data_7NZN # _entry.id 7NZN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NZN pdb_00007nzn 10.2210/pdb7nzn/pdb WWPDB D_1292114879 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-09 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7NZN _pdbx_database_status.recvd_initial_deposition_date 2021-03-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Briggs, D.C.' 1 0000-0002-9793-7339 'McDonald, N.Q.' 2 0000-0003-0975-6325 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 1536 _citation.page_last 1551 _citation.title ;Discovery of N-Trisubstituted Pyrimidine Derivatives as Type I RET and RET Gatekeeper Mutant Inhibitors with a Novel Kinase Binding Pose. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c01280 _citation.pdbx_database_id_PubMed 35081714 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, L.' 1 ? primary 'Moccia, M.' 2 ? primary 'Briggs, D.C.' 3 0000-0002-9793-7339 primary 'Bharate, J.B.' 4 0000-0003-3269-6228 primary 'Lakkaniga, N.R.' 5 ? primary 'Knowles, P.' 6 ? primary 'Yan, W.' 7 0000-0003-1535-3100 primary 'Tran, P.' 8 ? primary 'Kharbanda, A.' 9 ? primary 'Wang, X.' 10 0000-0002-8514-0410 primary 'Leung, Y.K.' 11 ? primary 'Frett, B.' 12 0000-0003-2429-8895 primary 'Santoro, M.' 13 ? primary 'McDonald, N.Q.' 14 0000-0003-0975-6325 primary 'Carlomagno, F.' 15 0000-0002-1483-4677 primary 'Li, H.Y.' 16 0000-0001-9212-2010 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proto-oncogene tyrosine-protein kinase receptor Ret' 35868.191 1 2.7.10.1 ? ? 'Residues 700-705 are vector derived sequence.' 2 non-polymer syn ;2-[4-[[4-[1-[2-(dimethylamino)ethyl]pyrazol-4-yl]-6-[(3-methyl-1~{H}-pyrazol-5-yl)amino]pyrimidin-2-yl]amino]phenyl]-~{N}-(3-fluorophenyl)ethanamide ; 554.621 1 ? ? ? ? 3 non-polymer syn 'FORMIC ACID' 46.025 3 ? ? ? ? 4 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cadherin family member 12,Proto-oncogene c-Ret' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPLSLSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVL KQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQIS QGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDV(PTR)EEDS(PTR)VKRSQGRIPVKWMAIESLFDHIYTTQ SDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVK RR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLSLSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVL KQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQIS QGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGV LLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2-[4-[[4-[1-[2-(dimethylamino)ethyl]pyrazol-4-yl]-6-[(3-methyl-1~{H}-pyrazol-5-yl)amino]pyrimidin-2-yl]amino]phenyl]-~{N}-(3-fluorophenyl)ethanamide ; VJH 3 'FORMIC ACID' FMT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 SER n 1 5 LEU n 1 6 SER n 1 7 VAL n 1 8 ASP n 1 9 ALA n 1 10 PHE n 1 11 LYS n 1 12 ILE n 1 13 LEU n 1 14 GLU n 1 15 ASP n 1 16 PRO n 1 17 LYS n 1 18 TRP n 1 19 GLU n 1 20 PHE n 1 21 PRO n 1 22 ARG n 1 23 LYS n 1 24 ASN n 1 25 LEU n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 LYS n 1 30 THR n 1 31 LEU n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 GLU n 1 36 PHE n 1 37 GLY n 1 38 LYS n 1 39 VAL n 1 40 VAL n 1 41 LYS n 1 42 ALA n 1 43 THR n 1 44 ALA n 1 45 PHE n 1 46 HIS n 1 47 LEU n 1 48 LYS n 1 49 GLY n 1 50 ARG n 1 51 ALA n 1 52 GLY n 1 53 TYR n 1 54 THR n 1 55 THR n 1 56 VAL n 1 57 ALA n 1 58 VAL n 1 59 LYS n 1 60 MET n 1 61 LEU n 1 62 LYS n 1 63 GLU n 1 64 ASN n 1 65 ALA n 1 66 SER n 1 67 PRO n 1 68 SER n 1 69 GLU n 1 70 LEU n 1 71 ARG n 1 72 ASP n 1 73 LEU n 1 74 LEU n 1 75 SER n 1 76 GLU n 1 77 PHE n 1 78 ASN n 1 79 VAL n 1 80 LEU n 1 81 LYS n 1 82 GLN n 1 83 VAL n 1 84 ASN n 1 85 HIS n 1 86 PRO n 1 87 HIS n 1 88 VAL n 1 89 ILE n 1 90 LYS n 1 91 LEU n 1 92 TYR n 1 93 GLY n 1 94 ALA n 1 95 CYS n 1 96 SER n 1 97 GLN n 1 98 ASP n 1 99 GLY n 1 100 PRO n 1 101 LEU n 1 102 LEU n 1 103 LEU n 1 104 ILE n 1 105 VAL n 1 106 GLU n 1 107 TYR n 1 108 ALA n 1 109 LYS n 1 110 TYR n 1 111 GLY n 1 112 SER n 1 113 LEU n 1 114 ARG n 1 115 GLY n 1 116 PHE n 1 117 LEU n 1 118 ARG n 1 119 GLU n 1 120 SER n 1 121 ARG n 1 122 LYS n 1 123 VAL n 1 124 GLY n 1 125 PRO n 1 126 GLY n 1 127 TYR n 1 128 LEU n 1 129 GLY n 1 130 SER n 1 131 GLY n 1 132 GLY n 1 133 SER n 1 134 ARG n 1 135 ASN n 1 136 SER n 1 137 SER n 1 138 SER n 1 139 LEU n 1 140 ASP n 1 141 HIS n 1 142 PRO n 1 143 ASP n 1 144 GLU n 1 145 ARG n 1 146 ALA n 1 147 LEU n 1 148 THR n 1 149 MET n 1 150 GLY n 1 151 ASP n 1 152 LEU n 1 153 ILE n 1 154 SER n 1 155 PHE n 1 156 ALA n 1 157 TRP n 1 158 GLN n 1 159 ILE n 1 160 SER n 1 161 GLN n 1 162 GLY n 1 163 MET n 1 164 GLN n 1 165 TYR n 1 166 LEU n 1 167 ALA n 1 168 GLU n 1 169 MET n 1 170 LYS n 1 171 LEU n 1 172 VAL n 1 173 HIS n 1 174 ARG n 1 175 ASP n 1 176 LEU n 1 177 ALA n 1 178 ALA n 1 179 ARG n 1 180 ASN n 1 181 ILE n 1 182 LEU n 1 183 VAL n 1 184 ALA n 1 185 GLU n 1 186 GLY n 1 187 ARG n 1 188 LYS n 1 189 MET n 1 190 LYS n 1 191 ILE n 1 192 SER n 1 193 ASP n 1 194 PHE n 1 195 GLY n 1 196 LEU n 1 197 SER n 1 198 ARG n 1 199 ASP n 1 200 VAL n 1 201 PTR n 1 202 GLU n 1 203 GLU n 1 204 ASP n 1 205 SER n 1 206 PTR n 1 207 VAL n 1 208 LYS n 1 209 ARG n 1 210 SER n 1 211 GLN n 1 212 GLY n 1 213 ARG n 1 214 ILE n 1 215 PRO n 1 216 VAL n 1 217 LYS n 1 218 TRP n 1 219 MET n 1 220 ALA n 1 221 ILE n 1 222 GLU n 1 223 SER n 1 224 LEU n 1 225 PHE n 1 226 ASP n 1 227 HIS n 1 228 ILE n 1 229 TYR n 1 230 THR n 1 231 THR n 1 232 GLN n 1 233 SER n 1 234 ASP n 1 235 VAL n 1 236 TRP n 1 237 SER n 1 238 PHE n 1 239 GLY n 1 240 VAL n 1 241 LEU n 1 242 LEU n 1 243 TRP n 1 244 GLU n 1 245 ILE n 1 246 VAL n 1 247 THR n 1 248 LEU n 1 249 GLY n 1 250 GLY n 1 251 ASN n 1 252 PRO n 1 253 TYR n 1 254 PRO n 1 255 GLY n 1 256 ILE n 1 257 PRO n 1 258 PRO n 1 259 GLU n 1 260 ARG n 1 261 LEU n 1 262 PHE n 1 263 ASN n 1 264 LEU n 1 265 LEU n 1 266 LYS n 1 267 THR n 1 268 GLY n 1 269 HIS n 1 270 ARG n 1 271 MET n 1 272 GLU n 1 273 ARG n 1 274 PRO n 1 275 ASP n 1 276 ASN n 1 277 CYS n 1 278 SER n 1 279 GLU n 1 280 GLU n 1 281 MET n 1 282 TYR n 1 283 ARG n 1 284 LEU n 1 285 MET n 1 286 LEU n 1 287 GLN n 1 288 CYS n 1 289 TRP n 1 290 LYS n 1 291 GLN n 1 292 GLU n 1 293 PRO n 1 294 ASP n 1 295 LYS n 1 296 ARG n 1 297 PRO n 1 298 VAL n 1 299 PHE n 1 300 ALA n 1 301 ASP n 1 302 ILE n 1 303 SER n 1 304 LYS n 1 305 ASP n 1 306 LEU n 1 307 GLU n 1 308 LYS n 1 309 MET n 1 310 MET n 1 311 VAL n 1 312 LYS n 1 313 ARG n 1 314 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 314 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RET, CDHF12, CDHR16, PTC, RET51' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VJH non-polymer . ;2-[4-[[4-[1-[2-(dimethylamino)ethyl]pyrazol-4-yl]-6-[(3-methyl-1~{H}-pyrazol-5-yl)amino]pyrimidin-2-yl]amino]phenyl]-~{N}-(3-fluorophenyl)ethanamide ; ? 'C29 H31 F N10 O' 554.621 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 700 700 GLY GLY A . n A 1 2 PRO 2 701 701 PRO PRO A . n A 1 3 LEU 3 702 702 LEU LEU A . n A 1 4 SER 4 703 703 SER SER A . n A 1 5 LEU 5 704 704 LEU LEU A . n A 1 6 SER 6 705 705 SER SER A . n A 1 7 VAL 7 706 706 VAL VAL A . n A 1 8 ASP 8 707 707 ASP ASP A . n A 1 9 ALA 9 708 708 ALA ALA A . n A 1 10 PHE 10 709 709 PHE PHE A . n A 1 11 LYS 11 710 710 LYS LYS A . n A 1 12 ILE 12 711 711 ILE ILE A . n A 1 13 LEU 13 712 ? ? ? A . n A 1 14 GLU 14 713 ? ? ? A . n A 1 15 ASP 15 714 714 ASP ASP A . n A 1 16 PRO 16 715 715 PRO PRO A . n A 1 17 LYS 17 716 716 LYS LYS A . n A 1 18 TRP 18 717 717 TRP TRP A . n A 1 19 GLU 19 718 718 GLU GLU A . n A 1 20 PHE 20 719 719 PHE PHE A . n A 1 21 PRO 21 720 720 PRO PRO A . n A 1 22 ARG 22 721 721 ARG ARG A . n A 1 23 LYS 23 722 722 LYS LYS A . n A 1 24 ASN 24 723 723 ASN ASN A . n A 1 25 LEU 25 724 724 LEU LEU A . n A 1 26 VAL 26 725 725 VAL VAL A . n A 1 27 LEU 27 726 726 LEU LEU A . n A 1 28 GLY 28 727 727 GLY GLY A . n A 1 29 LYS 29 728 728 LYS LYS A . n A 1 30 THR 30 729 729 THR THR A . n A 1 31 LEU 31 730 730 LEU LEU A . n A 1 32 GLY 32 731 731 GLY GLY A . n A 1 33 GLU 33 732 732 GLU GLU A . n A 1 34 GLY 34 733 733 GLY GLY A . n A 1 35 GLU 35 734 734 GLU GLU A . n A 1 36 PHE 36 735 735 PHE PHE A . n A 1 37 GLY 37 736 736 GLY GLY A . n A 1 38 LYS 38 737 737 LYS LYS A . n A 1 39 VAL 39 738 738 VAL VAL A . n A 1 40 VAL 40 739 739 VAL VAL A . n A 1 41 LYS 41 740 740 LYS LYS A . n A 1 42 ALA 42 741 741 ALA ALA A . n A 1 43 THR 43 742 742 THR THR A . n A 1 44 ALA 44 743 743 ALA ALA A . n A 1 45 PHE 45 744 744 PHE PHE A . n A 1 46 HIS 46 745 745 HIS HIS A . n A 1 47 LEU 47 746 746 LEU LEU A . n A 1 48 LYS 48 747 747 LYS LYS A . n A 1 49 GLY 49 748 748 GLY GLY A . n A 1 50 ARG 50 749 749 ARG ARG A . n A 1 51 ALA 51 750 750 ALA ALA A . n A 1 52 GLY 52 751 751 GLY GLY A . n A 1 53 TYR 53 752 752 TYR TYR A . n A 1 54 THR 54 753 753 THR THR A . n A 1 55 THR 55 754 754 THR THR A . n A 1 56 VAL 56 755 755 VAL VAL A . n A 1 57 ALA 57 756 756 ALA ALA A . n A 1 58 VAL 58 757 757 VAL VAL A . n A 1 59 LYS 59 758 758 LYS LYS A . n A 1 60 MET 60 759 759 MET MET A . n A 1 61 LEU 61 760 760 LEU LEU A . n A 1 62 LYS 62 761 761 LYS LYS A . n A 1 63 GLU 63 762 762 GLU GLU A . n A 1 64 ASN 64 763 763 ASN ASN A . n A 1 65 ALA 65 764 764 ALA ALA A . n A 1 66 SER 66 765 765 SER SER A . n A 1 67 PRO 67 766 766 PRO PRO A . n A 1 68 SER 68 767 767 SER SER A . n A 1 69 GLU 69 768 768 GLU GLU A . n A 1 70 LEU 70 769 769 LEU LEU A . n A 1 71 ARG 71 770 770 ARG ARG A . n A 1 72 ASP 72 771 771 ASP ASP A . n A 1 73 LEU 73 772 772 LEU LEU A . n A 1 74 LEU 74 773 773 LEU LEU A . n A 1 75 SER 75 774 774 SER SER A . n A 1 76 GLU 76 775 775 GLU GLU A . n A 1 77 PHE 77 776 776 PHE PHE A . n A 1 78 ASN 78 777 777 ASN ASN A . n A 1 79 VAL 79 778 778 VAL VAL A . n A 1 80 LEU 80 779 779 LEU LEU A . n A 1 81 LYS 81 780 780 LYS LYS A . n A 1 82 GLN 82 781 781 GLN GLN A . n A 1 83 VAL 83 782 782 VAL VAL A . n A 1 84 ASN 84 783 783 ASN ASN A . n A 1 85 HIS 85 784 784 HIS HIS A . n A 1 86 PRO 86 785 785 PRO PRO A . n A 1 87 HIS 87 786 786 HIS HIS A . n A 1 88 VAL 88 787 787 VAL VAL A . n A 1 89 ILE 89 788 788 ILE ILE A . n A 1 90 LYS 90 789 789 LYS LYS A . n A 1 91 LEU 91 790 790 LEU LEU A . n A 1 92 TYR 92 791 791 TYR TYR A . n A 1 93 GLY 93 792 792 GLY GLY A . n A 1 94 ALA 94 793 793 ALA ALA A . n A 1 95 CYS 95 794 794 CYS CYS A . n A 1 96 SER 96 795 795 SER SER A . n A 1 97 GLN 97 796 796 GLN GLN A . n A 1 98 ASP 98 797 797 ASP ASP A . n A 1 99 GLY 99 798 798 GLY GLY A . n A 1 100 PRO 100 799 799 PRO PRO A . n A 1 101 LEU 101 800 800 LEU LEU A . n A 1 102 LEU 102 801 801 LEU LEU A . n A 1 103 LEU 103 802 802 LEU LEU A . n A 1 104 ILE 104 803 803 ILE ILE A . n A 1 105 VAL 105 804 804 VAL VAL A . n A 1 106 GLU 106 805 805 GLU GLU A . n A 1 107 TYR 107 806 806 TYR TYR A . n A 1 108 ALA 108 807 807 ALA ALA A . n A 1 109 LYS 109 808 808 LYS LYS A . n A 1 110 TYR 110 809 809 TYR TYR A . n A 1 111 GLY 111 810 810 GLY GLY A . n A 1 112 SER 112 811 811 SER SER A . n A 1 113 LEU 113 812 812 LEU LEU A . n A 1 114 ARG 114 813 813 ARG ARG A . n A 1 115 GLY 115 814 814 GLY GLY A . n A 1 116 PHE 116 815 815 PHE PHE A . n A 1 117 LEU 117 816 816 LEU LEU A . n A 1 118 ARG 118 817 817 ARG ARG A . n A 1 119 GLU 119 818 818 GLU GLU A . n A 1 120 SER 120 819 819 SER SER A . n A 1 121 ARG 121 820 820 ARG ARG A . n A 1 122 LYS 122 821 ? ? ? A . n A 1 123 VAL 123 822 ? ? ? A . n A 1 124 GLY 124 823 ? ? ? A . n A 1 125 PRO 125 824 ? ? ? A . n A 1 126 GLY 126 825 ? ? ? A . n A 1 127 TYR 127 826 ? ? ? A . n A 1 128 LEU 128 827 ? ? ? A . n A 1 129 GLY 129 828 ? ? ? A . n A 1 130 SER 130 829 ? ? ? A . n A 1 131 GLY 131 830 ? ? ? A . n A 1 132 GLY 132 831 ? ? ? A . n A 1 133 SER 133 832 ? ? ? A . n A 1 134 ARG 134 833 ? ? ? A . n A 1 135 ASN 135 834 ? ? ? A . n A 1 136 SER 136 835 ? ? ? A . n A 1 137 SER 137 836 ? ? ? A . n A 1 138 SER 138 837 ? ? ? A . n A 1 139 LEU 139 838 ? ? ? A . n A 1 140 ASP 140 839 ? ? ? A . n A 1 141 HIS 141 840 ? ? ? A . n A 1 142 PRO 142 841 ? ? ? A . n A 1 143 ASP 143 842 ? ? ? A . n A 1 144 GLU 144 843 ? ? ? A . n A 1 145 ARG 145 844 844 ARG ARG A . n A 1 146 ALA 146 845 845 ALA ALA A . n A 1 147 LEU 147 846 846 LEU LEU A . n A 1 148 THR 148 847 847 THR THR A . n A 1 149 MET 149 848 848 MET MET A . n A 1 150 GLY 150 849 849 GLY GLY A . n A 1 151 ASP 151 850 850 ASP ASP A . n A 1 152 LEU 152 851 851 LEU LEU A . n A 1 153 ILE 153 852 852 ILE ILE A . n A 1 154 SER 154 853 853 SER SER A . n A 1 155 PHE 155 854 854 PHE PHE A . n A 1 156 ALA 156 855 855 ALA ALA A . n A 1 157 TRP 157 856 856 TRP TRP A . n A 1 158 GLN 158 857 857 GLN GLN A . n A 1 159 ILE 159 858 858 ILE ILE A . n A 1 160 SER 160 859 859 SER SER A . n A 1 161 GLN 161 860 860 GLN GLN A . n A 1 162 GLY 162 861 861 GLY GLY A . n A 1 163 MET 163 862 862 MET MET A . n A 1 164 GLN 164 863 863 GLN GLN A . n A 1 165 TYR 165 864 864 TYR TYR A . n A 1 166 LEU 166 865 865 LEU LEU A . n A 1 167 ALA 167 866 866 ALA ALA A . n A 1 168 GLU 168 867 867 GLU GLU A . n A 1 169 MET 169 868 868 MET MET A . n A 1 170 LYS 170 869 869 LYS LYS A . n A 1 171 LEU 171 870 870 LEU LEU A . n A 1 172 VAL 172 871 871 VAL VAL A . n A 1 173 HIS 173 872 872 HIS HIS A . n A 1 174 ARG 174 873 873 ARG ARG A . n A 1 175 ASP 175 874 874 ASP ASP A . n A 1 176 LEU 176 875 875 LEU LEU A . n A 1 177 ALA 177 876 876 ALA ALA A . n A 1 178 ALA 178 877 877 ALA ALA A . n A 1 179 ARG 179 878 878 ARG ARG A . n A 1 180 ASN 180 879 879 ASN ASN A . n A 1 181 ILE 181 880 880 ILE ILE A . n A 1 182 LEU 182 881 881 LEU LEU A . n A 1 183 VAL 183 882 882 VAL VAL A . n A 1 184 ALA 184 883 883 ALA ALA A . n A 1 185 GLU 185 884 884 GLU GLU A . n A 1 186 GLY 186 885 885 GLY GLY A . n A 1 187 ARG 187 886 886 ARG ARG A . n A 1 188 LYS 188 887 887 LYS LYS A . n A 1 189 MET 189 888 888 MET MET A . n A 1 190 LYS 190 889 889 LYS LYS A . n A 1 191 ILE 191 890 890 ILE ILE A . n A 1 192 SER 192 891 891 SER SER A . n A 1 193 ASP 193 892 892 ASP ASP A . n A 1 194 PHE 194 893 893 PHE PHE A . n A 1 195 GLY 195 894 894 GLY GLY A . n A 1 196 LEU 196 895 895 LEU LEU A . n A 1 197 SER 197 896 896 SER SER A . n A 1 198 ARG 198 897 897 ARG ARG A . n A 1 199 ASP 199 898 898 ASP ASP A . n A 1 200 VAL 200 899 899 VAL VAL A . n A 1 201 PTR 201 900 900 PTR PTR A . n A 1 202 GLU 202 901 901 GLU GLU A . n A 1 203 GLU 203 902 902 GLU GLU A . n A 1 204 ASP 204 903 903 ASP ASP A . n A 1 205 SER 205 904 904 SER SER A . n A 1 206 PTR 206 905 905 PTR PTR A . n A 1 207 VAL 207 906 906 VAL VAL A . n A 1 208 LYS 208 907 907 LYS LYS A . n A 1 209 ARG 209 908 908 ARG ARG A . n A 1 210 SER 210 909 909 SER SER A . n A 1 211 GLN 211 910 910 GLN GLN A . n A 1 212 GLY 212 911 911 GLY GLY A . n A 1 213 ARG 213 912 912 ARG ARG A . n A 1 214 ILE 214 913 913 ILE ILE A . n A 1 215 PRO 215 914 914 PRO PRO A . n A 1 216 VAL 216 915 915 VAL VAL A . n A 1 217 LYS 217 916 916 LYS LYS A . n A 1 218 TRP 218 917 917 TRP TRP A . n A 1 219 MET 219 918 918 MET MET A . n A 1 220 ALA 220 919 919 ALA ALA A . n A 1 221 ILE 221 920 920 ILE ILE A . n A 1 222 GLU 222 921 921 GLU GLU A . n A 1 223 SER 223 922 922 SER SER A . n A 1 224 LEU 224 923 923 LEU LEU A . n A 1 225 PHE 225 924 924 PHE PHE A . n A 1 226 ASP 226 925 925 ASP ASP A . n A 1 227 HIS 227 926 926 HIS HIS A . n A 1 228 ILE 228 927 927 ILE ILE A . n A 1 229 TYR 229 928 928 TYR TYR A . n A 1 230 THR 230 929 929 THR THR A . n A 1 231 THR 231 930 930 THR THR A . n A 1 232 GLN 232 931 931 GLN GLN A . n A 1 233 SER 233 932 932 SER SER A . n A 1 234 ASP 234 933 933 ASP ASP A . n A 1 235 VAL 235 934 934 VAL VAL A . n A 1 236 TRP 236 935 935 TRP TRP A . n A 1 237 SER 237 936 936 SER SER A . n A 1 238 PHE 238 937 937 PHE PHE A . n A 1 239 GLY 239 938 938 GLY GLY A . n A 1 240 VAL 240 939 939 VAL VAL A . n A 1 241 LEU 241 940 940 LEU LEU A . n A 1 242 LEU 242 941 941 LEU LEU A . n A 1 243 TRP 243 942 942 TRP TRP A . n A 1 244 GLU 244 943 943 GLU GLU A . n A 1 245 ILE 245 944 944 ILE ILE A . n A 1 246 VAL 246 945 945 VAL VAL A . n A 1 247 THR 247 946 946 THR THR A . n A 1 248 LEU 248 947 947 LEU LEU A . n A 1 249 GLY 249 948 948 GLY GLY A . n A 1 250 GLY 250 949 949 GLY GLY A . n A 1 251 ASN 251 950 950 ASN ASN A . n A 1 252 PRO 252 951 951 PRO PRO A . n A 1 253 TYR 253 952 952 TYR TYR A . n A 1 254 PRO 254 953 953 PRO PRO A . n A 1 255 GLY 255 954 954 GLY GLY A . n A 1 256 ILE 256 955 955 ILE ILE A . n A 1 257 PRO 257 956 956 PRO PRO A . n A 1 258 PRO 258 957 957 PRO PRO A . n A 1 259 GLU 259 958 958 GLU GLU A . n A 1 260 ARG 260 959 959 ARG ARG A . n A 1 261 LEU 261 960 960 LEU LEU A . n A 1 262 PHE 262 961 961 PHE PHE A . n A 1 263 ASN 263 962 962 ASN ASN A . n A 1 264 LEU 264 963 963 LEU LEU A . n A 1 265 LEU 265 964 964 LEU LEU A . n A 1 266 LYS 266 965 965 LYS LYS A . n A 1 267 THR 267 966 966 THR THR A . n A 1 268 GLY 268 967 967 GLY GLY A . n A 1 269 HIS 269 968 968 HIS HIS A . n A 1 270 ARG 270 969 969 ARG ARG A . n A 1 271 MET 271 970 970 MET MET A . n A 1 272 GLU 272 971 971 GLU GLU A . n A 1 273 ARG 273 972 972 ARG ARG A . n A 1 274 PRO 274 973 973 PRO PRO A . n A 1 275 ASP 275 974 974 ASP ASP A . n A 1 276 ASN 276 975 975 ASN ASN A . n A 1 277 CYS 277 976 976 CYS CYS A . n A 1 278 SER 278 977 977 SER SER A . n A 1 279 GLU 279 978 978 GLU GLU A . n A 1 280 GLU 280 979 979 GLU GLU A . n A 1 281 MET 281 980 980 MET MET A . n A 1 282 TYR 282 981 981 TYR TYR A . n A 1 283 ARG 283 982 982 ARG ARG A . n A 1 284 LEU 284 983 983 LEU LEU A . n A 1 285 MET 285 984 984 MET MET A . n A 1 286 LEU 286 985 985 LEU LEU A . n A 1 287 GLN 287 986 986 GLN GLN A . n A 1 288 CYS 288 987 987 CYS CYS A . n A 1 289 TRP 289 988 988 TRP TRP A . n A 1 290 LYS 290 989 989 LYS LYS A . n A 1 291 GLN 291 990 990 GLN GLN A . n A 1 292 GLU 292 991 991 GLU GLU A . n A 1 293 PRO 293 992 992 PRO PRO A . n A 1 294 ASP 294 993 993 ASP ASP A . n A 1 295 LYS 295 994 994 LYS LYS A . n A 1 296 ARG 296 995 995 ARG ARG A . n A 1 297 PRO 297 996 996 PRO PRO A . n A 1 298 VAL 298 997 997 VAL VAL A . n A 1 299 PHE 299 998 998 PHE PHE A . n A 1 300 ALA 300 999 999 ALA ALA A . n A 1 301 ASP 301 1000 1000 ASP ASP A . n A 1 302 ILE 302 1001 1001 ILE ILE A . n A 1 303 SER 303 1002 1002 SER SER A . n A 1 304 LYS 304 1003 1003 LYS LYS A . n A 1 305 ASP 305 1004 1004 ASP ASP A . n A 1 306 LEU 306 1005 1005 LEU LEU A . n A 1 307 GLU 307 1006 1006 GLU GLU A . n A 1 308 LYS 308 1007 1007 LYS LYS A . n A 1 309 MET 309 1008 1008 MET MET A . n A 1 310 MET 310 1009 1009 MET MET A . n A 1 311 VAL 311 1010 1010 VAL VAL A . n A 1 312 LYS 312 1011 1011 LYS LYS A . n A 1 313 ARG 313 1012 1012 ARG ARG A . n A 1 314 ARG 314 1013 1013 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 VJH 1 1101 1101 VJH J48 A . C 3 FMT 1 1102 2 FMT FMT A . D 3 FMT 1 1103 3 FMT FMT A . E 3 FMT 1 1104 4 FMT FMT A . F 4 HOH 1 1201 50 HOH HOH A . F 4 HOH 2 1202 32 HOH HOH A . F 4 HOH 3 1203 9 HOH HOH A . F 4 HOH 4 1204 41 HOH HOH A . F 4 HOH 5 1205 10 HOH HOH A . F 4 HOH 6 1206 4 HOH HOH A . F 4 HOH 7 1207 26 HOH HOH A . F 4 HOH 8 1208 20 HOH HOH A . F 4 HOH 9 1209 27 HOH HOH A . F 4 HOH 10 1210 21 HOH HOH A . F 4 HOH 11 1211 25 HOH HOH A . F 4 HOH 12 1212 44 HOH HOH A . F 4 HOH 13 1213 14 HOH HOH A . F 4 HOH 14 1214 49 HOH HOH A . F 4 HOH 15 1215 24 HOH HOH A . F 4 HOH 16 1216 19 HOH HOH A . F 4 HOH 17 1217 11 HOH HOH A . F 4 HOH 18 1218 36 HOH HOH A . F 4 HOH 19 1219 38 HOH HOH A . F 4 HOH 20 1220 18 HOH HOH A . F 4 HOH 21 1221 33 HOH HOH A . F 4 HOH 22 1222 47 HOH HOH A . F 4 HOH 23 1223 51 HOH HOH A . F 4 HOH 24 1224 30 HOH HOH A . F 4 HOH 25 1225 29 HOH HOH A . F 4 HOH 26 1226 35 HOH HOH A . F 4 HOH 27 1227 2 HOH HOH A . F 4 HOH 28 1228 45 HOH HOH A . F 4 HOH 29 1229 43 HOH HOH A . F 4 HOH 30 1230 1 HOH HOH A . F 4 HOH 31 1231 31 HOH HOH A . F 4 HOH 32 1232 37 HOH HOH A . F 4 HOH 33 1233 48 HOH HOH A . F 4 HOH 34 1234 3 HOH HOH A . F 4 HOH 35 1235 16 HOH HOH A . F 4 HOH 36 1236 7 HOH HOH A . F 4 HOH 37 1237 15 HOH HOH A . F 4 HOH 38 1238 6 HOH HOH A . F 4 HOH 39 1239 46 HOH HOH A . F 4 HOH 40 1240 5 HOH HOH A . F 4 HOH 41 1241 42 HOH HOH A . F 4 HOH 42 1242 23 HOH HOH A . F 4 HOH 43 1243 22 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 710 ? CG ? A LYS 11 CG 2 1 Y 1 A LYS 710 ? CD ? A LYS 11 CD 3 1 Y 1 A LYS 710 ? CE ? A LYS 11 CE 4 1 Y 1 A LYS 710 ? NZ ? A LYS 11 NZ 5 1 Y 1 A ILE 711 ? CG1 ? A ILE 12 CG1 6 1 Y 1 A ILE 711 ? CG2 ? A ILE 12 CG2 7 1 Y 1 A ILE 711 ? CD1 ? A ILE 12 CD1 8 1 Y 1 A ASP 714 ? CG ? A ASP 15 CG 9 1 Y 1 A ASP 714 ? OD1 ? A ASP 15 OD1 10 1 Y 1 A ASP 714 ? OD2 ? A ASP 15 OD2 11 1 Y 1 A LYS 716 ? CG ? A LYS 17 CG 12 1 Y 1 A LYS 716 ? CD ? A LYS 17 CD 13 1 Y 1 A LYS 716 ? CE ? A LYS 17 CE 14 1 Y 1 A LYS 716 ? NZ ? A LYS 17 NZ 15 1 Y 1 A LYS 722 ? CG ? A LYS 23 CG 16 1 Y 1 A LYS 722 ? CD ? A LYS 23 CD 17 1 Y 1 A LYS 722 ? CE ? A LYS 23 CE 18 1 Y 1 A LYS 722 ? NZ ? A LYS 23 NZ 19 1 Y 1 A ARG 749 ? CG ? A ARG 50 CG 20 1 Y 1 A ARG 749 ? CD ? A ARG 50 CD 21 1 Y 1 A ARG 749 ? NE ? A ARG 50 NE 22 1 Y 1 A ARG 749 ? CZ ? A ARG 50 CZ 23 1 Y 1 A ARG 749 ? NH1 ? A ARG 50 NH1 24 1 Y 1 A ARG 749 ? NH2 ? A ARG 50 NH2 25 1 Y 1 A GLU 762 ? CG ? A GLU 63 CG 26 1 Y 1 A GLU 762 ? CD ? A GLU 63 CD 27 1 Y 1 A GLU 762 ? OE1 ? A GLU 63 OE1 28 1 Y 1 A GLU 762 ? OE2 ? A GLU 63 OE2 29 1 Y 1 A ASP 797 ? CG ? A ASP 98 CG 30 1 Y 1 A ASP 797 ? OD1 ? A ASP 98 OD1 31 1 Y 1 A ASP 797 ? OD2 ? A ASP 98 OD2 32 1 Y 1 A ARG 820 ? CG ? A ARG 121 CG 33 1 Y 1 A ARG 820 ? CD ? A ARG 121 CD 34 1 Y 1 A ARG 820 ? NE ? A ARG 121 NE 35 1 Y 1 A ARG 820 ? CZ ? A ARG 121 CZ 36 1 Y 1 A ARG 820 ? NH1 ? A ARG 121 NH1 37 1 Y 1 A ARG 820 ? NH2 ? A ARG 121 NH2 38 1 Y 1 A ARG 844 ? CG ? A ARG 145 CG 39 1 Y 1 A ARG 844 ? CD ? A ARG 145 CD 40 1 Y 1 A ARG 844 ? NE ? A ARG 145 NE 41 1 Y 1 A ARG 844 ? CZ ? A ARG 145 CZ 42 1 Y 1 A ARG 844 ? NH1 ? A ARG 145 NH1 43 1 Y 1 A ARG 844 ? NH2 ? A ARG 145 NH2 44 1 Y 1 A GLU 901 ? CG ? A GLU 202 CG 45 1 Y 1 A GLU 901 ? CD ? A GLU 202 CD 46 1 Y 1 A GLU 901 ? OE1 ? A GLU 202 OE1 47 1 Y 1 A GLU 901 ? OE2 ? A GLU 202 OE2 48 1 Y 1 A GLU 971 ? CD ? A GLU 272 CD 49 1 Y 1 A GLU 971 ? OE1 ? A GLU 272 OE1 50 1 Y 1 A GLU 971 ? OE2 ? A GLU 272 OE2 51 1 Y 1 A GLU 979 ? CG ? A GLU 280 CG 52 1 Y 1 A GLU 979 ? CD ? A GLU 280 CD 53 1 Y 1 A GLU 979 ? OE1 ? A GLU 280 OE1 54 1 Y 1 A GLU 979 ? OE2 ? A GLU 280 OE2 55 1 Y 1 A ARG 982 ? CG ? A ARG 283 CG 56 1 Y 1 A ARG 982 ? CD ? A ARG 283 CD 57 1 Y 1 A ARG 982 ? NE ? A ARG 283 NE 58 1 Y 1 A ARG 982 ? CZ ? A ARG 283 CZ 59 1 Y 1 A ARG 982 ? NH1 ? A ARG 283 NH1 60 1 Y 1 A ARG 982 ? NH2 ? A ARG 283 NH2 61 1 Y 1 A GLN 986 ? CD ? A GLN 287 CD 62 1 Y 1 A GLN 986 ? OE1 ? A GLN 287 OE1 63 1 Y 1 A GLN 986 ? NE2 ? A GLN 287 NE2 64 1 Y 1 A LYS 1003 ? CE ? A LYS 304 CE 65 1 Y 1 A LYS 1003 ? NZ ? A LYS 304 NZ 66 1 Y 1 A ARG 1013 ? CD ? A ARG 314 CD 67 1 Y 1 A ARG 1013 ? NE ? A ARG 314 NE 68 1 Y 1 A ARG 1013 ? CZ ? A ARG 314 CZ 69 1 Y 1 A ARG 1013 ? NH1 ? A ARG 314 NH1 70 1 Y 1 A ARG 1013 ? NH2 ? A ARG 314 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 101.580 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7NZN _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.910 _cell.length_a_esd ? _cell.length_b 71.090 _cell.length_b_esd ? _cell.length_c 80.180 _cell.length_c_esd ? _cell.volume 407127.613 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7NZN _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NZN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2-3M sodium formate 100mM sodium acetate pH 4.5-6 ; _exptl_crystal_grow.pdbx_pH_range 4.5-6.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 47.34 _reflns.entry_id 7NZN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.39 _reflns.d_resolution_low 39.92 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15912 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.24 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.63 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.977 _reflns.pdbx_CC_star 0.994 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.39 _reflns_shell.d_res_low 2.475 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.18 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1556 _reflns_shell.percent_possible_all 99.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.454 _reflns_shell.pdbx_CC_star .079 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.47 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7NZN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.39 _refine.ls_d_res_low 39.92 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15897 _refine.ls_number_reflns_R_free 799 _refine.ls_number_reflns_R_work 15098 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.26 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2148 _refine.ls_R_factor_R_free 0.2541 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2128 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4CKJ _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.8308 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3853 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.39 _refine_hist.d_res_low 39.92 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 2360 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2267 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0017 ? 2369 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4471 ? 3199 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0385 ? 343 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0025 ? 400 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.1777 ? 864 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.39 2.54 . . 142 2512 99.33 . . . 0.3796 . 0.3150 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.54 2.74 . . 135 2473 99.28 . . . 0.3310 . 0.3174 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.74 3.01 . . 123 2525 99.66 . . . 0.3194 . 0.2822 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.01 3.45 . . 112 2541 99.62 . . . 0.2972 . 0.2268 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.45 4.34 . . 139 2513 99.51 . . . 0.2368 . 0.1832 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.34 39.92 . . 148 2534 98.24 . . . 0.1961 . 0.1699 . . . . . . . . . . . # _struct.entry_id 7NZN _struct.title 'Structure of RET kinase domain bound to inhibitor JB-48' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NZN _struct_keywords.text 'Kinase, Inhibitor, Cancer, Receptor Tyrosine Kinase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RET_HUMAN _struct_ref.pdbx_db_accession P07949 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNH PHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQY LAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEI VTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR ; _struct_ref.pdbx_align_begin 705 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NZN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 314 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07949 _struct_ref_seq.db_align_beg 705 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1013 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 705 _struct_ref_seq.pdbx_auth_seq_align_end 1013 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7NZN GLY A 1 ? UNP P07949 ? ? 'expression tag' 700 1 1 7NZN PRO A 2 ? UNP P07949 ? ? 'expression tag' 701 2 1 7NZN LEU A 3 ? UNP P07949 ? ? 'expression tag' 702 3 1 7NZN SER A 4 ? UNP P07949 ? ? 'expression tag' 703 4 1 7NZN LEU A 5 ? UNP P07949 ? ? 'expression tag' 704 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3940 ? 1 MORE -20 ? 1 'SSA (A^2)' 24980 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein runs at expected molecular weight for a monomer.' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 72.9100000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? LYS A 11 ? GLY A 700 LYS A 710 1 ? 11 HELX_P HELX_P2 AA2 PRO A 21 ? LYS A 23 ? PRO A 720 LYS A 722 5 ? 3 HELX_P HELX_P3 AA3 SER A 66 ? LYS A 81 ? SER A 765 LYS A 780 1 ? 16 HELX_P HELX_P4 AA4 LEU A 113 ? GLU A 119 ? LEU A 812 GLU A 818 1 ? 7 HELX_P HELX_P5 AA5 THR A 148 ? MET A 169 ? THR A 847 MET A 868 1 ? 22 HELX_P HELX_P6 AA6 ALA A 177 ? ARG A 179 ? ALA A 876 ARG A 878 5 ? 3 HELX_P HELX_P7 AA7 PRO A 215 ? MET A 219 ? PRO A 914 MET A 918 5 ? 5 HELX_P HELX_P8 AA8 ALA A 220 ? HIS A 227 ? ALA A 919 HIS A 926 1 ? 8 HELX_P HELX_P9 AA9 THR A 230 ? THR A 247 ? THR A 929 THR A 946 1 ? 18 HELX_P HELX_P10 AB1 PRO A 257 ? GLU A 259 ? PRO A 956 GLU A 958 5 ? 3 HELX_P HELX_P11 AB2 ARG A 260 ? THR A 267 ? ARG A 959 THR A 966 1 ? 8 HELX_P HELX_P12 AB3 SER A 278 ? TRP A 289 ? SER A 977 TRP A 988 1 ? 12 HELX_P HELX_P13 AB4 GLU A 292 ? ARG A 296 ? GLU A 991 ARG A 995 5 ? 5 HELX_P HELX_P14 AB5 VAL A 298 ? LYS A 312 ? VAL A 997 LYS A 1011 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 200 C ? ? ? 1_555 A PTR 201 N ? ? A VAL 899 A PTR 900 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A PTR 201 C ? ? ? 1_555 A GLU 202 N ? ? A PTR 900 A GLU 901 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A SER 205 C ? ? ? 1_555 A PTR 206 N ? ? A SER 904 A PTR 905 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A PTR 206 C ? ? ? 1_555 A VAL 207 N ? ? A PTR 905 A VAL 906 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 25 ? GLU A 33 ? LEU A 724 GLU A 732 AA1 2 GLY A 37 ? LEU A 47 ? GLY A 736 LEU A 746 AA1 3 ARG A 50 ? LEU A 61 ? ARG A 749 LEU A 760 AA1 4 LEU A 102 ? VAL A 105 ? LEU A 801 VAL A 804 AA1 5 LEU A 91 ? CYS A 95 ? LEU A 790 CYS A 794 AA2 1 GLY A 111 ? SER A 112 ? GLY A 810 SER A 811 AA2 2 ILE A 181 ? ALA A 184 ? ILE A 880 ALA A 883 AA2 3 LYS A 188 ? ILE A 191 ? LYS A 887 ILE A 890 AA3 1 LEU A 171 ? VAL A 172 ? LEU A 870 VAL A 871 AA3 2 ARG A 198 ? ASP A 199 ? ARG A 897 ASP A 898 AA4 1 PTR A 206 ? VAL A 207 ? PTR A 905 VAL A 906 AA4 2 ILE A 228 ? TYR A 229 ? ILE A 927 TYR A 928 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 32 ? N GLY A 731 O VAL A 39 ? O VAL A 738 AA1 2 3 N VAL A 40 ? N VAL A 739 O VAL A 58 ? O VAL A 757 AA1 3 4 N ALA A 57 ? N ALA A 756 O VAL A 105 ? O VAL A 804 AA1 4 5 O ILE A 104 ? O ILE A 803 N TYR A 92 ? N TYR A 791 AA2 1 2 N GLY A 111 ? N GLY A 810 O VAL A 183 ? O VAL A 882 AA2 2 3 N LEU A 182 ? N LEU A 881 O LYS A 190 ? O LYS A 889 AA3 1 2 N VAL A 172 ? N VAL A 871 O ARG A 198 ? O ARG A 897 AA4 1 2 N PTR A 206 ? N PTR A 905 O TYR A 229 ? O TYR A 928 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 710 ? ? -68.67 64.56 2 1 ASN A 763 ? ? 70.62 47.78 3 1 GLU A 818 ? ? -96.87 35.28 4 1 ARG A 873 ? ? 74.95 -19.06 5 1 ASP A 892 ? ? 55.88 76.53 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A PTR 201 A PTR 900 ? TYR 'modified residue' 2 A PTR 206 A PTR 905 ? TYR 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 15.4428396954 5.1981935803 2.6808831515 0.435091199913 ? 0.073777554435 ? 0.0296858042516 ? 0.391482463049 ? 0.0142233989157 ? 0.678934324219 ? 0.708560629909 ? -1.0613531926 ? -0.898605788309 ? 2.38641816717 ? 1.70247629172 ? 2.56286916017 ? -0.144785675074 ? 0.316768976506 ? -0.494807020021 ? 0.386802070387 ? 0.0912871479395 ? 0.27922030166 ? 0.392295303668 ? -0.138524503295 ? 7.73224554814e-05 ? 2 'X-RAY DIFFRACTION' ? refined 20.4164966551 1.94752962356 7.05165438975 0.362509016051 ? 0.015998203846 ? 0.126730131468 ? 0.403841288678 ? -0.0198513683591 ? 0.446296344231 ? 1.65212190936 ? -1.12010584406 ? -0.119439858312 ? 1.13299045648 ? 0.085695242851 ? 1.17616727636 ? -0.0545619386353 ? 0.127862045301 ? -0.161286174978 ? -0.127942098076 ? 0.0390075984462 ? 0.103272871027 ? -0.0208471758016 ? 0.0250200624368 ? 0.00418197703423 ? 3 'X-RAY DIFFRACTION' ? refined 26.6549424878 8.03208357937 19.4590645501 0.273172167892 ? 0.125137512463 ? 0.0835362687129 ? 0.403322972944 ? -0.0637866660888 ? 0.25923778362 ? 2.50711759258 ? -1.13579947717 ? 1.24051539564 ? 3.97374195634 ? -0.717352516391 ? 3.69342189185 ? -0.153346187149 ? -0.333396825713 ? 0.0610254609758 ? 0.301483104528 ? 0.204317544562 ? 0.0823928001329 ? -0.302734120155 ? -0.151437067966 ? 0.0257437936423 ? 4 'X-RAY DIFFRACTION' ? refined 27.5550179382 3.23999570914 18.4774694935 0.390067980606 ? 0.103995838268 ? 0.0496181944414 ? 0.437435388804 ? -0.00900155079893 ? 0.383225068214 ? 1.97849159767 ? 0.0772993436156 ? 0.59829096948 ? 2.21310522148 ? -0.647413921952 ? 2.26395509718 ? 0.179374030003 ? -0.268054514951 ? 0.594586495541 ? -0.490575762902 ? -0.182568851839 ? -0.0215803122592 ? -0.368576861047 ? -0.256058155479 ? 0.0222216190807 ? 5 'X-RAY DIFFRACTION' ? refined 39.7571812771 -4.82075026759 14.9618472874 0.3600858569 ? 0.0619471755181 ? 0.0253373751008 ? 0.392974112224 ? 0.0507883506774 ? 0.39904417269 ? 3.90359184325 ? 0.0652046679986 ? -0.92767033936 ? 4.03170564069 ? 0.920856961791 ? 3.84241379208 ? -0.133596083048 ? -0.163671640294 ? -0.302054687006 ? 0.104665967628 ? 0.0590707635532 ? 0.0100394810282 ? 0.142086679289 ? 0.148064781497 ? -0.0031898028384 ? 6 'X-RAY DIFFRACTION' ? refined 40.9535982787 -0.951828079238 30.9176034932 0.616139413035 ? 0.0717644181274 ? 0.0684239820944 ? 0.823178296851 ? 0.063881421681 ? 0.486857407657 ? 2.70055209998 ? -0.736597266726 ? -1.0949388752 ? 0.718459811519 ? -0.0734399755027 ? 2.74004261807 ? -0.000686276068108 ? -0.492782278667 ? -0.0199228521893 ? 0.589968652212 ? 0.129767352679 ? -0.148245498599 ? 0.354095566841 ? 0.104578034732 ? -0.000124483791038 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 700 ? A 50 A 751 ? ? ;chain 'A' and (resid 700 through 751 ) ; 2 'X-RAY DIFFRACTION' 2 A 51 A 752 ? A 93 A 794 ? ? ;chain 'A' and (resid 752 through 794 ) ; 3 'X-RAY DIFFRACTION' 3 A 94 A 795 ? A 143 A 867 ? ? ;chain 'A' and (resid 795 through 867 ) ; 4 'X-RAY DIFFRACTION' 4 A 144 A 868 ? A 166 A 890 ? ? ;chain 'A' and (resid 868 through 890 ) ; 5 'X-RAY DIFFRACTION' 5 A 167 A 891 ? A 241 A 965 ? ? ;chain 'A' and (resid 891 through 965 ) ; 6 'X-RAY DIFFRACTION' 6 A 242 A 966 ? A 289 A 1013 ? ? ;chain 'A' and (resid 966 through 1013 ) ; # _pdbx_entry_details.entry_id 7NZN _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 712 ? A LEU 13 2 1 Y 1 A GLU 713 ? A GLU 14 3 1 Y 1 A LYS 821 ? A LYS 122 4 1 Y 1 A VAL 822 ? A VAL 123 5 1 Y 1 A GLY 823 ? A GLY 124 6 1 Y 1 A PRO 824 ? A PRO 125 7 1 Y 1 A GLY 825 ? A GLY 126 8 1 Y 1 A TYR 826 ? A TYR 127 9 1 Y 1 A LEU 827 ? A LEU 128 10 1 Y 1 A GLY 828 ? A GLY 129 11 1 Y 1 A SER 829 ? A SER 130 12 1 Y 1 A GLY 830 ? A GLY 131 13 1 Y 1 A GLY 831 ? A GLY 132 14 1 Y 1 A SER 832 ? A SER 133 15 1 Y 1 A ARG 833 ? A ARG 134 16 1 Y 1 A ASN 834 ? A ASN 135 17 1 Y 1 A SER 835 ? A SER 136 18 1 Y 1 A SER 836 ? A SER 137 19 1 Y 1 A SER 837 ? A SER 138 20 1 Y 1 A LEU 838 ? A LEU 139 21 1 Y 1 A ASP 839 ? A ASP 140 22 1 Y 1 A HIS 840 ? A HIS 141 23 1 Y 1 A PRO 841 ? A PRO 142 24 1 Y 1 A ASP 842 ? A ASP 143 25 1 Y 1 A GLU 843 ? A GLU 144 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMT C C N N 88 FMT O1 O N N 89 FMT O2 O N N 90 FMT H H N N 91 FMT HO2 H N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 PTR N N N N 295 PTR CA C N S 296 PTR C C N N 297 PTR O O N N 298 PTR OXT O N N 299 PTR CB C N N 300 PTR CG C Y N 301 PTR CD1 C Y N 302 PTR CD2 C Y N 303 PTR CE1 C Y N 304 PTR CE2 C Y N 305 PTR CZ C Y N 306 PTR OH O N N 307 PTR P P N N 308 PTR O1P O N N 309 PTR O2P O N N 310 PTR O3P O N N 311 PTR H H N N 312 PTR H2 H N N 313 PTR HA H N N 314 PTR HXT H N N 315 PTR HB2 H N N 316 PTR HB3 H N N 317 PTR HD1 H N N 318 PTR HD2 H N N 319 PTR HE1 H N N 320 PTR HE2 H N N 321 PTR HO2P H N N 322 PTR HO3P H N N 323 SER N N N N 324 SER CA C N S 325 SER C C N N 326 SER O O N N 327 SER CB C N N 328 SER OG O N N 329 SER OXT O N N 330 SER H H N N 331 SER H2 H N N 332 SER HA H N N 333 SER HB2 H N N 334 SER HB3 H N N 335 SER HG H N N 336 SER HXT H N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TRP N N N N 355 TRP CA C N S 356 TRP C C N N 357 TRP O O N N 358 TRP CB C N N 359 TRP CG C Y N 360 TRP CD1 C Y N 361 TRP CD2 C Y N 362 TRP NE1 N Y N 363 TRP CE2 C Y N 364 TRP CE3 C Y N 365 TRP CZ2 C Y N 366 TRP CZ3 C Y N 367 TRP CH2 C Y N 368 TRP OXT O N N 369 TRP H H N N 370 TRP H2 H N N 371 TRP HA H N N 372 TRP HB2 H N N 373 TRP HB3 H N N 374 TRP HD1 H N N 375 TRP HE1 H N N 376 TRP HE3 H N N 377 TRP HZ2 H N N 378 TRP HZ3 H N N 379 TRP HH2 H N N 380 TRP HXT H N N 381 TYR N N N N 382 TYR CA C N S 383 TYR C C N N 384 TYR O O N N 385 TYR CB C N N 386 TYR CG C Y N 387 TYR CD1 C Y N 388 TYR CD2 C Y N 389 TYR CE1 C Y N 390 TYR CE2 C Y N 391 TYR CZ C Y N 392 TYR OH O N N 393 TYR OXT O N N 394 TYR H H N N 395 TYR H2 H N N 396 TYR HA H N N 397 TYR HB2 H N N 398 TYR HB3 H N N 399 TYR HD1 H N N 400 TYR HD2 H N N 401 TYR HE1 H N N 402 TYR HE2 H N N 403 TYR HH H N N 404 TYR HXT H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 VJH C11 C Y N 425 VJH C12 C Y N 426 VJH C13 C Y N 427 VJH C15 C N N 428 VJH C16 C N N 429 VJH C18 C Y N 430 VJH C19 C Y N 431 VJH C22 C Y N 432 VJH C26 C Y N 433 VJH C29 C Y N 434 VJH C30 C Y N 435 VJH C31 C Y N 436 VJH C33 C N N 437 VJH C34 C N N 438 VJH C36 C N N 439 VJH C37 C N N 440 VJH N35 N N N 441 VJH C01 C N N 442 VJH C02 C Y N 443 VJH C05 C Y N 444 VJH C07 C Y N 445 VJH C09 C Y N 446 VJH C14 C Y N 447 VJH C20 C Y N 448 VJH C21 C Y N 449 VJH C24 C Y N 450 VJH C27 C Y N 451 VJH C39 C Y N 452 VJH C40 C Y N 453 VJH C41 C Y N 454 VJH F23 F N N 455 VJH N03 N Y N 456 VJH N04 N Y N 457 VJH N06 N N N 458 VJH N08 N Y N 459 VJH N10 N N N 460 VJH N17 N N N 461 VJH N28 N Y N 462 VJH N32 N Y N 463 VJH N38 N Y N 464 VJH O25 O N N 465 VJH H121 H N N 466 VJH H131 H N N 467 VJH H152 H N N 468 VJH H151 H N N 469 VJH H191 H N N 470 VJH H261 H N N 471 VJH H311 H N N 472 VJH H332 H N N 473 VJH H331 H N N 474 VJH H341 H N N 475 VJH H342 H N N 476 VJH H362 H N N 477 VJH H363 H N N 478 VJH H361 H N N 479 VJH H372 H N N 480 VJH H371 H N N 481 VJH H373 H N N 482 VJH H013 H N N 483 VJH H012 H N N 484 VJH H011 H N N 485 VJH H201 H N N 486 VJH H211 H N N 487 VJH H241 H N N 488 VJH H271 H N N 489 VJH H391 H N N 490 VJH H401 H N N 491 VJH H411 H N N 492 VJH H041 H N N 493 VJH H061 H N N 494 VJH H101 H N N 495 VJH H171 H N N 496 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMT C O1 doub N N 83 FMT C O2 sing N N 84 FMT C H sing N N 85 FMT O2 HO2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 PTR N CA sing N N 281 PTR N H sing N N 282 PTR N H2 sing N N 283 PTR CA C sing N N 284 PTR CA CB sing N N 285 PTR CA HA sing N N 286 PTR C O doub N N 287 PTR C OXT sing N N 288 PTR OXT HXT sing N N 289 PTR CB CG sing N N 290 PTR CB HB2 sing N N 291 PTR CB HB3 sing N N 292 PTR CG CD1 doub Y N 293 PTR CG CD2 sing Y N 294 PTR CD1 CE1 sing Y N 295 PTR CD1 HD1 sing N N 296 PTR CD2 CE2 doub Y N 297 PTR CD2 HD2 sing N N 298 PTR CE1 CZ doub Y N 299 PTR CE1 HE1 sing N N 300 PTR CE2 CZ sing Y N 301 PTR CE2 HE2 sing N N 302 PTR CZ OH sing N N 303 PTR OH P sing N N 304 PTR P O1P doub N N 305 PTR P O2P sing N N 306 PTR P O3P sing N N 307 PTR O2P HO2P sing N N 308 PTR O3P HO3P sing N N 309 SER N CA sing N N 310 SER N H sing N N 311 SER N H2 sing N N 312 SER CA C sing N N 313 SER CA CB sing N N 314 SER CA HA sing N N 315 SER C O doub N N 316 SER C OXT sing N N 317 SER CB OG sing N N 318 SER CB HB2 sing N N 319 SER CB HB3 sing N N 320 SER OG HG sing N N 321 SER OXT HXT sing N N 322 THR N CA sing N N 323 THR N H sing N N 324 THR N H2 sing N N 325 THR CA C sing N N 326 THR CA CB sing N N 327 THR CA HA sing N N 328 THR C O doub N N 329 THR C OXT sing N N 330 THR CB OG1 sing N N 331 THR CB CG2 sing N N 332 THR CB HB sing N N 333 THR OG1 HG1 sing N N 334 THR CG2 HG21 sing N N 335 THR CG2 HG22 sing N N 336 THR CG2 HG23 sing N N 337 THR OXT HXT sing N N 338 TRP N CA sing N N 339 TRP N H sing N N 340 TRP N H2 sing N N 341 TRP CA C sing N N 342 TRP CA CB sing N N 343 TRP CA HA sing N N 344 TRP C O doub N N 345 TRP C OXT sing N N 346 TRP CB CG sing N N 347 TRP CB HB2 sing N N 348 TRP CB HB3 sing N N 349 TRP CG CD1 doub Y N 350 TRP CG CD2 sing Y N 351 TRP CD1 NE1 sing Y N 352 TRP CD1 HD1 sing N N 353 TRP CD2 CE2 doub Y N 354 TRP CD2 CE3 sing Y N 355 TRP NE1 CE2 sing Y N 356 TRP NE1 HE1 sing N N 357 TRP CE2 CZ2 sing Y N 358 TRP CE3 CZ3 doub Y N 359 TRP CE3 HE3 sing N N 360 TRP CZ2 CH2 doub Y N 361 TRP CZ2 HZ2 sing N N 362 TRP CZ3 CH2 sing Y N 363 TRP CZ3 HZ3 sing N N 364 TRP CH2 HH2 sing N N 365 TRP OXT HXT sing N N 366 TYR N CA sing N N 367 TYR N H sing N N 368 TYR N H2 sing N N 369 TYR CA C sing N N 370 TYR CA CB sing N N 371 TYR CA HA sing N N 372 TYR C O doub N N 373 TYR C OXT sing N N 374 TYR CB CG sing N N 375 TYR CB HB2 sing N N 376 TYR CB HB3 sing N N 377 TYR CG CD1 doub Y N 378 TYR CG CD2 sing Y N 379 TYR CD1 CE1 sing Y N 380 TYR CD1 HD1 sing N N 381 TYR CD2 CE2 doub Y N 382 TYR CD2 HD2 sing N N 383 TYR CE1 CZ doub Y N 384 TYR CE1 HE1 sing N N 385 TYR CE2 CZ sing Y N 386 TYR CE2 HE2 sing N N 387 TYR CZ OH sing N N 388 TYR OH HH sing N N 389 TYR OXT HXT sing N N 390 VAL N CA sing N N 391 VAL N H sing N N 392 VAL N H2 sing N N 393 VAL CA C sing N N 394 VAL CA CB sing N N 395 VAL CA HA sing N N 396 VAL C O doub N N 397 VAL C OXT sing N N 398 VAL CB CG1 sing N N 399 VAL CB CG2 sing N N 400 VAL CB HB sing N N 401 VAL CG1 HG11 sing N N 402 VAL CG1 HG12 sing N N 403 VAL CG1 HG13 sing N N 404 VAL CG2 HG21 sing N N 405 VAL CG2 HG22 sing N N 406 VAL CG2 HG23 sing N N 407 VAL OXT HXT sing N N 408 VJH C20 C19 doub Y N 409 VJH C20 C21 sing Y N 410 VJH C19 C18 sing Y N 411 VJH C21 C22 doub Y N 412 VJH C18 N17 sing N N 413 VJH C18 C24 doub Y N 414 VJH C22 C24 sing Y N 415 VJH C22 F23 sing N N 416 VJH N17 C16 sing N N 417 VJH C13 C12 doub Y N 418 VJH C13 C14 sing Y N 419 VJH C12 C11 sing Y N 420 VJH C16 C15 sing N N 421 VJH C16 O25 doub N N 422 VJH C15 C14 sing N N 423 VJH C14 C26 doub Y N 424 VJH C01 C02 sing N N 425 VJH C11 N10 sing N N 426 VJH C11 C27 doub Y N 427 VJH N10 C09 sing N N 428 VJH C02 C41 sing Y N 429 VJH C02 N03 doub Y N 430 VJH C26 C27 sing Y N 431 VJH C41 C05 doub Y N 432 VJH C09 N08 doub Y N 433 VJH C09 N28 sing Y N 434 VJH N08 C07 sing Y N 435 VJH N28 C29 doub Y N 436 VJH N03 N04 sing Y N 437 VJH C05 N06 sing N N 438 VJH C05 N04 sing Y N 439 VJH C07 N06 sing N N 440 VJH C07 C40 doub Y N 441 VJH C29 C40 sing Y N 442 VJH C29 C30 sing N N 443 VJH C30 C39 sing Y N 444 VJH C30 C31 doub Y N 445 VJH C39 N38 doub Y N 446 VJH C31 N32 sing Y N 447 VJH N38 N32 sing Y N 448 VJH N32 C33 sing N N 449 VJH N35 C37 sing N N 450 VJH N35 C36 sing N N 451 VJH N35 C34 sing N N 452 VJH C33 C34 sing N N 453 VJH C12 H121 sing N N 454 VJH C13 H131 sing N N 455 VJH C15 H152 sing N N 456 VJH C15 H151 sing N N 457 VJH C19 H191 sing N N 458 VJH C26 H261 sing N N 459 VJH C31 H311 sing N N 460 VJH C33 H332 sing N N 461 VJH C33 H331 sing N N 462 VJH C34 H341 sing N N 463 VJH C34 H342 sing N N 464 VJH C36 H362 sing N N 465 VJH C36 H363 sing N N 466 VJH C36 H361 sing N N 467 VJH C37 H372 sing N N 468 VJH C37 H371 sing N N 469 VJH C37 H373 sing N N 470 VJH C01 H013 sing N N 471 VJH C01 H012 sing N N 472 VJH C01 H011 sing N N 473 VJH C20 H201 sing N N 474 VJH C21 H211 sing N N 475 VJH C24 H241 sing N N 476 VJH C27 H271 sing N N 477 VJH C39 H391 sing N N 478 VJH C40 H401 sing N N 479 VJH C41 H411 sing N N 480 VJH N04 H041 sing N N 481 VJH N06 H061 sing N N 482 VJH N10 H101 sing N N 483 VJH N17 H171 sing N N 484 # _pdbx_audit_support.funding_organization 'The Francis Crick Institute' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id VJH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id VJH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4CKJ _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 7NZN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013716 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002810 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014067 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012731 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 8.95735 ? ? ? 7.27484 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_