data_7O7J # _entry.id 7O7J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7O7J pdb_00007o7j 10.2210/pdb7o7j/pdb WWPDB D_1292115269 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-24 2 'Structure model' 1 1 2021-12-01 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7O7J _pdbx_database_status.recvd_initial_deposition_date 2021-04-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kaltheuner, I.H.' 1 0000-0001-8450-4959 'Anand, K.' 2 0000-0003-1953-7222 'Geyer, M.' 3 0000-0002-7718-5002 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 6607 _citation.page_last 6607 _citation.title 'Abemaciclib is a potent inhibitor of DYRK1A and HIP kinases involved in transcriptional regulation.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-26935-z _citation.pdbx_database_id_PubMed 34785661 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kaltheuner, I.H.' 1 ? primary 'Anand, K.' 2 ? primary 'Moecking, J.' 3 ? primary 'Duster, R.' 4 0000-0003-4954-6883 primary 'Wang, J.' 5 0000-0002-1214-4103 primary 'Gray, N.S.' 6 0000-0001-5354-7403 primary 'Geyer, M.' 7 0000-0002-7718-5002 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Homeodomain-interacting protein kinase 3' 46144.840 1 2.7.11.1 ? ? ? 2 non-polymer syn ;N-{5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl}-5-fluoro-4-[4-fluoro-2-methyl-1-(propan-2-yl)-1H-benzimidazol-6-yl]py rimidin-2-amine ; 506.593 1 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Androgen receptor-interacting nuclear protein kinase,ANPK,Fas-interacting serine/threonine-protein kinase,FIST,Homolog of protein kinase YAK1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GNPVTVVTATTGSKQNCTTGEGDYQLVQHEVLCSMKNTYEVLDFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQG QIEVSILARLSTENADEYNFVRAYECFQHRNHTCLVFEMLEQNLYDFLKQNKFSPLPLKVIRPILQQVATALKKLKSLGL IHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCST(PTR)LQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFL GWPLYPGALEYDQIRYISQTQGLPGEQLLNVGTKSTRFFCKETDMSHSGWRLKTLEEHEAETGMKSKEARKYIFNSLDDV AHVNTVMDLEGSDLLAEKADRREFVSLLKKMLLIDADLRITPAETLNHPFVNMKHLLDFPHSNHVKSCFHIMDICKSHLN SCDTNNHN ; _entity_poly.pdbx_seq_one_letter_code_can ;GNPVTVVTATTGSKQNCTTGEGDYQLVQHEVLCSMKNTYEVLDFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQG QIEVSILARLSTENADEYNFVRAYECFQHRNHTCLVFEMLEQNLYDFLKQNKFSPLPLKVIRPILQQVATALKKLKSLGL IHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPL YPGALEYDQIRYISQTQGLPGEQLLNVGTKSTRFFCKETDMSHSGWRLKTLEEHEAETGMKSKEARKYIFNSLDDVAHVN TVMDLEGSDLLAEKADRREFVSLLKKMLLIDADLRITPAETLNHPFVNMKHLLDFPHSNHVKSCFHIMDICKSHLNSCDT NNHN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-{5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl}-5-fluoro-4-[4-fluoro-2-methyl-1-(propan-2-yl)-1H-benzimidazol-6-yl]py rimidin-2-amine ; 6ZV 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 PRO n 1 4 VAL n 1 5 THR n 1 6 VAL n 1 7 VAL n 1 8 THR n 1 9 ALA n 1 10 THR n 1 11 THR n 1 12 GLY n 1 13 SER n 1 14 LYS n 1 15 GLN n 1 16 ASN n 1 17 CYS n 1 18 THR n 1 19 THR n 1 20 GLY n 1 21 GLU n 1 22 GLY n 1 23 ASP n 1 24 TYR n 1 25 GLN n 1 26 LEU n 1 27 VAL n 1 28 GLN n 1 29 HIS n 1 30 GLU n 1 31 VAL n 1 32 LEU n 1 33 CYS n 1 34 SER n 1 35 MET n 1 36 LYS n 1 37 ASN n 1 38 THR n 1 39 TYR n 1 40 GLU n 1 41 VAL n 1 42 LEU n 1 43 ASP n 1 44 PHE n 1 45 LEU n 1 46 GLY n 1 47 ARG n 1 48 GLY n 1 49 THR n 1 50 PHE n 1 51 GLY n 1 52 GLN n 1 53 VAL n 1 54 VAL n 1 55 LYS n 1 56 CYS n 1 57 TRP n 1 58 LYS n 1 59 ARG n 1 60 GLY n 1 61 THR n 1 62 ASN n 1 63 GLU n 1 64 ILE n 1 65 VAL n 1 66 ALA n 1 67 ILE n 1 68 LYS n 1 69 ILE n 1 70 LEU n 1 71 LYS n 1 72 ASN n 1 73 HIS n 1 74 PRO n 1 75 SER n 1 76 TYR n 1 77 ALA n 1 78 ARG n 1 79 GLN n 1 80 GLY n 1 81 GLN n 1 82 ILE n 1 83 GLU n 1 84 VAL n 1 85 SER n 1 86 ILE n 1 87 LEU n 1 88 ALA n 1 89 ARG n 1 90 LEU n 1 91 SER n 1 92 THR n 1 93 GLU n 1 94 ASN n 1 95 ALA n 1 96 ASP n 1 97 GLU n 1 98 TYR n 1 99 ASN n 1 100 PHE n 1 101 VAL n 1 102 ARG n 1 103 ALA n 1 104 TYR n 1 105 GLU n 1 106 CYS n 1 107 PHE n 1 108 GLN n 1 109 HIS n 1 110 ARG n 1 111 ASN n 1 112 HIS n 1 113 THR n 1 114 CYS n 1 115 LEU n 1 116 VAL n 1 117 PHE n 1 118 GLU n 1 119 MET n 1 120 LEU n 1 121 GLU n 1 122 GLN n 1 123 ASN n 1 124 LEU n 1 125 TYR n 1 126 ASP n 1 127 PHE n 1 128 LEU n 1 129 LYS n 1 130 GLN n 1 131 ASN n 1 132 LYS n 1 133 PHE n 1 134 SER n 1 135 PRO n 1 136 LEU n 1 137 PRO n 1 138 LEU n 1 139 LYS n 1 140 VAL n 1 141 ILE n 1 142 ARG n 1 143 PRO n 1 144 ILE n 1 145 LEU n 1 146 GLN n 1 147 GLN n 1 148 VAL n 1 149 ALA n 1 150 THR n 1 151 ALA n 1 152 LEU n 1 153 LYS n 1 154 LYS n 1 155 LEU n 1 156 LYS n 1 157 SER n 1 158 LEU n 1 159 GLY n 1 160 LEU n 1 161 ILE n 1 162 HIS n 1 163 ALA n 1 164 ASP n 1 165 LEU n 1 166 LYS n 1 167 PRO n 1 168 GLU n 1 169 ASN n 1 170 ILE n 1 171 MET n 1 172 LEU n 1 173 VAL n 1 174 ASP n 1 175 PRO n 1 176 VAL n 1 177 ARG n 1 178 GLN n 1 179 PRO n 1 180 TYR n 1 181 ARG n 1 182 VAL n 1 183 LYS n 1 184 VAL n 1 185 ILE n 1 186 ASP n 1 187 PHE n 1 188 GLY n 1 189 SER n 1 190 ALA n 1 191 SER n 1 192 HIS n 1 193 VAL n 1 194 SER n 1 195 LYS n 1 196 THR n 1 197 VAL n 1 198 CYS n 1 199 SER n 1 200 THR n 1 201 PTR n 1 202 LEU n 1 203 GLN n 1 204 SER n 1 205 ARG n 1 206 TYR n 1 207 TYR n 1 208 ARG n 1 209 ALA n 1 210 PRO n 1 211 GLU n 1 212 ILE n 1 213 ILE n 1 214 LEU n 1 215 GLY n 1 216 LEU n 1 217 PRO n 1 218 PHE n 1 219 CYS n 1 220 GLU n 1 221 ALA n 1 222 ILE n 1 223 ASP n 1 224 MET n 1 225 TRP n 1 226 SER n 1 227 LEU n 1 228 GLY n 1 229 CYS n 1 230 VAL n 1 231 ILE n 1 232 ALA n 1 233 GLU n 1 234 LEU n 1 235 PHE n 1 236 LEU n 1 237 GLY n 1 238 TRP n 1 239 PRO n 1 240 LEU n 1 241 TYR n 1 242 PRO n 1 243 GLY n 1 244 ALA n 1 245 LEU n 1 246 GLU n 1 247 TYR n 1 248 ASP n 1 249 GLN n 1 250 ILE n 1 251 ARG n 1 252 TYR n 1 253 ILE n 1 254 SER n 1 255 GLN n 1 256 THR n 1 257 GLN n 1 258 GLY n 1 259 LEU n 1 260 PRO n 1 261 GLY n 1 262 GLU n 1 263 GLN n 1 264 LEU n 1 265 LEU n 1 266 ASN n 1 267 VAL n 1 268 GLY n 1 269 THR n 1 270 LYS n 1 271 SER n 1 272 THR n 1 273 ARG n 1 274 PHE n 1 275 PHE n 1 276 CYS n 1 277 LYS n 1 278 GLU n 1 279 THR n 1 280 ASP n 1 281 MET n 1 282 SER n 1 283 HIS n 1 284 SER n 1 285 GLY n 1 286 TRP n 1 287 ARG n 1 288 LEU n 1 289 LYS n 1 290 THR n 1 291 LEU n 1 292 GLU n 1 293 GLU n 1 294 HIS n 1 295 GLU n 1 296 ALA n 1 297 GLU n 1 298 THR n 1 299 GLY n 1 300 MET n 1 301 LYS n 1 302 SER n 1 303 LYS n 1 304 GLU n 1 305 ALA n 1 306 ARG n 1 307 LYS n 1 308 TYR n 1 309 ILE n 1 310 PHE n 1 311 ASN n 1 312 SER n 1 313 LEU n 1 314 ASP n 1 315 ASP n 1 316 VAL n 1 317 ALA n 1 318 HIS n 1 319 VAL n 1 320 ASN n 1 321 THR n 1 322 VAL n 1 323 MET n 1 324 ASP n 1 325 LEU n 1 326 GLU n 1 327 GLY n 1 328 SER n 1 329 ASP n 1 330 LEU n 1 331 LEU n 1 332 ALA n 1 333 GLU n 1 334 LYS n 1 335 ALA n 1 336 ASP n 1 337 ARG n 1 338 ARG n 1 339 GLU n 1 340 PHE n 1 341 VAL n 1 342 SER n 1 343 LEU n 1 344 LEU n 1 345 LYS n 1 346 LYS n 1 347 MET n 1 348 LEU n 1 349 LEU n 1 350 ILE n 1 351 ASP n 1 352 ALA n 1 353 ASP n 1 354 LEU n 1 355 ARG n 1 356 ILE n 1 357 THR n 1 358 PRO n 1 359 ALA n 1 360 GLU n 1 361 THR n 1 362 LEU n 1 363 ASN n 1 364 HIS n 1 365 PRO n 1 366 PHE n 1 367 VAL n 1 368 ASN n 1 369 MET n 1 370 LYS n 1 371 HIS n 1 372 LEU n 1 373 LEU n 1 374 ASP n 1 375 PHE n 1 376 PRO n 1 377 HIS n 1 378 SER n 1 379 ASN n 1 380 HIS n 1 381 VAL n 1 382 LYS n 1 383 SER n 1 384 CYS n 1 385 PHE n 1 386 HIS n 1 387 ILE n 1 388 MET n 1 389 ASP n 1 390 ILE n 1 391 CYS n 1 392 LYS n 1 393 SER n 1 394 HIS n 1 395 LEU n 1 396 ASN n 1 397 SER n 1 398 CYS n 1 399 ASP n 1 400 THR n 1 401 ASN n 1 402 ASN n 1 403 HIS n 1 404 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 404 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HIPK3, DYRK6, FIST3, PKY' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera aff. frugiperda 1 BOLD-2017' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 2449148 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6ZV non-polymer . ;N-{5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl}-5-fluoro-4-[4-fluoro-2-methyl-1-(propan-2-yl)-1H-benzimidazol-6-yl]py rimidin-2-amine ; Abemaciclib 'C27 H32 F2 N8' 506.593 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 159 ? ? ? A . n A 1 2 ASN 2 160 ? ? ? A . n A 1 3 PRO 3 161 ? ? ? A . n A 1 4 VAL 4 162 ? ? ? A . n A 1 5 THR 5 163 ? ? ? A . n A 1 6 VAL 6 164 ? ? ? A . n A 1 7 VAL 7 165 ? ? ? A . n A 1 8 THR 8 166 ? ? ? A . n A 1 9 ALA 9 167 ? ? ? A . n A 1 10 THR 10 168 ? ? ? A . n A 1 11 THR 11 169 ? ? ? A . n A 1 12 GLY 12 170 ? ? ? A . n A 1 13 SER 13 171 ? ? ? A . n A 1 14 LYS 14 172 ? ? ? A . n A 1 15 GLN 15 173 ? ? ? A . n A 1 16 ASN 16 174 ? ? ? A . n A 1 17 CYS 17 175 ? ? ? A . n A 1 18 THR 18 176 ? ? ? A . n A 1 19 THR 19 177 ? ? ? A . n A 1 20 GLY 20 178 ? ? ? A . n A 1 21 GLU 21 179 ? ? ? A . n A 1 22 GLY 22 180 ? ? ? A . n A 1 23 ASP 23 181 ? ? ? A . n A 1 24 TYR 24 182 ? ? ? A . n A 1 25 GLN 25 183 ? ? ? A . n A 1 26 LEU 26 184 184 LEU LEU A . n A 1 27 VAL 27 185 185 VAL VAL A . n A 1 28 GLN 28 186 186 GLN GLN A . n A 1 29 HIS 29 187 187 HIS HIS A . n A 1 30 GLU 30 188 188 GLU GLU A . n A 1 31 VAL 31 189 189 VAL VAL A . n A 1 32 LEU 32 190 190 LEU LEU A . n A 1 33 CYS 33 191 191 CYS CYS A . n A 1 34 SER 34 192 192 SER SER A . n A 1 35 MET 35 193 193 MET MET A . n A 1 36 LYS 36 194 194 LYS LYS A . n A 1 37 ASN 37 195 195 ASN ASN A . n A 1 38 THR 38 196 196 THR THR A . n A 1 39 TYR 39 197 197 TYR TYR A . n A 1 40 GLU 40 198 198 GLU GLU A . n A 1 41 VAL 41 199 199 VAL VAL A . n A 1 42 LEU 42 200 200 LEU LEU A . n A 1 43 ASP 43 201 201 ASP ASP A . n A 1 44 PHE 44 202 202 PHE PHE A . n A 1 45 LEU 45 203 203 LEU LEU A . n A 1 46 GLY 46 204 204 GLY GLY A . n A 1 47 ARG 47 205 205 ARG ARG A . n A 1 48 GLY 48 206 206 GLY GLY A . n A 1 49 THR 49 207 207 THR THR A . n A 1 50 PHE 50 208 208 PHE PHE A . n A 1 51 GLY 51 209 209 GLY GLY A . n A 1 52 GLN 52 210 210 GLN GLN A . n A 1 53 VAL 53 211 211 VAL VAL A . n A 1 54 VAL 54 212 212 VAL VAL A . n A 1 55 LYS 55 213 213 LYS LYS A . n A 1 56 CYS 56 214 214 CYS CYS A . n A 1 57 TRP 57 215 215 TRP TRP A . n A 1 58 LYS 58 216 216 LYS LYS A . n A 1 59 ARG 59 217 217 ARG ARG A . n A 1 60 GLY 60 218 218 GLY GLY A . n A 1 61 THR 61 219 219 THR THR A . n A 1 62 ASN 62 220 220 ASN ASN A . n A 1 63 GLU 63 221 221 GLU GLU A . n A 1 64 ILE 64 222 222 ILE ILE A . n A 1 65 VAL 65 223 223 VAL VAL A . n A 1 66 ALA 66 224 224 ALA ALA A . n A 1 67 ILE 67 225 225 ILE ILE A . n A 1 68 LYS 68 226 226 LYS LYS A . n A 1 69 ILE 69 227 227 ILE ILE A . n A 1 70 LEU 70 228 228 LEU LEU A . n A 1 71 LYS 71 229 229 LYS LYS A . n A 1 72 ASN 72 230 230 ASN ASN A . n A 1 73 HIS 73 231 231 HIS HIS A . n A 1 74 PRO 74 232 232 PRO PRO A . n A 1 75 SER 75 233 233 SER SER A . n A 1 76 TYR 76 234 234 TYR TYR A . n A 1 77 ALA 77 235 235 ALA ALA A . n A 1 78 ARG 78 236 236 ARG ARG A . n A 1 79 GLN 79 237 237 GLN GLN A . n A 1 80 GLY 80 238 238 GLY GLY A . n A 1 81 GLN 81 239 239 GLN GLN A . n A 1 82 ILE 82 240 240 ILE ILE A . n A 1 83 GLU 83 241 241 GLU GLU A . n A 1 84 VAL 84 242 242 VAL VAL A . n A 1 85 SER 85 243 243 SER SER A . n A 1 86 ILE 86 244 244 ILE ILE A . n A 1 87 LEU 87 245 245 LEU LEU A . n A 1 88 ALA 88 246 246 ALA ALA A . n A 1 89 ARG 89 247 247 ARG ARG A . n A 1 90 LEU 90 248 248 LEU LEU A . n A 1 91 SER 91 249 249 SER SER A . n A 1 92 THR 92 250 250 THR THR A . n A 1 93 GLU 93 251 251 GLU GLU A . n A 1 94 ASN 94 252 252 ASN ASN A . n A 1 95 ALA 95 253 253 ALA ALA A . n A 1 96 ASP 96 254 254 ASP ASP A . n A 1 97 GLU 97 255 255 GLU GLU A . n A 1 98 TYR 98 256 256 TYR TYR A . n A 1 99 ASN 99 257 257 ASN ASN A . n A 1 100 PHE 100 258 258 PHE PHE A . n A 1 101 VAL 101 259 259 VAL VAL A . n A 1 102 ARG 102 260 260 ARG ARG A . n A 1 103 ALA 103 261 261 ALA ALA A . n A 1 104 TYR 104 262 262 TYR TYR A . n A 1 105 GLU 105 263 263 GLU GLU A . n A 1 106 CYS 106 264 264 CYS CYS A . n A 1 107 PHE 107 265 265 PHE PHE A . n A 1 108 GLN 108 266 266 GLN GLN A . n A 1 109 HIS 109 267 267 HIS HIS A . n A 1 110 ARG 110 268 268 ARG ARG A . n A 1 111 ASN 111 269 269 ASN ASN A . n A 1 112 HIS 112 270 270 HIS HIS A . n A 1 113 THR 113 271 271 THR THR A . n A 1 114 CYS 114 272 272 CYS CYS A . n A 1 115 LEU 115 273 273 LEU LEU A . n A 1 116 VAL 116 274 274 VAL VAL A . n A 1 117 PHE 117 275 275 PHE PHE A . n A 1 118 GLU 118 276 276 GLU GLU A . n A 1 119 MET 119 277 277 MET MET A . n A 1 120 LEU 120 278 278 LEU LEU A . n A 1 121 GLU 121 279 279 GLU GLU A . n A 1 122 GLN 122 280 280 GLN GLN A . n A 1 123 ASN 123 281 281 ASN ASN A . n A 1 124 LEU 124 282 282 LEU LEU A . n A 1 125 TYR 125 283 283 TYR TYR A . n A 1 126 ASP 126 284 284 ASP ASP A . n A 1 127 PHE 127 285 285 PHE PHE A . n A 1 128 LEU 128 286 286 LEU LEU A . n A 1 129 LYS 129 287 287 LYS LYS A . n A 1 130 GLN 130 288 288 GLN GLN A . n A 1 131 ASN 131 289 289 ASN ASN A . n A 1 132 LYS 132 290 290 LYS LYS A . n A 1 133 PHE 133 291 291 PHE PHE A . n A 1 134 SER 134 292 292 SER SER A . n A 1 135 PRO 135 293 293 PRO PRO A . n A 1 136 LEU 136 294 294 LEU LEU A . n A 1 137 PRO 137 295 295 PRO PRO A . n A 1 138 LEU 138 296 296 LEU LEU A . n A 1 139 LYS 139 297 297 LYS LYS A . n A 1 140 VAL 140 298 298 VAL VAL A . n A 1 141 ILE 141 299 299 ILE ILE A . n A 1 142 ARG 142 300 300 ARG ARG A . n A 1 143 PRO 143 301 301 PRO PRO A . n A 1 144 ILE 144 302 302 ILE ILE A . n A 1 145 LEU 145 303 303 LEU LEU A . n A 1 146 GLN 146 304 304 GLN GLN A . n A 1 147 GLN 147 305 305 GLN GLN A . n A 1 148 VAL 148 306 306 VAL VAL A . n A 1 149 ALA 149 307 307 ALA ALA A . n A 1 150 THR 150 308 308 THR THR A . n A 1 151 ALA 151 309 309 ALA ALA A . n A 1 152 LEU 152 310 310 LEU LEU A . n A 1 153 LYS 153 311 311 LYS LYS A . n A 1 154 LYS 154 312 312 LYS LYS A . n A 1 155 LEU 155 313 313 LEU LEU A . n A 1 156 LYS 156 314 314 LYS LYS A . n A 1 157 SER 157 315 315 SER SER A . n A 1 158 LEU 158 316 316 LEU LEU A . n A 1 159 GLY 159 317 317 GLY GLY A . n A 1 160 LEU 160 318 318 LEU LEU A . n A 1 161 ILE 161 319 319 ILE ILE A . n A 1 162 HIS 162 320 320 HIS HIS A . n A 1 163 ALA 163 321 321 ALA ALA A . n A 1 164 ASP 164 322 322 ASP ASP A . n A 1 165 LEU 165 323 323 LEU LEU A . n A 1 166 LYS 166 324 324 LYS LYS A . n A 1 167 PRO 167 325 325 PRO PRO A . n A 1 168 GLU 168 326 326 GLU GLU A . n A 1 169 ASN 169 327 327 ASN ASN A . n A 1 170 ILE 170 328 328 ILE ILE A . n A 1 171 MET 171 329 329 MET MET A . n A 1 172 LEU 172 330 330 LEU LEU A . n A 1 173 VAL 173 331 331 VAL VAL A . n A 1 174 ASP 174 332 332 ASP ASP A . n A 1 175 PRO 175 333 333 PRO PRO A . n A 1 176 VAL 176 334 334 VAL VAL A . n A 1 177 ARG 177 335 335 ARG ARG A . n A 1 178 GLN 178 336 336 GLN GLN A . n A 1 179 PRO 179 337 337 PRO PRO A . n A 1 180 TYR 180 338 338 TYR TYR A . n A 1 181 ARG 181 339 339 ARG ARG A . n A 1 182 VAL 182 340 340 VAL VAL A . n A 1 183 LYS 183 341 341 LYS LYS A . n A 1 184 VAL 184 342 342 VAL VAL A . n A 1 185 ILE 185 343 343 ILE ILE A . n A 1 186 ASP 186 344 344 ASP ASP A . n A 1 187 PHE 187 345 345 PHE PHE A . n A 1 188 GLY 188 346 346 GLY GLY A . n A 1 189 SER 189 347 347 SER SER A . n A 1 190 ALA 190 348 348 ALA ALA A . n A 1 191 SER 191 349 349 SER SER A . n A 1 192 HIS 192 350 350 HIS HIS A . n A 1 193 VAL 193 351 351 VAL VAL A . n A 1 194 SER 194 352 352 SER SER A . n A 1 195 LYS 195 353 353 LYS LYS A . n A 1 196 THR 196 354 354 THR THR A . n A 1 197 VAL 197 355 355 VAL VAL A . n A 1 198 CYS 198 356 356 CYS CYS A . n A 1 199 SER 199 357 357 SER SER A . n A 1 200 THR 200 358 358 THR THR A . n A 1 201 PTR 201 359 359 PTR PTR A . n A 1 202 LEU 202 360 360 LEU LEU A . n A 1 203 GLN 203 361 361 GLN GLN A . n A 1 204 SER 204 362 362 SER SER A . n A 1 205 ARG 205 363 363 ARG ARG A . n A 1 206 TYR 206 364 364 TYR TYR A . n A 1 207 TYR 207 365 365 TYR TYR A . n A 1 208 ARG 208 366 366 ARG ARG A . n A 1 209 ALA 209 367 367 ALA ALA A . n A 1 210 PRO 210 368 368 PRO PRO A . n A 1 211 GLU 211 369 369 GLU GLU A . n A 1 212 ILE 212 370 370 ILE ILE A . n A 1 213 ILE 213 371 371 ILE ILE A . n A 1 214 LEU 214 372 372 LEU LEU A . n A 1 215 GLY 215 373 373 GLY GLY A . n A 1 216 LEU 216 374 374 LEU LEU A . n A 1 217 PRO 217 375 375 PRO PRO A . n A 1 218 PHE 218 376 376 PHE PHE A . n A 1 219 CYS 219 377 377 CYS CYS A . n A 1 220 GLU 220 378 378 GLU GLU A . n A 1 221 ALA 221 379 379 ALA ALA A . n A 1 222 ILE 222 380 380 ILE ILE A . n A 1 223 ASP 223 381 381 ASP ASP A . n A 1 224 MET 224 382 382 MET MET A . n A 1 225 TRP 225 383 383 TRP TRP A . n A 1 226 SER 226 384 384 SER SER A . n A 1 227 LEU 227 385 385 LEU LEU A . n A 1 228 GLY 228 386 386 GLY GLY A . n A 1 229 CYS 229 387 387 CYS CYS A . n A 1 230 VAL 230 388 388 VAL VAL A . n A 1 231 ILE 231 389 389 ILE ILE A . n A 1 232 ALA 232 390 390 ALA ALA A . n A 1 233 GLU 233 391 391 GLU GLU A . n A 1 234 LEU 234 392 392 LEU LEU A . n A 1 235 PHE 235 393 393 PHE PHE A . n A 1 236 LEU 236 394 394 LEU LEU A . n A 1 237 GLY 237 395 395 GLY GLY A . n A 1 238 TRP 238 396 396 TRP TRP A . n A 1 239 PRO 239 397 397 PRO PRO A . n A 1 240 LEU 240 398 398 LEU LEU A . n A 1 241 TYR 241 399 399 TYR TYR A . n A 1 242 PRO 242 400 400 PRO PRO A . n A 1 243 GLY 243 401 401 GLY GLY A . n A 1 244 ALA 244 402 402 ALA ALA A . n A 1 245 LEU 245 403 403 LEU LEU A . n A 1 246 GLU 246 404 404 GLU GLU A . n A 1 247 TYR 247 405 405 TYR TYR A . n A 1 248 ASP 248 406 406 ASP ASP A . n A 1 249 GLN 249 407 407 GLN GLN A . n A 1 250 ILE 250 408 408 ILE ILE A . n A 1 251 ARG 251 409 409 ARG ARG A . n A 1 252 TYR 252 410 410 TYR TYR A . n A 1 253 ILE 253 411 411 ILE ILE A . n A 1 254 SER 254 412 412 SER SER A . n A 1 255 GLN 255 413 413 GLN GLN A . n A 1 256 THR 256 414 414 THR THR A . n A 1 257 GLN 257 415 415 GLN GLN A . n A 1 258 GLY 258 416 416 GLY GLY A . n A 1 259 LEU 259 417 417 LEU LEU A . n A 1 260 PRO 260 418 418 PRO PRO A . n A 1 261 GLY 261 419 419 GLY GLY A . n A 1 262 GLU 262 420 420 GLU GLU A . n A 1 263 GLN 263 421 421 GLN GLN A . n A 1 264 LEU 264 422 422 LEU LEU A . n A 1 265 LEU 265 423 423 LEU LEU A . n A 1 266 ASN 266 424 424 ASN ASN A . n A 1 267 VAL 267 425 425 VAL VAL A . n A 1 268 GLY 268 426 426 GLY GLY A . n A 1 269 THR 269 427 427 THR THR A . n A 1 270 LYS 270 428 428 LYS LYS A . n A 1 271 SER 271 429 429 SER SER A . n A 1 272 THR 272 430 430 THR THR A . n A 1 273 ARG 273 431 431 ARG ARG A . n A 1 274 PHE 274 432 432 PHE PHE A . n A 1 275 PHE 275 433 433 PHE PHE A . n A 1 276 CYS 276 434 434 CYS CYS A . n A 1 277 LYS 277 435 435 LYS LYS A . n A 1 278 GLU 278 436 436 GLU GLU A . n A 1 279 THR 279 437 437 THR THR A . n A 1 280 ASP 280 438 438 ASP ASP A . n A 1 281 MET 281 439 439 MET MET A . n A 1 282 SER 282 440 440 SER SER A . n A 1 283 HIS 283 441 441 HIS HIS A . n A 1 284 SER 284 442 442 SER SER A . n A 1 285 GLY 285 443 443 GLY GLY A . n A 1 286 TRP 286 444 444 TRP TRP A . n A 1 287 ARG 287 445 445 ARG ARG A . n A 1 288 LEU 288 446 446 LEU LEU A . n A 1 289 LYS 289 447 447 LYS LYS A . n A 1 290 THR 290 448 448 THR THR A . n A 1 291 LEU 291 449 449 LEU LEU A . n A 1 292 GLU 292 450 450 GLU GLU A . n A 1 293 GLU 293 451 451 GLU GLU A . n A 1 294 HIS 294 452 452 HIS HIS A . n A 1 295 GLU 295 453 453 GLU GLU A . n A 1 296 ALA 296 454 454 ALA ALA A . n A 1 297 GLU 297 455 455 GLU GLU A . n A 1 298 THR 298 456 456 THR THR A . n A 1 299 GLY 299 457 457 GLY GLY A . n A 1 300 MET 300 458 458 MET MET A . n A 1 301 LYS 301 459 459 LYS LYS A . n A 1 302 SER 302 460 460 SER SER A . n A 1 303 LYS 303 461 461 LYS LYS A . n A 1 304 GLU 304 462 462 GLU GLU A . n A 1 305 ALA 305 463 463 ALA ALA A . n A 1 306 ARG 306 464 464 ARG ARG A . n A 1 307 LYS 307 465 465 LYS LYS A . n A 1 308 TYR 308 466 466 TYR TYR A . n A 1 309 ILE 309 467 467 ILE ILE A . n A 1 310 PHE 310 468 468 PHE PHE A . n A 1 311 ASN 311 469 469 ASN ASN A . n A 1 312 SER 312 470 470 SER SER A . n A 1 313 LEU 313 471 471 LEU LEU A . n A 1 314 ASP 314 472 472 ASP ASP A . n A 1 315 ASP 315 473 473 ASP ASP A . n A 1 316 VAL 316 474 474 VAL VAL A . n A 1 317 ALA 317 475 475 ALA ALA A . n A 1 318 HIS 318 476 476 HIS HIS A . n A 1 319 VAL 319 477 477 VAL VAL A . n A 1 320 ASN 320 478 478 ASN ASN A . n A 1 321 THR 321 479 479 THR THR A . n A 1 322 VAL 322 480 480 VAL VAL A . n A 1 323 MET 323 481 481 MET MET A . n A 1 324 ASP 324 482 482 ASP ASP A . n A 1 325 LEU 325 483 483 LEU LEU A . n A 1 326 GLU 326 484 484 GLU GLU A . n A 1 327 GLY 327 485 485 GLY GLY A . n A 1 328 SER 328 486 486 SER SER A . n A 1 329 ASP 329 487 487 ASP ASP A . n A 1 330 LEU 330 488 488 LEU LEU A . n A 1 331 LEU 331 489 489 LEU LEU A . n A 1 332 ALA 332 490 490 ALA ALA A . n A 1 333 GLU 333 491 491 GLU GLU A . n A 1 334 LYS 334 492 492 LYS LYS A . n A 1 335 ALA 335 493 493 ALA ALA A . n A 1 336 ASP 336 494 494 ASP ASP A . n A 1 337 ARG 337 495 495 ARG ARG A . n A 1 338 ARG 338 496 496 ARG ARG A . n A 1 339 GLU 339 497 497 GLU GLU A . n A 1 340 PHE 340 498 498 PHE PHE A . n A 1 341 VAL 341 499 499 VAL VAL A . n A 1 342 SER 342 500 500 SER SER A . n A 1 343 LEU 343 501 501 LEU LEU A . n A 1 344 LEU 344 502 502 LEU LEU A . n A 1 345 LYS 345 503 503 LYS LYS A . n A 1 346 LYS 346 504 504 LYS LYS A . n A 1 347 MET 347 505 505 MET MET A . n A 1 348 LEU 348 506 506 LEU LEU A . n A 1 349 LEU 349 507 507 LEU LEU A . n A 1 350 ILE 350 508 508 ILE ILE A . n A 1 351 ASP 351 509 509 ASP ASP A . n A 1 352 ALA 352 510 510 ALA ALA A . n A 1 353 ASP 353 511 511 ASP ASP A . n A 1 354 LEU 354 512 512 LEU LEU A . n A 1 355 ARG 355 513 513 ARG ARG A . n A 1 356 ILE 356 514 514 ILE ILE A . n A 1 357 THR 357 515 515 THR THR A . n A 1 358 PRO 358 516 516 PRO PRO A . n A 1 359 ALA 359 517 517 ALA ALA A . n A 1 360 GLU 360 518 518 GLU GLU A . n A 1 361 THR 361 519 519 THR THR A . n A 1 362 LEU 362 520 520 LEU LEU A . n A 1 363 ASN 363 521 521 ASN ASN A . n A 1 364 HIS 364 522 522 HIS HIS A . n A 1 365 PRO 365 523 523 PRO PRO A . n A 1 366 PHE 366 524 524 PHE PHE A . n A 1 367 VAL 367 525 525 VAL VAL A . n A 1 368 ASN 368 526 526 ASN ASN A . n A 1 369 MET 369 527 527 MET MET A . n A 1 370 LYS 370 528 528 LYS LYS A . n A 1 371 HIS 371 529 529 HIS HIS A . n A 1 372 LEU 372 530 530 LEU LEU A . n A 1 373 LEU 373 531 531 LEU LEU A . n A 1 374 ASP 374 532 532 ASP ASP A . n A 1 375 PHE 375 533 533 PHE PHE A . n A 1 376 PRO 376 534 534 PRO PRO A . n A 1 377 HIS 377 535 535 HIS HIS A . n A 1 378 SER 378 536 536 SER SER A . n A 1 379 ASN 379 537 537 ASN ASN A . n A 1 380 HIS 380 538 538 HIS HIS A . n A 1 381 VAL 381 539 539 VAL VAL A . n A 1 382 LYS 382 540 540 LYS LYS A . n A 1 383 SER 383 541 541 SER SER A . n A 1 384 CYS 384 542 542 CYS CYS A . n A 1 385 PHE 385 543 543 PHE PHE A . n A 1 386 HIS 386 544 544 HIS HIS A . n A 1 387 ILE 387 545 545 ILE ILE A . n A 1 388 MET 388 546 546 MET MET A . n A 1 389 ASP 389 547 547 ASP ASP A . n A 1 390 ILE 390 548 548 ILE ILE A . n A 1 391 CYS 391 549 549 CYS CYS A . n A 1 392 LYS 392 550 550 LYS LYS A . n A 1 393 SER 393 551 551 SER SER A . n A 1 394 HIS 394 552 ? ? ? A . n A 1 395 LEU 395 553 ? ? ? A . n A 1 396 ASN 396 554 ? ? ? A . n A 1 397 SER 397 555 ? ? ? A . n A 1 398 CYS 398 556 ? ? ? A . n A 1 399 ASP 399 557 ? ? ? A . n A 1 400 THR 400 558 ? ? ? A . n A 1 401 ASN 401 559 ? ? ? A . n A 1 402 ASN 402 560 ? ? ? A . n A 1 403 HIS 403 561 ? ? ? A . n A 1 404 ASN 404 562 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 6ZV 1 900 900 6ZV 6ZV A . C 3 HOH 1 1001 84 HOH HOH A . C 3 HOH 2 1002 94 HOH HOH A . C 3 HOH 3 1003 93 HOH HOH A . C 3 HOH 4 1004 89 HOH HOH A . C 3 HOH 5 1005 9 HOH HOH A . C 3 HOH 6 1006 6 HOH HOH A . C 3 HOH 7 1007 1 HOH HOH A . C 3 HOH 8 1008 80 HOH HOH A . C 3 HOH 9 1009 2 HOH HOH A . C 3 HOH 10 1010 83 HOH HOH A . C 3 HOH 11 1011 95 HOH HOH A . C 3 HOH 12 1012 88 HOH HOH A . C 3 HOH 13 1013 96 HOH HOH A . C 3 HOH 14 1014 22 HOH HOH A . C 3 HOH 15 1015 85 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 193 ? CG ? A MET 35 CG 2 1 Y 1 A MET 193 ? SD ? A MET 35 SD 3 1 Y 1 A MET 193 ? CE ? A MET 35 CE 4 1 Y 1 A GLN 239 ? CG ? A GLN 81 CG 5 1 Y 1 A GLN 239 ? CD ? A GLN 81 CD 6 1 Y 1 A GLN 239 ? OE1 ? A GLN 81 OE1 7 1 Y 1 A GLN 239 ? NE2 ? A GLN 81 NE2 8 1 Y 1 A ARG 335 ? CG ? A ARG 177 CG 9 1 Y 1 A ARG 335 ? CD ? A ARG 177 CD 10 1 Y 1 A ARG 335 ? NE ? A ARG 177 NE 11 1 Y 1 A ARG 335 ? CZ ? A ARG 177 CZ 12 1 Y 1 A ARG 335 ? NH1 ? A ARG 177 NH1 13 1 Y 1 A ARG 335 ? NH2 ? A ARG 177 NH2 14 1 Y 1 A GLU 420 ? CG ? A GLU 262 CG 15 1 Y 1 A GLU 420 ? CD ? A GLU 262 CD 16 1 Y 1 A GLU 420 ? OE1 ? A GLU 262 OE1 17 1 Y 1 A GLU 420 ? OE2 ? A GLU 262 OE2 18 1 Y 1 A LYS 459 ? CG ? A LYS 301 CG 19 1 Y 1 A LYS 459 ? CD ? A LYS 301 CD 20 1 Y 1 A LYS 459 ? CE ? A LYS 301 CE 21 1 Y 1 A LYS 459 ? NZ ? A LYS 301 NZ 22 1 Y 1 A LYS 461 ? CD ? A LYS 303 CD 23 1 Y 1 A LYS 461 ? CE ? A LYS 303 CE 24 1 Y 1 A LYS 461 ? NZ ? A LYS 303 NZ 25 1 Y 0 A LYS 492 ? CE ? A LYS 334 CE 26 1 Y 0 A LYS 492 ? NZ ? A LYS 334 NZ 27 1 Y 1 A ARG 496 ? CD ? A ARG 338 CD 28 1 Y 1 A ARG 496 ? NE ? A ARG 338 NE 29 1 Y 1 A ARG 496 ? CZ ? A ARG 338 CZ 30 1 Y 1 A ARG 496 ? NH1 ? A ARG 338 NH1 31 1 Y 1 A ARG 496 ? NH2 ? A ARG 338 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7O7J _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.064 _cell.length_a_esd ? _cell.length_b 81.064 _cell.length_b_esd ? _cell.length_c 178.820 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7O7J _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7O7J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.00 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 288 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris/HCl (pH 8.0), 0.2 M MgCl2, and 8% PEG 8000 solution' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00001 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00001 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7O7J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.81 _reflns.d_resolution_low 45.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17239 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.91 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.68 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06367 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.81 _reflns_shell.d_res_low 2.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1679 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.825 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 194.980 _refine.B_iso_mean 116.1661 _refine.B_iso_min 68.430 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7O7J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8100 _refine.ls_d_res_low 45.4400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17239 _refine.ls_number_reflns_R_free 863 _refine.ls_number_reflns_R_work 16376 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9000 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2473 _refine.ls_R_factor_R_free 0.2733 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2459 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model HIPK3 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.0100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8100 _refine_hist.d_res_low 45.4400 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 2995 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 368 _refine_hist.pdbx_B_iso_mean_ligand 98.03 _refine_hist.pdbx_B_iso_mean_solvent 113.47 _refine_hist.pdbx_number_atoms_protein 2943 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8100 2.9800 2792 . 140 2652 100.0000 . . . 0.3565 0.0000 0.3322 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.9800 3.2100 2820 . 141 2679 100.0000 . . . 0.3995 0.0000 0.3820 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.2100 3.5400 2843 . 143 2700 100.0000 . . . 0.3581 0.0000 0.3134 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.5400 4.0500 2864 . 143 2721 100.0000 . . . 0.2941 0.0000 0.2951 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 4.0500 5.1000 2882 . 145 2737 100.0000 . . . 0.2648 0.0000 0.2399 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 5.1000 45.4400 3038 . 151 2887 100.0000 . . . 0.2420 0.0000 0.2050 . . . . . . . 6 . . . # _struct.entry_id 7O7J _struct.title 'Crystal structure of the human HIPK3 kinase domain bound to abemaciclib' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7O7J _struct_keywords.text 'serine/threonine kinase, CMGC kinase, homeodomain-interacting protein kinase 3, transcription, abemaciclib, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HIPK3_HUMAN _struct_ref.pdbx_db_accession Q9H422 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GNPVTVVTATTGSKQNCTTGEGDYQLVQHEVLCSMKNTYEVLDFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQG QIEVSILARLSTENADEYNFVRAYECFQHRNHTCLVFEMLEQNLYDFLKQNKFSPLPLKVIRPILQQVATALKKLKSLGL IHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPL YPGALEYDQIRYISQTQGLPGEQLLNVGTKSTRFFCKETDMSHSGWRLKTLEEHEAETGMKSKEARKYIFNSLDDVAHVN TVMDLEGSDLLAEKADRREFVSLLKKMLLIDADLRITPAETLNHPFVNMKHLLDFPHSNHVKSCFHIMDICKSHLNSCDT NNHN ; _struct_ref.pdbx_align_begin 159 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7O7J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 404 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H422 _struct_ref_seq.db_align_beg 159 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 562 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 159 _struct_ref_seq.pdbx_auth_seq_align_end 562 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 17920 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 73 ? SER A 75 ? HIS A 231 SER A 233 5 ? 3 HELX_P HELX_P2 AA2 TYR A 76 ? THR A 92 ? TYR A 234 THR A 250 1 ? 17 HELX_P HELX_P3 AA3 LEU A 124 ? ASN A 131 ? LEU A 282 ASN A 289 1 ? 8 HELX_P HELX_P4 AA4 PRO A 137 ? GLY A 159 ? PRO A 295 GLY A 317 1 ? 23 HELX_P HELX_P5 AA5 LYS A 166 ? GLU A 168 ? LYS A 324 GLU A 326 5 ? 3 HELX_P HELX_P6 AA6 SER A 204 ? ARG A 208 ? SER A 362 ARG A 366 5 ? 5 HELX_P HELX_P7 AA7 ALA A 209 ? GLY A 215 ? ALA A 367 GLY A 373 1 ? 7 HELX_P HELX_P8 AA8 GLU A 220 ? GLY A 237 ? GLU A 378 GLY A 395 1 ? 18 HELX_P HELX_P9 AA9 LEU A 245 ? GLY A 258 ? LEU A 403 GLY A 416 1 ? 14 HELX_P HELX_P10 AB1 GLY A 261 ? GLY A 268 ? GLY A 419 GLY A 426 1 ? 8 HELX_P HELX_P11 AB2 LYS A 270 ? PHE A 274 ? LYS A 428 PHE A 432 1 ? 5 HELX_P HELX_P12 AB3 THR A 290 ? GLY A 299 ? THR A 448 GLY A 457 1 ? 10 HELX_P HELX_P13 AB4 LEU A 313 ? VAL A 319 ? LEU A 471 VAL A 477 5 ? 7 HELX_P HELX_P14 AB5 GLY A 327 ? LEU A 348 ? GLY A 485 LEU A 506 1 ? 22 HELX_P HELX_P15 AB6 THR A 357 ? LEU A 362 ? THR A 515 LEU A 520 1 ? 6 HELX_P HELX_P16 AB7 HIS A 364 ? MET A 369 ? HIS A 522 MET A 527 1 ? 6 HELX_P HELX_P17 AB8 MET A 369 ? ASP A 374 ? MET A 527 ASP A 532 1 ? 6 HELX_P HELX_P18 AB9 HIS A 380 ? SER A 393 ? HIS A 538 SER A 551 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 200 C ? ? ? 1_555 A PTR 201 N ? ? A THR 358 A PTR 359 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale2 covale both ? A PTR 201 C ? ? ? 1_555 A LEU 202 N ? ? A PTR 359 A LEU 360 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 39 ? GLY A 48 ? TYR A 197 GLY A 206 AA1 2 GLY A 51 ? LYS A 58 ? GLY A 209 LYS A 216 AA1 3 ILE A 64 ? LEU A 70 ? ILE A 222 LEU A 228 AA1 4 HIS A 112 ? GLU A 118 ? HIS A 270 GLU A 276 AA1 5 ALA A 103 ? HIS A 109 ? ALA A 261 HIS A 267 AA2 1 GLN A 122 ? ASN A 123 ? GLN A 280 ASN A 281 AA2 2 ILE A 170 ? ASP A 174 ? ILE A 328 ASP A 332 AA2 3 GLN A 178 ? VAL A 184 ? GLN A 336 VAL A 342 AA3 1 LEU A 160 ? ILE A 161 ? LEU A 318 ILE A 319 AA3 2 SER A 191 ? HIS A 192 ? SER A 349 HIS A 350 AA4 1 PHE A 275 ? CYS A 276 ? PHE A 433 CYS A 434 AA4 2 ARG A 287 ? LEU A 288 ? ARG A 445 LEU A 446 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 40 ? N GLU A 198 O TRP A 57 ? O TRP A 215 AA1 2 3 N GLN A 52 ? N GLN A 210 O ILE A 69 ? O ILE A 227 AA1 3 4 N ALA A 66 ? N ALA A 224 O PHE A 117 ? O PHE A 275 AA1 4 5 O CYS A 114 ? O CYS A 272 N PHE A 107 ? N PHE A 265 AA2 1 2 N GLN A 122 ? N GLN A 280 O LEU A 172 ? O LEU A 330 AA2 2 3 N ASP A 174 ? N ASP A 332 O GLN A 178 ? O GLN A 336 AA3 1 2 N ILE A 161 ? N ILE A 319 O SER A 191 ? O SER A 349 AA4 1 2 N CYS A 276 ? N CYS A 434 O ARG A 287 ? O ARG A 445 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 185 ? ? 170.75 147.97 2 1 GLU A 188 ? ? -178.56 82.49 3 1 VAL A 189 ? ? 168.52 148.84 4 1 LEU A 190 ? ? 175.96 168.47 5 1 LEU A 200 ? ? -120.85 -50.87 6 1 GLU A 251 ? ? 77.47 -3.72 7 1 GLU A 255 ? ? 76.81 -9.06 8 1 TYR A 256 ? ? -92.69 31.30 9 1 TYR A 262 ? ? -74.08 -77.91 10 1 PHE A 265 ? ? -165.13 -167.59 11 1 ASN A 269 ? ? 81.77 -19.70 12 1 ALA A 321 ? ? 89.21 -9.20 13 1 ILE A 343 ? ? -150.57 19.86 14 1 LEU A 360 ? ? -150.61 30.48 15 1 CYS A 377 ? ? -116.92 -164.35 16 1 PRO A 400 ? ? -78.85 48.52 17 1 PRO A 418 ? ? -56.75 171.91 18 1 SER A 440 ? ? -110.28 62.76 19 1 ASP A 482 ? ? 59.72 12.34 20 1 MET A 527 ? ? 82.23 17.35 21 1 HIS A 535 ? ? 30.29 54.19 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 201 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 359 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -44.0233 _pdbx_refine_tls.origin_y 13.8086 _pdbx_refine_tls.origin_z -37.6159 _pdbx_refine_tls.T[1][1] 0.8967 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.1426 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0040 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.5862 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0526 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.8150 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.3592 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0101 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.9442 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.7918 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.4464 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.9949 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.1632 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1196 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.2490 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1447 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0608 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0620 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.2903 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1551 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.2688 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 184 ? ? ? A 551 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? A 900 ? ? ? A 900 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? ? B 96 ? ? all # _pdbx_entry_details.entry_id 7O7J _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 159 ? A GLY 1 2 1 Y 1 A ASN 160 ? A ASN 2 3 1 Y 1 A PRO 161 ? A PRO 3 4 1 Y 1 A VAL 162 ? A VAL 4 5 1 Y 1 A THR 163 ? A THR 5 6 1 Y 1 A VAL 164 ? A VAL 6 7 1 Y 1 A VAL 165 ? A VAL 7 8 1 Y 1 A THR 166 ? A THR 8 9 1 Y 1 A ALA 167 ? A ALA 9 10 1 Y 1 A THR 168 ? A THR 10 11 1 Y 1 A THR 169 ? A THR 11 12 1 Y 1 A GLY 170 ? A GLY 12 13 1 Y 1 A SER 171 ? A SER 13 14 1 Y 1 A LYS 172 ? A LYS 14 15 1 Y 1 A GLN 173 ? A GLN 15 16 1 Y 1 A ASN 174 ? A ASN 16 17 1 Y 1 A CYS 175 ? A CYS 17 18 1 Y 1 A THR 176 ? A THR 18 19 1 Y 1 A THR 177 ? A THR 19 20 1 Y 1 A GLY 178 ? A GLY 20 21 1 Y 1 A GLU 179 ? A GLU 21 22 1 Y 1 A GLY 180 ? A GLY 22 23 1 Y 1 A ASP 181 ? A ASP 23 24 1 Y 1 A TYR 182 ? A TYR 24 25 1 Y 1 A GLN 183 ? A GLN 25 26 1 Y 1 A HIS 552 ? A HIS 394 27 1 Y 1 A LEU 553 ? A LEU 395 28 1 Y 1 A ASN 554 ? A ASN 396 29 1 Y 1 A SER 555 ? A SER 397 30 1 Y 1 A CYS 556 ? A CYS 398 31 1 Y 1 A ASP 557 ? A ASP 399 32 1 Y 1 A THR 558 ? A THR 400 33 1 Y 1 A ASN 559 ? A ASN 401 34 1 Y 1 A ASN 560 ? A ASN 402 35 1 Y 1 A HIS 561 ? A HIS 403 36 1 Y 1 A ASN 562 ? A ASN 404 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6ZV C1 C N N 1 6ZV C2 C Y N 2 6ZV C3 C N N 3 6ZV C4 C Y N 4 6ZV C5 C Y N 5 6ZV C6 C Y N 6 6ZV N2 N N N 7 6ZV C10 C Y N 8 6ZV C C Y N 9 6ZV C17 C Y N 10 6ZV C21 C Y N 11 6ZV C12 C Y N 12 6ZV C16 C Y N 13 6ZV C11 C Y N 14 6ZV C19 C Y N 15 6ZV C18 C Y N 16 6ZV C20 C Y N 17 6ZV C8 C Y N 18 6ZV C23 C Y N 19 6ZV C31 C N N 20 6ZV C35 C N N 21 6ZV C32 C N N 22 6ZV C34 C N N 23 6ZV C25 C N N 24 6ZV C27 C N N 25 6ZV C28 C N N 26 6ZV C14 C N N 27 6ZV C26 C N N 28 6ZV N N Y N 29 6ZV N1 N Y N 30 6ZV N24 N Y N 31 6ZV N3 N Y N 32 6ZV N22 N Y N 33 6ZV N30 N N N 34 6ZV N7 N N N 35 6ZV F29 F N N 36 6ZV F15 F N N 37 6ZV H69 H N N 38 6ZV H77 H N N 39 6ZV H78 H N N 40 6ZV H79 H N N 41 6ZV H76 H N N 42 6ZV H42 H N N 43 6ZV H41 H N N 44 6ZV H68 H N N 45 6ZV H39 H N N 46 6ZV H40 H N N 47 6ZV H38 H N N 48 6ZV H44 H N N 49 6ZV H43 H N N 50 6ZV H65 H N N 51 6ZV H66 H N N 52 6ZV H71 H N N 53 6ZV H72 H N N 54 6ZV H74 H N N 55 6ZV H73 H N N 56 6ZV H51 H N N 57 6ZV H52 H N N 58 6ZV H53 H N N 59 6ZV H57 H N N 60 6ZV H58 H N N 61 6ZV H59 H N N 62 6ZV H62 H N N 63 6ZV H60 H N N 64 6ZV H61 H N N 65 6ZV H63 H N N 66 6ZV H64 H N N 67 6ZV H67 H N N 68 6ZV H70 H N N 69 ALA N N N N 70 ALA CA C N S 71 ALA C C N N 72 ALA O O N N 73 ALA CB C N N 74 ALA OXT O N N 75 ALA H H N N 76 ALA H2 H N N 77 ALA HA H N N 78 ALA HB1 H N N 79 ALA HB2 H N N 80 ALA HB3 H N N 81 ALA HXT H N N 82 ARG N N N N 83 ARG CA C N S 84 ARG C C N N 85 ARG O O N N 86 ARG CB C N N 87 ARG CG C N N 88 ARG CD C N N 89 ARG NE N N N 90 ARG CZ C N N 91 ARG NH1 N N N 92 ARG NH2 N N N 93 ARG OXT O N N 94 ARG H H N N 95 ARG H2 H N N 96 ARG HA H N N 97 ARG HB2 H N N 98 ARG HB3 H N N 99 ARG HG2 H N N 100 ARG HG3 H N N 101 ARG HD2 H N N 102 ARG HD3 H N N 103 ARG HE H N N 104 ARG HH11 H N N 105 ARG HH12 H N N 106 ARG HH21 H N N 107 ARG HH22 H N N 108 ARG HXT H N N 109 ASN N N N N 110 ASN CA C N S 111 ASN C C N N 112 ASN O O N N 113 ASN CB C N N 114 ASN CG C N N 115 ASN OD1 O N N 116 ASN ND2 N N N 117 ASN OXT O N N 118 ASN H H N N 119 ASN H2 H N N 120 ASN HA H N N 121 ASN HB2 H N N 122 ASN HB3 H N N 123 ASN HD21 H N N 124 ASN HD22 H N N 125 ASN HXT H N N 126 ASP N N N N 127 ASP CA C N S 128 ASP C C N N 129 ASP O O N N 130 ASP CB C N N 131 ASP CG C N N 132 ASP OD1 O N N 133 ASP OD2 O N N 134 ASP OXT O N N 135 ASP H H N N 136 ASP H2 H N N 137 ASP HA H N N 138 ASP HB2 H N N 139 ASP HB3 H N N 140 ASP HD2 H N N 141 ASP HXT H N N 142 CYS N N N N 143 CYS CA C N R 144 CYS C C N N 145 CYS O O N N 146 CYS CB C N N 147 CYS SG S N N 148 CYS OXT O N N 149 CYS H H N N 150 CYS H2 H N N 151 CYS HA H N N 152 CYS HB2 H N N 153 CYS HB3 H N N 154 CYS HG H N N 155 CYS HXT H N N 156 GLN N N N N 157 GLN CA C N S 158 GLN C C N N 159 GLN O O N N 160 GLN CB C N N 161 GLN CG C N N 162 GLN CD C N N 163 GLN OE1 O N N 164 GLN NE2 N N N 165 GLN OXT O N N 166 GLN H H N N 167 GLN H2 H N N 168 GLN HA H N N 169 GLN HB2 H N N 170 GLN HB3 H N N 171 GLN HG2 H N N 172 GLN HG3 H N N 173 GLN HE21 H N N 174 GLN HE22 H N N 175 GLN HXT H N N 176 GLU N N N N 177 GLU CA C N S 178 GLU C C N N 179 GLU O O N N 180 GLU CB C N N 181 GLU CG C N N 182 GLU CD C N N 183 GLU OE1 O N N 184 GLU OE2 O N N 185 GLU OXT O N N 186 GLU H H N N 187 GLU H2 H N N 188 GLU HA H N N 189 GLU HB2 H N N 190 GLU HB3 H N N 191 GLU HG2 H N N 192 GLU HG3 H N N 193 GLU HE2 H N N 194 GLU HXT H N N 195 GLY N N N N 196 GLY CA C N N 197 GLY C C N N 198 GLY O O N N 199 GLY OXT O N N 200 GLY H H N N 201 GLY H2 H N N 202 GLY HA2 H N N 203 GLY HA3 H N N 204 GLY HXT H N N 205 HIS N N N N 206 HIS CA C N S 207 HIS C C N N 208 HIS O O N N 209 HIS CB C N N 210 HIS CG C Y N 211 HIS ND1 N Y N 212 HIS CD2 C Y N 213 HIS CE1 C Y N 214 HIS NE2 N Y N 215 HIS OXT O N N 216 HIS H H N N 217 HIS H2 H N N 218 HIS HA H N N 219 HIS HB2 H N N 220 HIS HB3 H N N 221 HIS HD1 H N N 222 HIS HD2 H N N 223 HIS HE1 H N N 224 HIS HE2 H N N 225 HIS HXT H N N 226 HOH O O N N 227 HOH H1 H N N 228 HOH H2 H N N 229 ILE N N N N 230 ILE CA C N S 231 ILE C C N N 232 ILE O O N N 233 ILE CB C N S 234 ILE CG1 C N N 235 ILE CG2 C N N 236 ILE CD1 C N N 237 ILE OXT O N N 238 ILE H H N N 239 ILE H2 H N N 240 ILE HA H N N 241 ILE HB H N N 242 ILE HG12 H N N 243 ILE HG13 H N N 244 ILE HG21 H N N 245 ILE HG22 H N N 246 ILE HG23 H N N 247 ILE HD11 H N N 248 ILE HD12 H N N 249 ILE HD13 H N N 250 ILE HXT H N N 251 LEU N N N N 252 LEU CA C N S 253 LEU C C N N 254 LEU O O N N 255 LEU CB C N N 256 LEU CG C N N 257 LEU CD1 C N N 258 LEU CD2 C N N 259 LEU OXT O N N 260 LEU H H N N 261 LEU H2 H N N 262 LEU HA H N N 263 LEU HB2 H N N 264 LEU HB3 H N N 265 LEU HG H N N 266 LEU HD11 H N N 267 LEU HD12 H N N 268 LEU HD13 H N N 269 LEU HD21 H N N 270 LEU HD22 H N N 271 LEU HD23 H N N 272 LEU HXT H N N 273 LYS N N N N 274 LYS CA C N S 275 LYS C C N N 276 LYS O O N N 277 LYS CB C N N 278 LYS CG C N N 279 LYS CD C N N 280 LYS CE C N N 281 LYS NZ N N N 282 LYS OXT O N N 283 LYS H H N N 284 LYS H2 H N N 285 LYS HA H N N 286 LYS HB2 H N N 287 LYS HB3 H N N 288 LYS HG2 H N N 289 LYS HG3 H N N 290 LYS HD2 H N N 291 LYS HD3 H N N 292 LYS HE2 H N N 293 LYS HE3 H N N 294 LYS HZ1 H N N 295 LYS HZ2 H N N 296 LYS HZ3 H N N 297 LYS HXT H N N 298 MET N N N N 299 MET CA C N S 300 MET C C N N 301 MET O O N N 302 MET CB C N N 303 MET CG C N N 304 MET SD S N N 305 MET CE C N N 306 MET OXT O N N 307 MET H H N N 308 MET H2 H N N 309 MET HA H N N 310 MET HB2 H N N 311 MET HB3 H N N 312 MET HG2 H N N 313 MET HG3 H N N 314 MET HE1 H N N 315 MET HE2 H N N 316 MET HE3 H N N 317 MET HXT H N N 318 PHE N N N N 319 PHE CA C N S 320 PHE C C N N 321 PHE O O N N 322 PHE CB C N N 323 PHE CG C Y N 324 PHE CD1 C Y N 325 PHE CD2 C Y N 326 PHE CE1 C Y N 327 PHE CE2 C Y N 328 PHE CZ C Y N 329 PHE OXT O N N 330 PHE H H N N 331 PHE H2 H N N 332 PHE HA H N N 333 PHE HB2 H N N 334 PHE HB3 H N N 335 PHE HD1 H N N 336 PHE HD2 H N N 337 PHE HE1 H N N 338 PHE HE2 H N N 339 PHE HZ H N N 340 PHE HXT H N N 341 PRO N N N N 342 PRO CA C N S 343 PRO C C N N 344 PRO O O N N 345 PRO CB C N N 346 PRO CG C N N 347 PRO CD C N N 348 PRO OXT O N N 349 PRO H H N N 350 PRO HA H N N 351 PRO HB2 H N N 352 PRO HB3 H N N 353 PRO HG2 H N N 354 PRO HG3 H N N 355 PRO HD2 H N N 356 PRO HD3 H N N 357 PRO HXT H N N 358 PTR N N N N 359 PTR CA C N S 360 PTR C C N N 361 PTR O O N N 362 PTR OXT O N N 363 PTR CB C N N 364 PTR CG C Y N 365 PTR CD1 C Y N 366 PTR CD2 C Y N 367 PTR CE1 C Y N 368 PTR CE2 C Y N 369 PTR CZ C Y N 370 PTR OH O N N 371 PTR P P N N 372 PTR O1P O N N 373 PTR O2P O N N 374 PTR O3P O N N 375 PTR H H N N 376 PTR H2 H N N 377 PTR HA H N N 378 PTR HXT H N N 379 PTR HB2 H N N 380 PTR HB3 H N N 381 PTR HD1 H N N 382 PTR HD2 H N N 383 PTR HE1 H N N 384 PTR HE2 H N N 385 PTR HO2P H N N 386 PTR HO3P H N N 387 SER N N N N 388 SER CA C N S 389 SER C C N N 390 SER O O N N 391 SER CB C N N 392 SER OG O N N 393 SER OXT O N N 394 SER H H N N 395 SER H2 H N N 396 SER HA H N N 397 SER HB2 H N N 398 SER HB3 H N N 399 SER HG H N N 400 SER HXT H N N 401 THR N N N N 402 THR CA C N S 403 THR C C N N 404 THR O O N N 405 THR CB C N R 406 THR OG1 O N N 407 THR CG2 C N N 408 THR OXT O N N 409 THR H H N N 410 THR H2 H N N 411 THR HA H N N 412 THR HB H N N 413 THR HG1 H N N 414 THR HG21 H N N 415 THR HG22 H N N 416 THR HG23 H N N 417 THR HXT H N N 418 TRP N N N N 419 TRP CA C N S 420 TRP C C N N 421 TRP O O N N 422 TRP CB C N N 423 TRP CG C Y N 424 TRP CD1 C Y N 425 TRP CD2 C Y N 426 TRP NE1 N Y N 427 TRP CE2 C Y N 428 TRP CE3 C Y N 429 TRP CZ2 C Y N 430 TRP CZ3 C Y N 431 TRP CH2 C Y N 432 TRP OXT O N N 433 TRP H H N N 434 TRP H2 H N N 435 TRP HA H N N 436 TRP HB2 H N N 437 TRP HB3 H N N 438 TRP HD1 H N N 439 TRP HE1 H N N 440 TRP HE3 H N N 441 TRP HZ2 H N N 442 TRP HZ3 H N N 443 TRP HH2 H N N 444 TRP HXT H N N 445 TYR N N N N 446 TYR CA C N S 447 TYR C C N N 448 TYR O O N N 449 TYR CB C N N 450 TYR CG C Y N 451 TYR CD1 C Y N 452 TYR CD2 C Y N 453 TYR CE1 C Y N 454 TYR CE2 C Y N 455 TYR CZ C Y N 456 TYR OH O N N 457 TYR OXT O N N 458 TYR H H N N 459 TYR H2 H N N 460 TYR HA H N N 461 TYR HB2 H N N 462 TYR HB3 H N N 463 TYR HD1 H N N 464 TYR HD2 H N N 465 TYR HE1 H N N 466 TYR HE2 H N N 467 TYR HH H N N 468 TYR HXT H N N 469 VAL N N N N 470 VAL CA C N S 471 VAL C C N N 472 VAL O O N N 473 VAL CB C N N 474 VAL CG1 C N N 475 VAL CG2 C N N 476 VAL OXT O N N 477 VAL H H N N 478 VAL H2 H N N 479 VAL HA H N N 480 VAL HB H N N 481 VAL HG11 H N N 482 VAL HG12 H N N 483 VAL HG13 H N N 484 VAL HG21 H N N 485 VAL HG22 H N N 486 VAL HG23 H N N 487 VAL HXT H N N 488 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6ZV C32 N2 sing N N 1 6ZV C32 C31 sing N N 2 6ZV N2 C34 sing N N 3 6ZV N2 C1 sing N N 4 6ZV C31 N30 sing N N 5 6ZV C34 C35 sing N N 6 6ZV N30 C35 sing N N 7 6ZV N30 C14 sing N N 8 6ZV C1 C3 sing N N 9 6ZV C12 N doub Y N 10 6ZV C12 C11 sing Y N 11 6ZV N C8 sing Y N 12 6ZV C14 C11 sing N N 13 6ZV C11 C10 doub Y N 14 6ZV C8 N7 sing N N 15 6ZV C8 C doub Y N 16 6ZV N7 C2 sing N N 17 6ZV C10 C sing Y N 18 6ZV N1 C2 doub Y N 19 6ZV N1 C6 sing Y N 20 6ZV C2 N3 sing Y N 21 6ZV C6 C5 doub Y N 22 6ZV N3 C4 doub Y N 23 6ZV C4 C5 sing Y N 24 6ZV C4 C16 sing N N 25 6ZV C5 F15 sing N N 26 6ZV C28 C26 sing N N 27 6ZV C27 C26 sing N N 28 6ZV C17 C16 doub Y N 29 6ZV C17 C18 sing Y N 30 6ZV C16 C21 sing Y N 31 6ZV C26 N22 sing N N 32 6ZV C18 N22 sing Y N 33 6ZV C18 C19 doub Y N 34 6ZV C21 C20 doub Y N 35 6ZV N22 C23 sing Y N 36 6ZV C20 C19 sing Y N 37 6ZV C20 F29 sing N N 38 6ZV C19 N24 sing Y N 39 6ZV C23 N24 doub Y N 40 6ZV C23 C25 sing N N 41 6ZV C1 H69 sing N N 42 6ZV C1 H77 sing N N 43 6ZV C3 H78 sing N N 44 6ZV C3 H79 sing N N 45 6ZV C3 H76 sing N N 46 6ZV C6 H42 sing N N 47 6ZV C10 H41 sing N N 48 6ZV C H68 sing N N 49 6ZV C17 H39 sing N N 50 6ZV C21 H40 sing N N 51 6ZV C12 H38 sing N N 52 6ZV C31 H44 sing N N 53 6ZV C31 H43 sing N N 54 6ZV C35 H65 sing N N 55 6ZV C35 H66 sing N N 56 6ZV C32 H71 sing N N 57 6ZV C32 H72 sing N N 58 6ZV C34 H74 sing N N 59 6ZV C34 H73 sing N N 60 6ZV C25 H51 sing N N 61 6ZV C25 H52 sing N N 62 6ZV C25 H53 sing N N 63 6ZV C27 H57 sing N N 64 6ZV C27 H58 sing N N 65 6ZV C27 H59 sing N N 66 6ZV C28 H62 sing N N 67 6ZV C28 H60 sing N N 68 6ZV C28 H61 sing N N 69 6ZV C14 H63 sing N N 70 6ZV C14 H64 sing N N 71 6ZV C26 H67 sing N N 72 6ZV N7 H70 sing N N 73 ALA N CA sing N N 74 ALA N H sing N N 75 ALA N H2 sing N N 76 ALA CA C sing N N 77 ALA CA CB sing N N 78 ALA CA HA sing N N 79 ALA C O doub N N 80 ALA C OXT sing N N 81 ALA CB HB1 sing N N 82 ALA CB HB2 sing N N 83 ALA CB HB3 sing N N 84 ALA OXT HXT sing N N 85 ARG N CA sing N N 86 ARG N H sing N N 87 ARG N H2 sing N N 88 ARG CA C sing N N 89 ARG CA CB sing N N 90 ARG CA HA sing N N 91 ARG C O doub N N 92 ARG C OXT sing N N 93 ARG CB CG sing N N 94 ARG CB HB2 sing N N 95 ARG CB HB3 sing N N 96 ARG CG CD sing N N 97 ARG CG HG2 sing N N 98 ARG CG HG3 sing N N 99 ARG CD NE sing N N 100 ARG CD HD2 sing N N 101 ARG CD HD3 sing N N 102 ARG NE CZ sing N N 103 ARG NE HE sing N N 104 ARG CZ NH1 sing N N 105 ARG CZ NH2 doub N N 106 ARG NH1 HH11 sing N N 107 ARG NH1 HH12 sing N N 108 ARG NH2 HH21 sing N N 109 ARG NH2 HH22 sing N N 110 ARG OXT HXT sing N N 111 ASN N CA sing N N 112 ASN N H sing N N 113 ASN N H2 sing N N 114 ASN CA C sing N N 115 ASN CA CB sing N N 116 ASN CA HA sing N N 117 ASN C O doub N N 118 ASN C OXT sing N N 119 ASN CB CG sing N N 120 ASN CB HB2 sing N N 121 ASN CB HB3 sing N N 122 ASN CG OD1 doub N N 123 ASN CG ND2 sing N N 124 ASN ND2 HD21 sing N N 125 ASN ND2 HD22 sing N N 126 ASN OXT HXT sing N N 127 ASP N CA sing N N 128 ASP N H sing N N 129 ASP N H2 sing N N 130 ASP CA C sing N N 131 ASP CA CB sing N N 132 ASP CA HA sing N N 133 ASP C O doub N N 134 ASP C OXT sing N N 135 ASP CB CG sing N N 136 ASP CB HB2 sing N N 137 ASP CB HB3 sing N N 138 ASP CG OD1 doub N N 139 ASP CG OD2 sing N N 140 ASP OD2 HD2 sing N N 141 ASP OXT HXT sing N N 142 CYS N CA sing N N 143 CYS N H sing N N 144 CYS N H2 sing N N 145 CYS CA C sing N N 146 CYS CA CB sing N N 147 CYS CA HA sing N N 148 CYS C O doub N N 149 CYS C OXT sing N N 150 CYS CB SG sing N N 151 CYS CB HB2 sing N N 152 CYS CB HB3 sing N N 153 CYS SG HG sing N N 154 CYS OXT HXT sing N N 155 GLN N CA sing N N 156 GLN N H sing N N 157 GLN N H2 sing N N 158 GLN CA C sing N N 159 GLN CA CB sing N N 160 GLN CA HA sing N N 161 GLN C O doub N N 162 GLN C OXT sing N N 163 GLN CB CG sing N N 164 GLN CB HB2 sing N N 165 GLN CB HB3 sing N N 166 GLN CG CD sing N N 167 GLN CG HG2 sing N N 168 GLN CG HG3 sing N N 169 GLN CD OE1 doub N N 170 GLN CD NE2 sing N N 171 GLN NE2 HE21 sing N N 172 GLN NE2 HE22 sing N N 173 GLN OXT HXT sing N N 174 GLU N CA sing N N 175 GLU N H sing N N 176 GLU N H2 sing N N 177 GLU CA C sing N N 178 GLU CA CB sing N N 179 GLU CA HA sing N N 180 GLU C O doub N N 181 GLU C OXT sing N N 182 GLU CB CG sing N N 183 GLU CB HB2 sing N N 184 GLU CB HB3 sing N N 185 GLU CG CD sing N N 186 GLU CG HG2 sing N N 187 GLU CG HG3 sing N N 188 GLU CD OE1 doub N N 189 GLU CD OE2 sing N N 190 GLU OE2 HE2 sing N N 191 GLU OXT HXT sing N N 192 GLY N CA sing N N 193 GLY N H sing N N 194 GLY N H2 sing N N 195 GLY CA C sing N N 196 GLY CA HA2 sing N N 197 GLY CA HA3 sing N N 198 GLY C O doub N N 199 GLY C OXT sing N N 200 GLY OXT HXT sing N N 201 HIS N CA sing N N 202 HIS N H sing N N 203 HIS N H2 sing N N 204 HIS CA C sing N N 205 HIS CA CB sing N N 206 HIS CA HA sing N N 207 HIS C O doub N N 208 HIS C OXT sing N N 209 HIS CB CG sing N N 210 HIS CB HB2 sing N N 211 HIS CB HB3 sing N N 212 HIS CG ND1 sing Y N 213 HIS CG CD2 doub Y N 214 HIS ND1 CE1 doub Y N 215 HIS ND1 HD1 sing N N 216 HIS CD2 NE2 sing Y N 217 HIS CD2 HD2 sing N N 218 HIS CE1 NE2 sing Y N 219 HIS CE1 HE1 sing N N 220 HIS NE2 HE2 sing N N 221 HIS OXT HXT sing N N 222 HOH O H1 sing N N 223 HOH O H2 sing N N 224 ILE N CA sing N N 225 ILE N H sing N N 226 ILE N H2 sing N N 227 ILE CA C sing N N 228 ILE CA CB sing N N 229 ILE CA HA sing N N 230 ILE C O doub N N 231 ILE C OXT sing N N 232 ILE CB CG1 sing N N 233 ILE CB CG2 sing N N 234 ILE CB HB sing N N 235 ILE CG1 CD1 sing N N 236 ILE CG1 HG12 sing N N 237 ILE CG1 HG13 sing N N 238 ILE CG2 HG21 sing N N 239 ILE CG2 HG22 sing N N 240 ILE CG2 HG23 sing N N 241 ILE CD1 HD11 sing N N 242 ILE CD1 HD12 sing N N 243 ILE CD1 HD13 sing N N 244 ILE OXT HXT sing N N 245 LEU N CA sing N N 246 LEU N H sing N N 247 LEU N H2 sing N N 248 LEU CA C sing N N 249 LEU CA CB sing N N 250 LEU CA HA sing N N 251 LEU C O doub N N 252 LEU C OXT sing N N 253 LEU CB CG sing N N 254 LEU CB HB2 sing N N 255 LEU CB HB3 sing N N 256 LEU CG CD1 sing N N 257 LEU CG CD2 sing N N 258 LEU CG HG sing N N 259 LEU CD1 HD11 sing N N 260 LEU CD1 HD12 sing N N 261 LEU CD1 HD13 sing N N 262 LEU CD2 HD21 sing N N 263 LEU CD2 HD22 sing N N 264 LEU CD2 HD23 sing N N 265 LEU OXT HXT sing N N 266 LYS N CA sing N N 267 LYS N H sing N N 268 LYS N H2 sing N N 269 LYS CA C sing N N 270 LYS CA CB sing N N 271 LYS CA HA sing N N 272 LYS C O doub N N 273 LYS C OXT sing N N 274 LYS CB CG sing N N 275 LYS CB HB2 sing N N 276 LYS CB HB3 sing N N 277 LYS CG CD sing N N 278 LYS CG HG2 sing N N 279 LYS CG HG3 sing N N 280 LYS CD CE sing N N 281 LYS CD HD2 sing N N 282 LYS CD HD3 sing N N 283 LYS CE NZ sing N N 284 LYS CE HE2 sing N N 285 LYS CE HE3 sing N N 286 LYS NZ HZ1 sing N N 287 LYS NZ HZ2 sing N N 288 LYS NZ HZ3 sing N N 289 LYS OXT HXT sing N N 290 MET N CA sing N N 291 MET N H sing N N 292 MET N H2 sing N N 293 MET CA C sing N N 294 MET CA CB sing N N 295 MET CA HA sing N N 296 MET C O doub N N 297 MET C OXT sing N N 298 MET CB CG sing N N 299 MET CB HB2 sing N N 300 MET CB HB3 sing N N 301 MET CG SD sing N N 302 MET CG HG2 sing N N 303 MET CG HG3 sing N N 304 MET SD CE sing N N 305 MET CE HE1 sing N N 306 MET CE HE2 sing N N 307 MET CE HE3 sing N N 308 MET OXT HXT sing N N 309 PHE N CA sing N N 310 PHE N H sing N N 311 PHE N H2 sing N N 312 PHE CA C sing N N 313 PHE CA CB sing N N 314 PHE CA HA sing N N 315 PHE C O doub N N 316 PHE C OXT sing N N 317 PHE CB CG sing N N 318 PHE CB HB2 sing N N 319 PHE CB HB3 sing N N 320 PHE CG CD1 doub Y N 321 PHE CG CD2 sing Y N 322 PHE CD1 CE1 sing Y N 323 PHE CD1 HD1 sing N N 324 PHE CD2 CE2 doub Y N 325 PHE CD2 HD2 sing N N 326 PHE CE1 CZ doub Y N 327 PHE CE1 HE1 sing N N 328 PHE CE2 CZ sing Y N 329 PHE CE2 HE2 sing N N 330 PHE CZ HZ sing N N 331 PHE OXT HXT sing N N 332 PRO N CA sing N N 333 PRO N CD sing N N 334 PRO N H sing N N 335 PRO CA C sing N N 336 PRO CA CB sing N N 337 PRO CA HA sing N N 338 PRO C O doub N N 339 PRO C OXT sing N N 340 PRO CB CG sing N N 341 PRO CB HB2 sing N N 342 PRO CB HB3 sing N N 343 PRO CG CD sing N N 344 PRO CG HG2 sing N N 345 PRO CG HG3 sing N N 346 PRO CD HD2 sing N N 347 PRO CD HD3 sing N N 348 PRO OXT HXT sing N N 349 PTR N CA sing N N 350 PTR N H sing N N 351 PTR N H2 sing N N 352 PTR CA C sing N N 353 PTR CA CB sing N N 354 PTR CA HA sing N N 355 PTR C O doub N N 356 PTR C OXT sing N N 357 PTR OXT HXT sing N N 358 PTR CB CG sing N N 359 PTR CB HB2 sing N N 360 PTR CB HB3 sing N N 361 PTR CG CD1 doub Y N 362 PTR CG CD2 sing Y N 363 PTR CD1 CE1 sing Y N 364 PTR CD1 HD1 sing N N 365 PTR CD2 CE2 doub Y N 366 PTR CD2 HD2 sing N N 367 PTR CE1 CZ doub Y N 368 PTR CE1 HE1 sing N N 369 PTR CE2 CZ sing Y N 370 PTR CE2 HE2 sing N N 371 PTR CZ OH sing N N 372 PTR OH P sing N N 373 PTR P O1P doub N N 374 PTR P O2P sing N N 375 PTR P O3P sing N N 376 PTR O2P HO2P sing N N 377 PTR O3P HO3P sing N N 378 SER N CA sing N N 379 SER N H sing N N 380 SER N H2 sing N N 381 SER CA C sing N N 382 SER CA CB sing N N 383 SER CA HA sing N N 384 SER C O doub N N 385 SER C OXT sing N N 386 SER CB OG sing N N 387 SER CB HB2 sing N N 388 SER CB HB3 sing N N 389 SER OG HG sing N N 390 SER OXT HXT sing N N 391 THR N CA sing N N 392 THR N H sing N N 393 THR N H2 sing N N 394 THR CA C sing N N 395 THR CA CB sing N N 396 THR CA HA sing N N 397 THR C O doub N N 398 THR C OXT sing N N 399 THR CB OG1 sing N N 400 THR CB CG2 sing N N 401 THR CB HB sing N N 402 THR OG1 HG1 sing N N 403 THR CG2 HG21 sing N N 404 THR CG2 HG22 sing N N 405 THR CG2 HG23 sing N N 406 THR OXT HXT sing N N 407 TRP N CA sing N N 408 TRP N H sing N N 409 TRP N H2 sing N N 410 TRP CA C sing N N 411 TRP CA CB sing N N 412 TRP CA HA sing N N 413 TRP C O doub N N 414 TRP C OXT sing N N 415 TRP CB CG sing N N 416 TRP CB HB2 sing N N 417 TRP CB HB3 sing N N 418 TRP CG CD1 doub Y N 419 TRP CG CD2 sing Y N 420 TRP CD1 NE1 sing Y N 421 TRP CD1 HD1 sing N N 422 TRP CD2 CE2 doub Y N 423 TRP CD2 CE3 sing Y N 424 TRP NE1 CE2 sing Y N 425 TRP NE1 HE1 sing N N 426 TRP CE2 CZ2 sing Y N 427 TRP CE3 CZ3 doub Y N 428 TRP CE3 HE3 sing N N 429 TRP CZ2 CH2 doub Y N 430 TRP CZ2 HZ2 sing N N 431 TRP CZ3 CH2 sing Y N 432 TRP CZ3 HZ3 sing N N 433 TRP CH2 HH2 sing N N 434 TRP OXT HXT sing N N 435 TYR N CA sing N N 436 TYR N H sing N N 437 TYR N H2 sing N N 438 TYR CA C sing N N 439 TYR CA CB sing N N 440 TYR CA HA sing N N 441 TYR C O doub N N 442 TYR C OXT sing N N 443 TYR CB CG sing N N 444 TYR CB HB2 sing N N 445 TYR CB HB3 sing N N 446 TYR CG CD1 doub Y N 447 TYR CG CD2 sing Y N 448 TYR CD1 CE1 sing Y N 449 TYR CD1 HD1 sing N N 450 TYR CD2 CE2 doub Y N 451 TYR CD2 HD2 sing N N 452 TYR CE1 CZ doub Y N 453 TYR CE1 HE1 sing N N 454 TYR CE2 CZ sing Y N 455 TYR CE2 HE2 sing N N 456 TYR CZ OH sing N N 457 TYR OH HH sing N N 458 TYR OXT HXT sing N N 459 VAL N CA sing N N 460 VAL N H sing N N 461 VAL N H2 sing N N 462 VAL CA C sing N N 463 VAL CA CB sing N N 464 VAL CA HA sing N N 465 VAL C O doub N N 466 VAL C OXT sing N N 467 VAL CB CG1 sing N N 468 VAL CB CG2 sing N N 469 VAL CB HB sing N N 470 VAL CG1 HG11 sing N N 471 VAL CG1 HG12 sing N N 472 VAL CG1 HG13 sing N N 473 VAL CG2 HG21 sing N N 474 VAL CG2 HG22 sing N N 475 VAL CG2 HG23 sing N N 476 VAL OXT HXT sing N N 477 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'GE 976/9-2' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 6ZV ? ? 6ZV ? ? 'SUBJECT OF INVESTIGATION' ? 2 PTR ? ? PTR ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details HIPK3 # _atom_sites.entry_id 7O7J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012336 _atom_sites.fract_transf_matrix[1][2] 0.007122 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014244 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005592 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F H N O P S # loop_