ? 1 ? 15 'MODEL REFINEMENT' ? Coot ? ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_shell.id 1 _em_virus_shell.entity_assembly_id 1 _em_virus_shell.diameter ? _em_virus_shell.name 'T=1 icosahedron' _em_virus_shell.triangulation ? # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Austrian Science Fund' Austria P31445 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI147890 2 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI150454 3 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R35GM136258 4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3TIR # _atom_sites.entry_id 7NO0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_