data_7O9I # _entry.id 7O9I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7O9I pdb_00007o9i 10.2210/pdb7o9i/pdb WWPDB D_1292115298 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-02 2 'Structure model' 1 1 2022-03-09 3 'Structure model' 2 0 2023-09-27 4 'Structure model' 2 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Non-polymer description' 7 3 'Structure model' 'Structure summary' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' chem_comp 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' entity 8 3 'Structure model' pdbx_entity_instance_feature 9 3 'Structure model' pdbx_entity_nonpoly 10 3 'Structure model' pdbx_nonpoly_scheme 11 3 'Structure model' struct_site 12 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 3 'Structure model' '_atom_site.auth_comp_id' 8 3 'Structure model' '_atom_site.label_comp_id' 9 3 'Structure model' '_chem_comp.formula' 10 3 'Structure model' '_chem_comp.formula_weight' 11 3 'Structure model' '_chem_comp.id' 12 3 'Structure model' '_chem_comp.mon_nstd_flag' 13 3 'Structure model' '_chem_comp.name' 14 3 'Structure model' '_chem_comp.type' 15 3 'Structure model' '_entity.pdbx_description' 16 3 'Structure model' '_pdbx_entity_instance_feature.auth_comp_id' 17 3 'Structure model' '_pdbx_entity_instance_feature.comp_id' 18 3 'Structure model' '_pdbx_entity_nonpoly.comp_id' 19 3 'Structure model' '_pdbx_entity_nonpoly.name' 20 3 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 21 3 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 22 3 'Structure model' '_struct_site.details' 23 3 'Structure model' '_struct_site.pdbx_auth_comp_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7O9I _pdbx_database_status.recvd_initial_deposition_date 2021-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Czech, L.' 1 0000-0001-7398-1186 'Mais, C.-N.' 2 0000-0003-1927-2885 'Bange, G.' 3 0000-0002-7826-0932 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 1069 _citation.page_last 1069 _citation.title 'Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-022-28675-0 _citation.pdbx_database_id_PubMed 35217658 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Czech, L.' 1 0000-0001-7398-1186 primary 'Mais, C.N.' 2 0000-0003-1927-2885 primary 'Kratzat, H.' 3 0000-0001-5849-6131 primary 'Sarmah, P.' 4 ? primary 'Giammarinaro, P.' 5 ? primary 'Freibert, S.A.' 6 0000-0002-8521-2963 primary 'Esser, H.F.' 7 ? primary 'Musial, J.' 8 ? primary 'Berninghausen, O.' 9 0000-0002-9255-0522 primary 'Steinchen, W.' 10 ? primary 'Beckmann, R.' 11 0000-0003-4291-3898 primary 'Koch, H.G.' 12 0000-0001-5913-0334 primary 'Bange, G.' 13 0000-0002-7826-0932 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Signal recognition particle protein' 33395.465 1 ? ? ? ? 2 non-polymer syn ;guanosine 5'-(tetrahydrogen triphosphate) 3'-(trihydrogen diphosphate) ; 683.140 1 ? ? ? ? 3 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Fifty-four homolog,Ffh,p48' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVR NELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDF FPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEA LPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVR NELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDF FPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEA LPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;guanosine 5'-(tetrahydrogen triphosphate) 3'-(trihydrogen diphosphate) ; 0O2 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 PHE n 1 4 ASP n 1 5 ASN n 1 6 LEU n 1 7 THR n 1 8 ASP n 1 9 ARG n 1 10 LEU n 1 11 SER n 1 12 ARG n 1 13 THR n 1 14 LEU n 1 15 ARG n 1 16 ASN n 1 17 ILE n 1 18 SER n 1 19 GLY n 1 20 ARG n 1 21 GLY n 1 22 ARG n 1 23 LEU n 1 24 THR n 1 25 GLU n 1 26 ASP n 1 27 ASN n 1 28 VAL n 1 29 LYS n 1 30 ASP n 1 31 THR n 1 32 LEU n 1 33 ARG n 1 34 GLU n 1 35 VAL n 1 36 ARG n 1 37 MET n 1 38 ALA n 1 39 LEU n 1 40 LEU n 1 41 GLU n 1 42 ALA n 1 43 ASP n 1 44 VAL n 1 45 ALA n 1 46 LEU n 1 47 PRO n 1 48 VAL n 1 49 VAL n 1 50 ARG n 1 51 GLU n 1 52 PHE n 1 53 ILE n 1 54 ASN n 1 55 ARG n 1 56 VAL n 1 57 LYS n 1 58 GLU n 1 59 LYS n 1 60 ALA n 1 61 VAL n 1 62 GLY n 1 63 HIS n 1 64 GLU n 1 65 VAL n 1 66 ASN n 1 67 LYS n 1 68 SER n 1 69 LEU n 1 70 THR n 1 71 PRO n 1 72 GLY n 1 73 GLN n 1 74 GLU n 1 75 PHE n 1 76 VAL n 1 77 LYS n 1 78 ILE n 1 79 VAL n 1 80 ARG n 1 81 ASN n 1 82 GLU n 1 83 LEU n 1 84 VAL n 1 85 ALA n 1 86 ALA n 1 87 MET n 1 88 GLY n 1 89 GLU n 1 90 GLU n 1 91 ASN n 1 92 GLN n 1 93 THR n 1 94 LEU n 1 95 ASN n 1 96 LEU n 1 97 ALA n 1 98 ALA n 1 99 GLN n 1 100 PRO n 1 101 PRO n 1 102 ALA n 1 103 VAL n 1 104 VAL n 1 105 LEU n 1 106 MET n 1 107 ALA n 1 108 GLY n 1 109 LEU n 1 110 GLN n 1 111 GLY n 1 112 ALA n 1 113 GLY n 1 114 LYS n 1 115 THR n 1 116 THR n 1 117 SER n 1 118 VAL n 1 119 GLY n 1 120 LYS n 1 121 LEU n 1 122 GLY n 1 123 LYS n 1 124 PHE n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 LYS n 1 129 HIS n 1 130 LYS n 1 131 LYS n 1 132 LYS n 1 133 VAL n 1 134 LEU n 1 135 VAL n 1 136 VAL n 1 137 SER n 1 138 ALA n 1 139 ASP n 1 140 VAL n 1 141 TYR n 1 142 ARG n 1 143 PRO n 1 144 ALA n 1 145 ALA n 1 146 ILE n 1 147 LYS n 1 148 GLN n 1 149 LEU n 1 150 GLU n 1 151 THR n 1 152 LEU n 1 153 ALA n 1 154 GLU n 1 155 GLN n 1 156 VAL n 1 157 GLY n 1 158 VAL n 1 159 ASP n 1 160 PHE n 1 161 PHE n 1 162 PRO n 1 163 SER n 1 164 ASP n 1 165 VAL n 1 166 GLY n 1 167 GLN n 1 168 LYS n 1 169 PRO n 1 170 VAL n 1 171 ASP n 1 172 ILE n 1 173 VAL n 1 174 ASN n 1 175 ALA n 1 176 ALA n 1 177 LEU n 1 178 LYS n 1 179 GLU n 1 180 ALA n 1 181 LYS n 1 182 LEU n 1 183 LYS n 1 184 PHE n 1 185 TYR n 1 186 ASP n 1 187 VAL n 1 188 LEU n 1 189 LEU n 1 190 VAL n 1 191 ASP n 1 192 THR n 1 193 ALA n 1 194 GLY n 1 195 ARG n 1 196 LEU n 1 197 HIS n 1 198 VAL n 1 199 ASP n 1 200 GLU n 1 201 ALA n 1 202 MET n 1 203 MET n 1 204 ASP n 1 205 GLU n 1 206 ILE n 1 207 LYS n 1 208 GLN n 1 209 VAL n 1 210 HIS n 1 211 ALA n 1 212 SER n 1 213 ILE n 1 214 ASN n 1 215 PRO n 1 216 VAL n 1 217 GLU n 1 218 THR n 1 219 LEU n 1 220 PHE n 1 221 VAL n 1 222 VAL n 1 223 ASP n 1 224 ALA n 1 225 MET n 1 226 THR n 1 227 GLY n 1 228 GLN n 1 229 ASP n 1 230 ALA n 1 231 ALA n 1 232 ASN n 1 233 THR n 1 234 ALA n 1 235 LYS n 1 236 ALA n 1 237 PHE n 1 238 ASN n 1 239 GLU n 1 240 ALA n 1 241 LEU n 1 242 PRO n 1 243 LEU n 1 244 THR n 1 245 GLY n 1 246 VAL n 1 247 VAL n 1 248 LEU n 1 249 THR n 1 250 LYS n 1 251 VAL n 1 252 ASP n 1 253 GLY n 1 254 ASP n 1 255 ALA n 1 256 ARG n 1 257 GLY n 1 258 GLY n 1 259 ALA n 1 260 ALA n 1 261 LEU n 1 262 SER n 1 263 ILE n 1 264 ARG n 1 265 HIS n 1 266 ILE n 1 267 THR n 1 268 GLY n 1 269 LYS n 1 270 PRO n 1 271 ILE n 1 272 LYS n 1 273 PHE n 1 274 LEU n 1 275 GLY n 1 276 VAL n 1 277 GLY n 1 278 GLU n 1 279 LYS n 1 280 THR n 1 281 GLU n 1 282 ALA n 1 283 LEU n 1 284 GLU n 1 285 PRO n 1 286 PHE n 1 287 HIS n 1 288 PRO n 1 289 ASP n 1 290 ARG n 1 291 ILE n 1 292 ALA n 1 293 SER n 1 294 ARG n 1 295 ILE n 1 296 LEU n 1 297 GLY n 1 298 MET n 1 299 GLY n 1 300 ASP n 1 301 HIS n 1 302 HIS n 1 303 HIS n 1 304 HIS n 1 305 HIS n 1 306 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 306 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ffh, b2610, JW5414' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0O2 non-polymer . ;guanosine 5'-(tetrahydrogen triphosphate) 3'-(trihydrogen diphosphate) ; ? 'C10 H18 N5 O20 P5' 683.140 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 ? ? ? A . n A 1 3 PHE 3 2 ? ? ? A . n A 1 4 ASP 4 3 ? ? ? A . n A 1 5 ASN 5 4 ? ? ? A . n A 1 6 LEU 6 5 ? ? ? A . n A 1 7 THR 7 6 ? ? ? A . n A 1 8 ASP 8 7 ? ? ? A . n A 1 9 ARG 9 8 ? ? ? A . n A 1 10 LEU 10 9 10 LEU LEU A . n A 1 11 SER 11 10 11 SER SER A . n A 1 12 ARG 12 11 12 ARG ARG A . n A 1 13 THR 13 12 13 THR THR A . n A 1 14 LEU 14 13 14 LEU LEU A . n A 1 15 ARG 15 14 15 ARG ARG A . n A 1 16 ASN 16 15 16 ASN ASN A . n A 1 17 ILE 17 16 17 ILE ILE A . n A 1 18 SER 18 17 18 SER SER A . n A 1 19 GLY 19 18 19 GLY GLY A . n A 1 20 ARG 20 19 20 ARG ARG A . n A 1 21 GLY 21 20 21 GLY GLY A . n A 1 22 ARG 22 21 22 ARG ARG A . n A 1 23 LEU 23 22 23 LEU LEU A . n A 1 24 THR 24 23 24 THR THR A . n A 1 25 GLU 25 24 25 GLU GLU A . n A 1 26 ASP 26 25 26 ASP ASP A . n A 1 27 ASN 27 26 27 ASN ASN A . n A 1 28 VAL 28 27 28 VAL VAL A . n A 1 29 LYS 29 28 29 LYS LYS A . n A 1 30 ASP 30 29 30 ASP ASP A . n A 1 31 THR 31 30 31 THR THR A . n A 1 32 LEU 32 31 32 LEU LEU A . n A 1 33 ARG 33 32 33 ARG ARG A . n A 1 34 GLU 34 33 34 GLU GLU A . n A 1 35 VAL 35 34 35 VAL VAL A . n A 1 36 ARG 36 35 36 ARG ARG A . n A 1 37 MET 37 36 37 MET MET A . n A 1 38 ALA 38 37 38 ALA ALA A . n A 1 39 LEU 39 38 39 LEU LEU A . n A 1 40 LEU 40 39 40 LEU LEU A . n A 1 41 GLU 41 40 41 GLU GLU A . n A 1 42 ALA 42 41 42 ALA ALA A . n A 1 43 ASP 43 42 43 ASP ASP A . n A 1 44 VAL 44 43 44 VAL VAL A . n A 1 45 ALA 45 44 45 ALA ALA A . n A 1 46 LEU 46 45 46 LEU LEU A . n A 1 47 PRO 47 46 47 PRO PRO A . n A 1 48 VAL 48 47 48 VAL VAL A . n A 1 49 VAL 49 48 49 VAL VAL A . n A 1 50 ARG 50 49 50 ARG ARG A . n A 1 51 GLU 51 50 51 GLU GLU A . n A 1 52 PHE 52 51 52 PHE PHE A . n A 1 53 ILE 53 52 53 ILE ILE A . n A 1 54 ASN 54 53 54 ASN ASN A . n A 1 55 ARG 55 54 55 ARG ARG A . n A 1 56 VAL 56 55 56 VAL VAL A . n A 1 57 LYS 57 56 57 LYS LYS A . n A 1 58 GLU 58 57 58 GLU GLU A . n A 1 59 LYS 59 58 59 LYS LYS A . n A 1 60 ALA 60 59 60 ALA ALA A . n A 1 61 VAL 61 60 61 VAL VAL A . n A 1 62 GLY 62 61 62 GLY GLY A . n A 1 63 HIS 63 62 63 HIS HIS A . n A 1 64 GLU 64 63 64 GLU GLU A . n A 1 65 VAL 65 64 65 VAL VAL A . n A 1 66 ASN 66 65 66 ASN ASN A . n A 1 67 LYS 67 66 67 LYS LYS A . n A 1 68 SER 68 67 68 SER SER A . n A 1 69 LEU 69 68 69 LEU LEU A . n A 1 70 THR 70 69 70 THR THR A . n A 1 71 PRO 71 70 71 PRO PRO A . n A 1 72 GLY 72 71 72 GLY GLY A . n A 1 73 GLN 73 72 73 GLN GLN A . n A 1 74 GLU 74 73 74 GLU GLU A . n A 1 75 PHE 75 74 75 PHE PHE A . n A 1 76 VAL 76 75 76 VAL VAL A . n A 1 77 LYS 77 76 77 LYS LYS A . n A 1 78 ILE 78 77 78 ILE ILE A . n A 1 79 VAL 79 78 79 VAL VAL A . n A 1 80 ARG 80 79 80 ARG ARG A . n A 1 81 ASN 81 80 81 ASN ASN A . n A 1 82 GLU 82 81 82 GLU GLU A . n A 1 83 LEU 83 82 83 LEU LEU A . n A 1 84 VAL 84 83 84 VAL VAL A . n A 1 85 ALA 85 84 85 ALA ALA A . n A 1 86 ALA 86 85 86 ALA ALA A . n A 1 87 MET 87 86 87 MET MET A . n A 1 88 GLY 88 87 88 GLY GLY A . n A 1 89 GLU 89 88 89 GLU GLU A . n A 1 90 GLU 90 89 90 GLU GLU A . n A 1 91 ASN 91 90 91 ASN ASN A . n A 1 92 GLN 92 91 92 GLN GLN A . n A 1 93 THR 93 92 93 THR THR A . n A 1 94 LEU 94 93 94 LEU LEU A . n A 1 95 ASN 95 94 95 ASN ASN A . n A 1 96 LEU 96 95 96 LEU LEU A . n A 1 97 ALA 97 96 97 ALA ALA A . n A 1 98 ALA 98 97 98 ALA ALA A . n A 1 99 GLN 99 98 99 GLN GLN A . n A 1 100 PRO 100 99 100 PRO PRO A . n A 1 101 PRO 101 100 101 PRO PRO A . n A 1 102 ALA 102 101 102 ALA ALA A . n A 1 103 VAL 103 102 103 VAL VAL A . n A 1 104 VAL 104 103 104 VAL VAL A . n A 1 105 LEU 105 104 105 LEU LEU A . n A 1 106 MET 106 105 106 MET MET A . n A 1 107 ALA 107 106 107 ALA ALA A . n A 1 108 GLY 108 107 108 GLY GLY A . n A 1 109 LEU 109 108 109 LEU LEU A . n A 1 110 GLN 110 109 110 GLN GLN A . n A 1 111 GLY 111 110 111 GLY GLY A . n A 1 112 ALA 112 111 112 ALA ALA A . n A 1 113 GLY 113 112 113 GLY GLY A . n A 1 114 LYS 114 113 114 LYS LYS A . n A 1 115 THR 115 114 115 THR THR A . n A 1 116 THR 116 115 116 THR THR A . n A 1 117 SER 117 116 117 SER SER A . n A 1 118 VAL 118 117 118 VAL VAL A . n A 1 119 GLY 119 118 119 GLY GLY A . n A 1 120 LYS 120 119 120 LYS LYS A . n A 1 121 LEU 121 120 121 LEU LEU A . n A 1 122 GLY 122 121 122 GLY GLY A . n A 1 123 LYS 123 122 123 LYS LYS A . n A 1 124 PHE 124 123 124 PHE PHE A . n A 1 125 LEU 125 124 125 LEU LEU A . n A 1 126 ARG 126 125 126 ARG ARG A . n A 1 127 GLU 127 126 127 GLU GLU A . n A 1 128 LYS 128 127 128 LYS LYS A . n A 1 129 HIS 129 128 129 HIS HIS A . n A 1 130 LYS 130 129 130 LYS LYS A . n A 1 131 LYS 131 130 131 LYS LYS A . n A 1 132 LYS 132 131 132 LYS LYS A . n A 1 133 VAL 133 132 133 VAL VAL A . n A 1 134 LEU 134 133 134 LEU LEU A . n A 1 135 VAL 135 134 135 VAL VAL A . n A 1 136 VAL 136 135 136 VAL VAL A . n A 1 137 SER 137 136 137 SER SER A . n A 1 138 ALA 138 137 138 ALA ALA A . n A 1 139 ASP 139 138 139 ASP ASP A . n A 1 140 VAL 140 139 140 VAL VAL A . n A 1 141 TYR 141 140 141 TYR TYR A . n A 1 142 ARG 142 141 142 ARG ARG A . n A 1 143 PRO 143 142 143 PRO PRO A . n A 1 144 ALA 144 143 144 ALA ALA A . n A 1 145 ALA 145 144 145 ALA ALA A . n A 1 146 ILE 146 145 146 ILE ILE A . n A 1 147 LYS 147 146 147 LYS LYS A . n A 1 148 GLN 148 147 148 GLN GLN A . n A 1 149 LEU 149 148 149 LEU LEU A . n A 1 150 GLU 150 149 150 GLU GLU A . n A 1 151 THR 151 150 151 THR THR A . n A 1 152 LEU 152 151 152 LEU LEU A . n A 1 153 ALA 153 152 153 ALA ALA A . n A 1 154 GLU 154 153 154 GLU GLU A . n A 1 155 GLN 155 154 155 GLN GLN A . n A 1 156 VAL 156 155 156 VAL VAL A . n A 1 157 GLY 157 156 157 GLY GLY A . n A 1 158 VAL 158 157 158 VAL VAL A . n A 1 159 ASP 159 158 159 ASP ASP A . n A 1 160 PHE 160 159 160 PHE PHE A . n A 1 161 PHE 161 160 161 PHE PHE A . n A 1 162 PRO 162 161 162 PRO PRO A . n A 1 163 SER 163 162 163 SER SER A . n A 1 164 ASP 164 163 164 ASP ASP A . n A 1 165 VAL 165 164 165 VAL VAL A . n A 1 166 GLY 166 165 166 GLY GLY A . n A 1 167 GLN 167 166 167 GLN GLN A . n A 1 168 LYS 168 167 168 LYS LYS A . n A 1 169 PRO 169 168 169 PRO PRO A . n A 1 170 VAL 170 169 170 VAL VAL A . n A 1 171 ASP 171 170 171 ASP ASP A . n A 1 172 ILE 172 171 172 ILE ILE A . n A 1 173 VAL 173 172 173 VAL VAL A . n A 1 174 ASN 174 173 174 ASN ASN A . n A 1 175 ALA 175 174 175 ALA ALA A . n A 1 176 ALA 176 175 176 ALA ALA A . n A 1 177 LEU 177 176 177 LEU LEU A . n A 1 178 LYS 178 177 178 LYS LYS A . n A 1 179 GLU 179 178 179 GLU GLU A . n A 1 180 ALA 180 179 180 ALA ALA A . n A 1 181 LYS 181 180 181 LYS LYS A . n A 1 182 LEU 182 181 182 LEU LEU A . n A 1 183 LYS 183 182 183 LYS LYS A . n A 1 184 PHE 184 183 184 PHE PHE A . n A 1 185 TYR 185 184 185 TYR TYR A . n A 1 186 ASP 186 185 186 ASP ASP A . n A 1 187 VAL 187 186 187 VAL VAL A . n A 1 188 LEU 188 187 188 LEU LEU A . n A 1 189 LEU 189 188 189 LEU LEU A . n A 1 190 VAL 190 189 190 VAL VAL A . n A 1 191 ASP 191 190 191 ASP ASP A . n A 1 192 THR 192 191 192 THR THR A . n A 1 193 ALA 193 192 193 ALA ALA A . n A 1 194 GLY 194 193 194 GLY GLY A . n A 1 195 ARG 195 194 195 ARG ARG A . n A 1 196 LEU 196 195 196 LEU LEU A . n A 1 197 HIS 197 196 197 HIS HIS A . n A 1 198 VAL 198 197 198 VAL VAL A . n A 1 199 ASP 199 198 199 ASP ASP A . n A 1 200 GLU 200 199 200 GLU GLU A . n A 1 201 ALA 201 200 201 ALA ALA A . n A 1 202 MET 202 201 202 MET MET A . n A 1 203 MET 203 202 203 MET MET A . n A 1 204 ASP 204 203 204 ASP ASP A . n A 1 205 GLU 205 204 205 GLU GLU A . n A 1 206 ILE 206 205 206 ILE ILE A . n A 1 207 LYS 207 206 207 LYS LYS A . n A 1 208 GLN 208 207 208 GLN GLN A . n A 1 209 VAL 209 208 209 VAL VAL A . n A 1 210 HIS 210 209 210 HIS HIS A . n A 1 211 ALA 211 210 211 ALA ALA A . n A 1 212 SER 212 211 212 SER SER A . n A 1 213 ILE 213 212 213 ILE ILE A . n A 1 214 ASN 214 213 214 ASN ASN A . n A 1 215 PRO 215 214 215 PRO PRO A . n A 1 216 VAL 216 215 216 VAL VAL A . n A 1 217 GLU 217 216 217 GLU GLU A . n A 1 218 THR 218 217 218 THR THR A . n A 1 219 LEU 219 218 219 LEU LEU A . n A 1 220 PHE 220 219 220 PHE PHE A . n A 1 221 VAL 221 220 221 VAL VAL A . n A 1 222 VAL 222 221 222 VAL VAL A . n A 1 223 ASP 223 222 223 ASP ASP A . n A 1 224 ALA 224 223 224 ALA ALA A . n A 1 225 MET 225 224 225 MET MET A . n A 1 226 THR 226 225 226 THR THR A . n A 1 227 GLY 227 226 227 GLY GLY A . n A 1 228 GLN 228 227 228 GLN GLN A . n A 1 229 ASP 229 228 229 ASP ASP A . n A 1 230 ALA 230 229 230 ALA ALA A . n A 1 231 ALA 231 230 231 ALA ALA A . n A 1 232 ASN 232 231 232 ASN ASN A . n A 1 233 THR 233 232 233 THR THR A . n A 1 234 ALA 234 233 234 ALA ALA A . n A 1 235 LYS 235 234 235 LYS LYS A . n A 1 236 ALA 236 235 236 ALA ALA A . n A 1 237 PHE 237 236 237 PHE PHE A . n A 1 238 ASN 238 237 238 ASN ASN A . n A 1 239 GLU 239 238 239 GLU GLU A . n A 1 240 ALA 240 239 240 ALA ALA A . n A 1 241 LEU 241 240 241 LEU LEU A . n A 1 242 PRO 242 241 242 PRO PRO A . n A 1 243 LEU 243 242 243 LEU LEU A . n A 1 244 THR 244 243 244 THR THR A . n A 1 245 GLY 245 244 245 GLY GLY A . n A 1 246 VAL 246 245 246 VAL VAL A . n A 1 247 VAL 247 246 247 VAL VAL A . n A 1 248 LEU 248 247 248 LEU LEU A . n A 1 249 THR 249 248 249 THR THR A . n A 1 250 LYS 250 249 250 LYS LYS A . n A 1 251 VAL 251 250 251 VAL VAL A . n A 1 252 ASP 252 251 252 ASP ASP A . n A 1 253 GLY 253 252 253 GLY GLY A . n A 1 254 ASP 254 253 254 ASP ASP A . n A 1 255 ALA 255 254 255 ALA ALA A . n A 1 256 ARG 256 255 256 ARG ARG A . n A 1 257 GLY 257 256 257 GLY GLY A . n A 1 258 GLY 258 257 258 GLY GLY A . n A 1 259 ALA 259 258 259 ALA ALA A . n A 1 260 ALA 260 259 260 ALA ALA A . n A 1 261 LEU 261 260 261 LEU LEU A . n A 1 262 SER 262 261 262 SER SER A . n A 1 263 ILE 263 262 263 ILE ILE A . n A 1 264 ARG 264 263 264 ARG ARG A . n A 1 265 HIS 265 264 265 HIS HIS A . n A 1 266 ILE 266 265 266 ILE ILE A . n A 1 267 THR 267 266 267 THR THR A . n A 1 268 GLY 268 267 268 GLY GLY A . n A 1 269 LYS 269 268 269 LYS LYS A . n A 1 270 PRO 270 269 270 PRO PRO A . n A 1 271 ILE 271 270 271 ILE ILE A . n A 1 272 LYS 272 271 272 LYS LYS A . n A 1 273 PHE 273 272 273 PHE PHE A . n A 1 274 LEU 274 273 274 LEU LEU A . n A 1 275 GLY 275 274 275 GLY GLY A . n A 1 276 VAL 276 275 276 VAL VAL A . n A 1 277 GLY 277 276 277 GLY GLY A . n A 1 278 GLU 278 277 278 GLU GLU A . n A 1 279 LYS 279 278 279 LYS LYS A . n A 1 280 THR 280 279 280 THR THR A . n A 1 281 GLU 281 280 281 GLU GLU A . n A 1 282 ALA 282 281 282 ALA ALA A . n A 1 283 LEU 283 282 283 LEU LEU A . n A 1 284 GLU 284 283 284 GLU GLU A . n A 1 285 PRO 285 284 285 PRO PRO A . n A 1 286 PHE 286 285 286 PHE PHE A . n A 1 287 HIS 287 286 287 HIS HIS A . n A 1 288 PRO 288 287 288 PRO PRO A . n A 1 289 ASP 289 288 289 ASP ASP A . n A 1 290 ARG 290 289 290 ARG ARG A . n A 1 291 ILE 291 290 291 ILE ILE A . n A 1 292 ALA 292 291 292 ALA ALA A . n A 1 293 SER 293 292 293 SER SER A . n A 1 294 ARG 294 293 294 ARG ARG A . n A 1 295 ILE 295 294 295 ILE ILE A . n A 1 296 LEU 296 295 ? ? ? A . n A 1 297 GLY 297 296 ? ? ? A . n A 1 298 MET 298 297 ? ? ? A . n A 1 299 GLY 299 298 ? ? ? A . n A 1 300 ASP 300 299 ? ? ? A . n A 1 301 HIS 301 300 ? ? ? A . n A 1 302 HIS 302 301 ? ? ? A . n A 1 303 HIS 303 302 ? ? ? A . n A 1 304 HIS 304 303 ? ? ? A . n A 1 305 HIS 305 304 ? ? ? A . n A 1 306 HIS 306 305 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 0O2 1 401 301 0O2 C1Z A . C 3 HOH 1 501 2 HOH HOH A . C 3 HOH 2 502 14 HOH HOH A . C 3 HOH 3 503 7 HOH HOH A . C 3 HOH 4 504 3 HOH HOH A . C 3 HOH 5 505 8 HOH HOH A . C 3 HOH 6 506 13 HOH HOH A . C 3 HOH 7 507 5 HOH HOH A . C 3 HOH 8 508 1 HOH HOH A . C 3 HOH 9 509 11 HOH HOH A . C 3 HOH 10 510 9 HOH HOH A . C 3 HOH 11 511 4 HOH HOH A . C 3 HOH 12 512 12 HOH HOH A . C 3 HOH 13 513 6 HOH HOH A . C 3 HOH 14 514 10 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 11 ? CG ? A ARG 12 CG 2 1 Y 1 A ARG 11 ? CD ? A ARG 12 CD 3 1 Y 1 A ARG 11 ? NE ? A ARG 12 NE 4 1 Y 1 A ARG 11 ? CZ ? A ARG 12 CZ 5 1 Y 1 A ARG 11 ? NH1 ? A ARG 12 NH1 6 1 Y 1 A ARG 11 ? NH2 ? A ARG 12 NH2 7 1 Y 1 A ARG 21 ? CG ? A ARG 22 CG 8 1 Y 1 A ARG 21 ? CD ? A ARG 22 CD 9 1 Y 1 A ARG 21 ? NE ? A ARG 22 NE 10 1 Y 1 A ARG 21 ? CZ ? A ARG 22 CZ 11 1 Y 1 A ARG 21 ? NH1 ? A ARG 22 NH1 12 1 Y 1 A ARG 21 ? NH2 ? A ARG 22 NH2 13 1 Y 1 A LEU 22 ? CG ? A LEU 23 CG 14 1 Y 1 A LEU 22 ? CD1 ? A LEU 23 CD1 15 1 Y 1 A LEU 22 ? CD2 ? A LEU 23 CD2 16 1 Y 1 A ARG 35 ? CG ? A ARG 36 CG 17 1 Y 1 A ARG 35 ? CD ? A ARG 36 CD 18 1 Y 1 A ARG 35 ? NE ? A ARG 36 NE 19 1 Y 1 A ARG 35 ? CZ ? A ARG 36 CZ 20 1 Y 1 A ARG 35 ? NH1 ? A ARG 36 NH1 21 1 Y 1 A ARG 35 ? NH2 ? A ARG 36 NH2 22 1 Y 1 A ARG 49 ? CG ? A ARG 50 CG 23 1 Y 1 A ARG 49 ? CD ? A ARG 50 CD 24 1 Y 1 A ARG 49 ? NE ? A ARG 50 NE 25 1 Y 1 A ARG 49 ? CZ ? A ARG 50 CZ 26 1 Y 1 A ARG 49 ? NH1 ? A ARG 50 NH1 27 1 Y 1 A ARG 49 ? NH2 ? A ARG 50 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.18.2_3874: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7O9I _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.060 _cell.length_a_esd ? _cell.length_b 58.060 _cell.length_b_esd ? _cell.length_c 101.680 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7O9I _symmetry.cell_setting ? _symmetry.Int_Tables_number 76 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7O9I _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M sodium chloride, 0.1 M CHES pH 9.5, 50% PEG 400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-09-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976253 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976253 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7O9I _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.49 _reflns.d_resolution_low 41.05 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11747 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.56 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.77 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.49 _reflns_shell.d_res_low 2.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1112 _reflns_shell.percent_possible_all 96.29 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.969 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7O9I _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.49 _refine.ls_d_res_low 41.05 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11724 _refine.ls_number_reflns_R_free 585 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.40 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2372 _refine.ls_R_factor_R_free 0.2753 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2351 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3NG1 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.52 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.35 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.49 _refine_hist.d_res_low 41.05 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 2206 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2152 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2240 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.271 ? 3041 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 20.644 ? 326 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.071 ? 362 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 387 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.49 2.74 . . 142 2727 98.00 . . . 0.3698 . 0.2672 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.74 3.14 . . 147 2775 100.00 . . . 0.3344 . 0.2793 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.14 3.95 . . 147 2806 100.00 . . . 0.2868 . 0.2494 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.96 41.05 . . 149 2831 100.00 . . . 0.2414 . 0.2115 . . . . . . . . . . . # _struct.entry_id 7O9I _struct.title 'Escherichia coli Ffh in complex with pppGpp' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7O9I _struct_keywords.text 'stringent response, targeting complex, signal recognition particle, alarmones, stress, TRANSLATION' _struct_keywords.pdbx_keywords TRANSLATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SRP54_ECOLI _struct_ref.pdbx_db_accession P0AGD7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNEL VAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPS DVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEALPL TGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGD ; _struct_ref.pdbx_align_begin 3 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7O9I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 300 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AGD7 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 299 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 299 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7O9I MET A 1 ? UNP P0AGD7 ? ? 'initiating methionine' 0 1 1 7O9I GLY A 2 ? UNP P0AGD7 ? ? 'expression tag' 1 2 1 7O9I PHE A 3 ? UNP P0AGD7 ? ? 'expression tag' 2 3 1 7O9I HIS A 301 ? UNP P0AGD7 ? ? 'expression tag' 300 4 1 7O9I HIS A 302 ? UNP P0AGD7 ? ? 'expression tag' 301 5 1 7O9I HIS A 303 ? UNP P0AGD7 ? ? 'expression tag' 302 6 1 7O9I HIS A 304 ? UNP P0AGD7 ? ? 'expression tag' 303 7 1 7O9I HIS A 305 ? UNP P0AGD7 ? ? 'expression tag' 304 8 1 7O9I HIS A 306 ? UNP P0AGD7 ? ? 'expression tag' 305 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13670 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 10 ? SER A 18 ? LEU A 9 SER A 17 1 ? 9 HELX_P HELX_P2 AA2 GLU A 25 ? VAL A 44 ? GLU A 24 VAL A 43 1 ? 20 HELX_P HELX_P3 AA3 VAL A 48 ? GLU A 64 ? VAL A 47 GLU A 63 1 ? 17 HELX_P HELX_P4 AA4 VAL A 65 ? SER A 68 ? VAL A 64 SER A 67 5 ? 4 HELX_P HELX_P5 AA5 THR A 70 ? MET A 87 ? THR A 69 MET A 86 1 ? 18 HELX_P HELX_P6 AA6 GLY A 113 ? LYS A 128 ? GLY A 112 LYS A 127 1 ? 16 HELX_P HELX_P7 AA7 ALA A 144 ? GLY A 157 ? ALA A 143 GLY A 156 1 ? 14 HELX_P HELX_P8 AA8 LYS A 168 ? LYS A 183 ? LYS A 167 LYS A 182 1 ? 16 HELX_P HELX_P9 AA9 ASP A 199 ? ASN A 214 ? ASP A 198 ASN A 213 1 ? 16 HELX_P HELX_P10 AB1 GLY A 227 ? LEU A 241 ? GLY A 226 LEU A 240 1 ? 15 HELX_P HELX_P11 AB2 LYS A 250 ? ASP A 254 ? LYS A 249 ASP A 253 5 ? 5 HELX_P HELX_P12 AB3 GLY A 258 ? GLY A 268 ? GLY A 257 GLY A 267 1 ? 11 HELX_P HELX_P13 AB4 HIS A 287 ? ILE A 295 ? HIS A 286 ILE A 294 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 100 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 99 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 101 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 100 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.26 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 159 ? PHE A 160 ? ASP A 158 PHE A 159 AA1 2 VAL A 133 ? SER A 137 ? VAL A 132 SER A 136 AA1 3 VAL A 187 ? ASP A 191 ? VAL A 186 ASP A 190 AA1 4 ALA A 102 ? ALA A 107 ? ALA A 101 ALA A 106 AA1 5 GLU A 217 ? ASP A 223 ? GLU A 216 ASP A 222 AA1 6 GLY A 245 ? THR A 249 ? GLY A 244 THR A 248 AA1 7 ILE A 271 ? GLY A 275 ? ILE A 270 GLY A 274 AA1 8 LEU A 283 ? PRO A 285 ? LEU A 282 PRO A 284 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASP A 159 ? O ASP A 158 N VAL A 133 ? N VAL A 132 AA1 2 3 N LEU A 134 ? N LEU A 133 O LEU A 189 ? O LEU A 188 AA1 3 4 O LEU A 188 ? O LEU A 187 N ALA A 102 ? N ALA A 101 AA1 4 5 N LEU A 105 ? N LEU A 104 O LEU A 219 ? O LEU A 218 AA1 5 6 N PHE A 220 ? N PHE A 219 O VAL A 247 ? O VAL A 246 AA1 6 7 N LEU A 248 ? N LEU A 247 O GLY A 275 ? O GLY A 274 AA1 7 8 N LEU A 274 ? N LEU A 273 O GLU A 284 ? O GLU A 283 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 0O2 _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 18 _struct_site.details 'binding site for residue 0O2 A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 LEU A 109 ? LEU A 108 . ? 1_555 ? 2 AC1 18 GLY A 111 ? GLY A 110 . ? 1_555 ? 3 AC1 18 ALA A 112 ? ALA A 111 . ? 1_555 ? 4 AC1 18 GLY A 113 ? GLY A 112 . ? 1_555 ? 5 AC1 18 LYS A 114 ? LYS A 113 . ? 1_555 ? 6 AC1 18 THR A 115 ? THR A 114 . ? 1_555 ? 7 AC1 18 THR A 116 ? THR A 115 . ? 1_555 ? 8 AC1 18 LYS A 120 ? LYS A 119 . ? 1_555 ? 9 AC1 18 ASP A 139 ? ASP A 138 . ? 1_555 ? 10 AC1 18 GLN A 148 ? GLN A 147 . ? 1_555 ? 11 AC1 18 ASP A 191 ? ASP A 190 . ? 1_555 ? 12 AC1 18 LYS A 250 ? LYS A 249 . ? 1_555 ? 13 AC1 18 ASP A 252 ? ASP A 251 . ? 1_555 ? 14 AC1 18 GLY A 275 ? GLY A 274 . ? 1_555 ? 15 AC1 18 VAL A 276 ? VAL A 275 . ? 1_555 ? 16 AC1 18 GLY A 277 ? GLY A 276 . ? 1_555 ? 17 AC1 18 GLU A 278 ? GLU A 277 . ? 1_555 ? 18 AC1 18 HOH C . ? HOH A 503 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 88 ? ? 72.60 -59.04 2 1 ALA A 97 ? ? -92.73 -159.63 # _pdbx_entry_details.entry_id 7O9I _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 1 ? A GLY 2 3 1 Y 1 A PHE 2 ? A PHE 3 4 1 Y 1 A ASP 3 ? A ASP 4 5 1 Y 1 A ASN 4 ? A ASN 5 6 1 Y 1 A LEU 5 ? A LEU 6 7 1 Y 1 A THR 6 ? A THR 7 8 1 Y 1 A ASP 7 ? A ASP 8 9 1 Y 1 A ARG 8 ? A ARG 9 10 1 Y 1 A LEU 295 ? A LEU 296 11 1 Y 1 A GLY 296 ? A GLY 297 12 1 Y 1 A MET 297 ? A MET 298 13 1 Y 1 A GLY 298 ? A GLY 299 14 1 Y 1 A ASP 299 ? A ASP 300 15 1 Y 1 A HIS 300 ? A HIS 301 16 1 Y 1 A HIS 301 ? A HIS 302 17 1 Y 1 A HIS 302 ? A HIS 303 18 1 Y 1 A HIS 303 ? A HIS 304 19 1 Y 1 A HIS 304 ? A HIS 305 20 1 Y 1 A HIS 305 ? A HIS 306 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0O2 PD P N N 1 0O2 O1D O N N 2 0O2 O2D O N N 3 0O2 O3D O N N 4 0O2 PG P N N 5 0O2 O1G O N N 6 0O2 O2G O N N 7 0O2 O3G O N N 8 0O2 PB P N N 9 0O2 O1B O N N 10 0O2 O2B O N N 11 0O2 O3B O N N 12 0O2 O3A O N N 13 0O2 PA P N N 14 0O2 O1A O N N 15 0O2 O2A O N N 16 0O2 "O5'" O N N 17 0O2 "C5'" C N N 18 0O2 "C4'" C N R 19 0O2 "O4'" O N N 20 0O2 "C3'" C N S 21 0O2 "O3'" O N N 22 0O2 "C2'" C N R 23 0O2 "O2'" O N N 24 0O2 "C1'" C N R 25 0O2 N9 N Y N 26 0O2 C8 C Y N 27 0O2 N7 N Y N 28 0O2 C5 C Y N 29 0O2 C6 C N N 30 0O2 O6 O N N 31 0O2 N1 N N N 32 0O2 C2 C N N 33 0O2 N2 N N N 34 0O2 N3 N N N 35 0O2 C4 C Y N 36 0O2 PC P N N 37 0O2 O1C O N N 38 0O2 O2C O N N 39 0O2 O3C O N N 40 0O2 H1 H N N 41 0O2 H2 H N N 42 0O2 H3 H N N 43 0O2 H4 H N N 44 0O2 H5 H N N 45 0O2 H6 H N N 46 0O2 H7 H N N 47 0O2 H8 H N N 48 0O2 H9 H N N 49 0O2 H10 H N N 50 0O2 H11 H N N 51 0O2 H12 H N N 52 0O2 H13 H N N 53 0O2 H14 H N N 54 0O2 H15 H N N 55 0O2 H16 H N N 56 0O2 H18 H N N 57 0O2 H19 H N N 58 ALA N N N N 59 ALA CA C N S 60 ALA C C N N 61 ALA O O N N 62 ALA CB C N N 63 ALA OXT O N N 64 ALA H H N N 65 ALA H2 H N N 66 ALA HA H N N 67 ALA HB1 H N N 68 ALA HB2 H N N 69 ALA HB3 H N N 70 ALA HXT H N N 71 ARG N N N N 72 ARG CA C N S 73 ARG C C N N 74 ARG O O N N 75 ARG CB C N N 76 ARG CG C N N 77 ARG CD C N N 78 ARG NE N N N 79 ARG CZ C N N 80 ARG NH1 N N N 81 ARG NH2 N N N 82 ARG OXT O N N 83 ARG H H N N 84 ARG H2 H N N 85 ARG HA H N N 86 ARG HB2 H N N 87 ARG HB3 H N N 88 ARG HG2 H N N 89 ARG HG3 H N N 90 ARG HD2 H N N 91 ARG HD3 H N N 92 ARG HE H N N 93 ARG HH11 H N N 94 ARG HH12 H N N 95 ARG HH21 H N N 96 ARG HH22 H N N 97 ARG HXT H N N 98 ASN N N N N 99 ASN CA C N S 100 ASN C C N N 101 ASN O O N N 102 ASN CB C N N 103 ASN CG C N N 104 ASN OD1 O N N 105 ASN ND2 N N N 106 ASN OXT O N N 107 ASN H H N N 108 ASN H2 H N N 109 ASN HA H N N 110 ASN HB2 H N N 111 ASN HB3 H N N 112 ASN HD21 H N N 113 ASN HD22 H N N 114 ASN HXT H N N 115 ASP N N N N 116 ASP CA C N S 117 ASP C C N N 118 ASP O O N N 119 ASP CB C N N 120 ASP CG C N N 121 ASP OD1 O N N 122 ASP OD2 O N N 123 ASP OXT O N N 124 ASP H H N N 125 ASP H2 H N N 126 ASP HA H N N 127 ASP HB2 H N N 128 ASP HB3 H N N 129 ASP HD2 H N N 130 ASP HXT H N N 131 GLN N N N N 132 GLN CA C N S 133 GLN C C N N 134 GLN O O N N 135 GLN CB C N N 136 GLN CG C N N 137 GLN CD C N N 138 GLN OE1 O N N 139 GLN NE2 N N N 140 GLN OXT O N N 141 GLN H H N N 142 GLN H2 H N N 143 GLN HA H N N 144 GLN HB2 H N N 145 GLN HB3 H N N 146 GLN HG2 H N N 147 GLN HG3 H N N 148 GLN HE21 H N N 149 GLN HE22 H N N 150 GLN HXT H N N 151 GLU N N N N 152 GLU CA C N S 153 GLU C C N N 154 GLU O O N N 155 GLU CB C N N 156 GLU CG C N N 157 GLU CD C N N 158 GLU OE1 O N N 159 GLU OE2 O N N 160 GLU OXT O N N 161 GLU H H N N 162 GLU H2 H N N 163 GLU HA H N N 164 GLU HB2 H N N 165 GLU HB3 H N N 166 GLU HG2 H N N 167 GLU HG3 H N N 168 GLU HE2 H N N 169 GLU HXT H N N 170 GLY N N N N 171 GLY CA C N N 172 GLY C C N N 173 GLY O O N N 174 GLY OXT O N N 175 GLY H H N N 176 GLY H2 H N N 177 GLY HA2 H N N 178 GLY HA3 H N N 179 GLY HXT H N N 180 HIS N N N N 181 HIS CA C N S 182 HIS C C N N 183 HIS O O N N 184 HIS CB C N N 185 HIS CG C Y N 186 HIS ND1 N Y N 187 HIS CD2 C Y N 188 HIS CE1 C Y N 189 HIS NE2 N Y N 190 HIS OXT O N N 191 HIS H H N N 192 HIS H2 H N N 193 HIS HA H N N 194 HIS HB2 H N N 195 HIS HB3 H N N 196 HIS HD1 H N N 197 HIS HD2 H N N 198 HIS HE1 H N N 199 HIS HE2 H N N 200 HIS HXT H N N 201 HOH O O N N 202 HOH H1 H N N 203 HOH H2 H N N 204 ILE N N N N 205 ILE CA C N S 206 ILE C C N N 207 ILE O O N N 208 ILE CB C N S 209 ILE CG1 C N N 210 ILE CG2 C N N 211 ILE CD1 C N N 212 ILE OXT O N N 213 ILE H H N N 214 ILE H2 H N N 215 ILE HA H N N 216 ILE HB H N N 217 ILE HG12 H N N 218 ILE HG13 H N N 219 ILE HG21 H N N 220 ILE HG22 H N N 221 ILE HG23 H N N 222 ILE HD11 H N N 223 ILE HD12 H N N 224 ILE HD13 H N N 225 ILE HXT H N N 226 LEU N N N N 227 LEU CA C N S 228 LEU C C N N 229 LEU O O N N 230 LEU CB C N N 231 LEU CG C N N 232 LEU CD1 C N N 233 LEU CD2 C N N 234 LEU OXT O N N 235 LEU H H N N 236 LEU H2 H N N 237 LEU HA H N N 238 LEU HB2 H N N 239 LEU HB3 H N N 240 LEU HG H N N 241 LEU HD11 H N N 242 LEU HD12 H N N 243 LEU HD13 H N N 244 LEU HD21 H N N 245 LEU HD22 H N N 246 LEU HD23 H N N 247 LEU HXT H N N 248 LYS N N N N 249 LYS CA C N S 250 LYS C C N N 251 LYS O O N N 252 LYS CB C N N 253 LYS CG C N N 254 LYS CD C N N 255 LYS CE C N N 256 LYS NZ N N N 257 LYS OXT O N N 258 LYS H H N N 259 LYS H2 H N N 260 LYS HA H N N 261 LYS HB2 H N N 262 LYS HB3 H N N 263 LYS HG2 H N N 264 LYS HG3 H N N 265 LYS HD2 H N N 266 LYS HD3 H N N 267 LYS HE2 H N N 268 LYS HE3 H N N 269 LYS HZ1 H N N 270 LYS HZ2 H N N 271 LYS HZ3 H N N 272 LYS HXT H N N 273 MET N N N N 274 MET CA C N S 275 MET C C N N 276 MET O O N N 277 MET CB C N N 278 MET CG C N N 279 MET SD S N N 280 MET CE C N N 281 MET OXT O N N 282 MET H H N N 283 MET H2 H N N 284 MET HA H N N 285 MET HB2 H N N 286 MET HB3 H N N 287 MET HG2 H N N 288 MET HG3 H N N 289 MET HE1 H N N 290 MET HE2 H N N 291 MET HE3 H N N 292 MET HXT H N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0O2 O1G PG doub N N 1 0O2 O2A PA doub N N 2 0O2 PG O3B sing N N 3 0O2 PG O2G sing N N 4 0O2 PG O3G sing N N 5 0O2 O3B PB sing N N 6 0O2 O3A PA sing N N 7 0O2 O3A PB sing N N 8 0O2 O2B PB doub N N 9 0O2 O1A PA sing N N 10 0O2 PA "O5'" sing N N 11 0O2 PB O1B sing N N 12 0O2 "O5'" "C5'" sing N N 13 0O2 "C5'" "C4'" sing N N 14 0O2 "C4'" "O4'" sing N N 15 0O2 "C4'" "C3'" sing N N 16 0O2 "O4'" "C1'" sing N N 17 0O2 O2C PC doub N N 18 0O2 C8 N7 doub Y N 19 0O2 C8 N9 sing Y N 20 0O2 "C3'" "C2'" sing N N 21 0O2 "C3'" "O3'" sing N N 22 0O2 N7 C5 sing Y N 23 0O2 "C1'" N9 sing N N 24 0O2 "C1'" "C2'" sing N N 25 0O2 N9 C4 sing Y N 26 0O2 "C2'" "O2'" sing N N 27 0O2 O2D PD doub N N 28 0O2 C5 C4 doub Y N 29 0O2 C5 C6 sing N N 30 0O2 PC "O3'" sing N N 31 0O2 PC O3C sing N N 32 0O2 PC O1C sing N N 33 0O2 C4 N3 sing N N 34 0O2 O6 C6 doub N N 35 0O2 C6 N1 sing N N 36 0O2 O1D PD sing N N 37 0O2 O3C PD sing N N 38 0O2 N3 C2 doub N N 39 0O2 PD O3D sing N N 40 0O2 N1 C2 sing N N 41 0O2 C2 N2 sing N N 42 0O2 O1D H1 sing N N 43 0O2 O3D H2 sing N N 44 0O2 O2G H3 sing N N 45 0O2 O3G H4 sing N N 46 0O2 O1B H5 sing N N 47 0O2 O1A H6 sing N N 48 0O2 "C5'" H7 sing N N 49 0O2 "C5'" H8 sing N N 50 0O2 "C4'" H9 sing N N 51 0O2 "C3'" H10 sing N N 52 0O2 "C2'" H11 sing N N 53 0O2 "O2'" H12 sing N N 54 0O2 "C1'" H13 sing N N 55 0O2 C8 H14 sing N N 56 0O2 N2 H15 sing N N 57 0O2 N2 H16 sing N N 58 0O2 O1C H18 sing N N 59 0O2 N1 H19 sing N N 60 ALA N CA sing N N 61 ALA N H sing N N 62 ALA N H2 sing N N 63 ALA CA C sing N N 64 ALA CA CB sing N N 65 ALA CA HA sing N N 66 ALA C O doub N N 67 ALA C OXT sing N N 68 ALA CB HB1 sing N N 69 ALA CB HB2 sing N N 70 ALA CB HB3 sing N N 71 ALA OXT HXT sing N N 72 ARG N CA sing N N 73 ARG N H sing N N 74 ARG N H2 sing N N 75 ARG CA C sing N N 76 ARG CA CB sing N N 77 ARG CA HA sing N N 78 ARG C O doub N N 79 ARG C OXT sing N N 80 ARG CB CG sing N N 81 ARG CB HB2 sing N N 82 ARG CB HB3 sing N N 83 ARG CG CD sing N N 84 ARG CG HG2 sing N N 85 ARG CG HG3 sing N N 86 ARG CD NE sing N N 87 ARG CD HD2 sing N N 88 ARG CD HD3 sing N N 89 ARG NE CZ sing N N 90 ARG NE HE sing N N 91 ARG CZ NH1 sing N N 92 ARG CZ NH2 doub N N 93 ARG NH1 HH11 sing N N 94 ARG NH1 HH12 sing N N 95 ARG NH2 HH21 sing N N 96 ARG NH2 HH22 sing N N 97 ARG OXT HXT sing N N 98 ASN N CA sing N N 99 ASN N H sing N N 100 ASN N H2 sing N N 101 ASN CA C sing N N 102 ASN CA CB sing N N 103 ASN CA HA sing N N 104 ASN C O doub N N 105 ASN C OXT sing N N 106 ASN CB CG sing N N 107 ASN CB HB2 sing N N 108 ASN CB HB3 sing N N 109 ASN CG OD1 doub N N 110 ASN CG ND2 sing N N 111 ASN ND2 HD21 sing N N 112 ASN ND2 HD22 sing N N 113 ASN OXT HXT sing N N 114 ASP N CA sing N N 115 ASP N H sing N N 116 ASP N H2 sing N N 117 ASP CA C sing N N 118 ASP CA CB sing N N 119 ASP CA HA sing N N 120 ASP C O doub N N 121 ASP C OXT sing N N 122 ASP CB CG sing N N 123 ASP CB HB2 sing N N 124 ASP CB HB3 sing N N 125 ASP CG OD1 doub N N 126 ASP CG OD2 sing N N 127 ASP OD2 HD2 sing N N 128 ASP OXT HXT sing N N 129 GLN N CA sing N N 130 GLN N H sing N N 131 GLN N H2 sing N N 132 GLN CA C sing N N 133 GLN CA CB sing N N 134 GLN CA HA sing N N 135 GLN C O doub N N 136 GLN C OXT sing N N 137 GLN CB CG sing N N 138 GLN CB HB2 sing N N 139 GLN CB HB3 sing N N 140 GLN CG CD sing N N 141 GLN CG HG2 sing N N 142 GLN CG HG3 sing N N 143 GLN CD OE1 doub N N 144 GLN CD NE2 sing N N 145 GLN NE2 HE21 sing N N 146 GLN NE2 HE22 sing N N 147 GLN OXT HXT sing N N 148 GLU N CA sing N N 149 GLU N H sing N N 150 GLU N H2 sing N N 151 GLU CA C sing N N 152 GLU CA CB sing N N 153 GLU CA HA sing N N 154 GLU C O doub N N 155 GLU C OXT sing N N 156 GLU CB CG sing N N 157 GLU CB HB2 sing N N 158 GLU CB HB3 sing N N 159 GLU CG CD sing N N 160 GLU CG HG2 sing N N 161 GLU CG HG3 sing N N 162 GLU CD OE1 doub N N 163 GLU CD OE2 sing N N 164 GLU OE2 HE2 sing N N 165 GLU OXT HXT sing N N 166 GLY N CA sing N N 167 GLY N H sing N N 168 GLY N H2 sing N N 169 GLY CA C sing N N 170 GLY CA HA2 sing N N 171 GLY CA HA3 sing N N 172 GLY C O doub N N 173 GLY C OXT sing N N 174 GLY OXT HXT sing N N 175 HIS N CA sing N N 176 HIS N H sing N N 177 HIS N H2 sing N N 178 HIS CA C sing N N 179 HIS CA CB sing N N 180 HIS CA HA sing N N 181 HIS C O doub N N 182 HIS C OXT sing N N 183 HIS CB CG sing N N 184 HIS CB HB2 sing N N 185 HIS CB HB3 sing N N 186 HIS CG ND1 sing Y N 187 HIS CG CD2 doub Y N 188 HIS ND1 CE1 doub Y N 189 HIS ND1 HD1 sing N N 190 HIS CD2 NE2 sing Y N 191 HIS CD2 HD2 sing N N 192 HIS CE1 NE2 sing Y N 193 HIS CE1 HE1 sing N N 194 HIS NE2 HE2 sing N N 195 HIS OXT HXT sing N N 196 HOH O H1 sing N N 197 HOH O H2 sing N N 198 ILE N CA sing N N 199 ILE N H sing N N 200 ILE N H2 sing N N 201 ILE CA C sing N N 202 ILE CA CB sing N N 203 ILE CA HA sing N N 204 ILE C O doub N N 205 ILE C OXT sing N N 206 ILE CB CG1 sing N N 207 ILE CB CG2 sing N N 208 ILE CB HB sing N N 209 ILE CG1 CD1 sing N N 210 ILE CG1 HG12 sing N N 211 ILE CG1 HG13 sing N N 212 ILE CG2 HG21 sing N N 213 ILE CG2 HG22 sing N N 214 ILE CG2 HG23 sing N N 215 ILE CD1 HD11 sing N N 216 ILE CD1 HD12 sing N N 217 ILE CD1 HD13 sing N N 218 ILE OXT HXT sing N N 219 LEU N CA sing N N 220 LEU N H sing N N 221 LEU N H2 sing N N 222 LEU CA C sing N N 223 LEU CA CB sing N N 224 LEU CA HA sing N N 225 LEU C O doub N N 226 LEU C OXT sing N N 227 LEU CB CG sing N N 228 LEU CB HB2 sing N N 229 LEU CB HB3 sing N N 230 LEU CG CD1 sing N N 231 LEU CG CD2 sing N N 232 LEU CG HG sing N N 233 LEU CD1 HD11 sing N N 234 LEU CD1 HD12 sing N N 235 LEU CD1 HD13 sing N N 236 LEU CD2 HD21 sing N N 237 LEU CD2 HD22 sing N N 238 LEU CD2 HD23 sing N N 239 LEU OXT HXT sing N N 240 LYS N CA sing N N 241 LYS N H sing N N 242 LYS N H2 sing N N 243 LYS CA C sing N N 244 LYS CA CB sing N N 245 LYS CA HA sing N N 246 LYS C O doub N N 247 LYS C OXT sing N N 248 LYS CB CG sing N N 249 LYS CB HB2 sing N N 250 LYS CB HB3 sing N N 251 LYS CG CD sing N N 252 LYS CG HG2 sing N N 253 LYS CG HG3 sing N N 254 LYS CD CE sing N N 255 LYS CD HD2 sing N N 256 LYS CD HD3 sing N N 257 LYS CE NZ sing N N 258 LYS CE HE2 sing N N 259 LYS CE HE3 sing N N 260 LYS NZ HZ1 sing N N 261 LYS NZ HZ2 sing N N 262 LYS NZ HZ3 sing N N 263 LYS OXT HXT sing N N 264 MET N CA sing N N 265 MET N H sing N N 266 MET N H2 sing N N 267 MET CA C sing N N 268 MET CA CB sing N N 269 MET CA HA sing N N 270 MET C O doub N N 271 MET C OXT sing N N 272 MET CB CG sing N N 273 MET CB HB2 sing N N 274 MET CB HB3 sing N N 275 MET CG SD sing N N 276 MET CG HG2 sing N N 277 MET CG HG3 sing N N 278 MET SD CE sing N N 279 MET CE HE1 sing N N 280 MET CE HE2 sing N N 281 MET CE HE3 sing N N 282 MET OXT HXT sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 PRO N CA sing N N 307 PRO N CD sing N N 308 PRO N H sing N N 309 PRO CA C sing N N 310 PRO CA CB sing N N 311 PRO CA HA sing N N 312 PRO C O doub N N 313 PRO C OXT sing N N 314 PRO CB CG sing N N 315 PRO CB HB2 sing N N 316 PRO CB HB3 sing N N 317 PRO CG CD sing N N 318 PRO CG HG2 sing N N 319 PRO CG HG3 sing N N 320 PRO CD HD2 sing N N 321 PRO CD HD3 sing N N 322 PRO OXT HXT sing N N 323 SER N CA sing N N 324 SER N H sing N N 325 SER N H2 sing N N 326 SER CA C sing N N 327 SER CA CB sing N N 328 SER CA HA sing N N 329 SER C O doub N N 330 SER C OXT sing N N 331 SER CB OG sing N N 332 SER CB HB2 sing N N 333 SER CB HB3 sing N N 334 SER OG HG sing N N 335 SER OXT HXT sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number SPP1879 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 0O2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 0O2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3NG1 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7O9I _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017224 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017224 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009835 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_