data_7OC9 # _entry.id 7OC9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.352 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OC9 pdb_00007oc9 10.2210/pdb7oc9/pdb WWPDB D_1292115464 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7OC9 _pdbx_database_status.recvd_initial_deposition_date 2021-04-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lovering, A.L.' 1 ? 'Valdivia-Delgado, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 89 _citation.language ? _citation.page_first 1647 _citation.page_last 1672 _citation.title 'Target highlights in CASP14: Analysis of models by structure providers.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.26247 _citation.pdbx_database_id_PubMed 34561912 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Alexander, L.T.' 1 ? primary 'Lepore, R.' 2 ? primary 'Kryshtafovych, A.' 3 ? primary 'Adamopoulos, A.' 4 ? primary 'Alahuhta, M.' 5 ? primary 'Arvin, A.M.' 6 ? primary 'Bomble, Y.J.' 7 ? primary 'Bottcher, B.' 8 ? primary 'Breyton, C.' 9 ? primary 'Chiarini, V.' 10 ? primary 'Chinnam, N.B.' 11 ? primary 'Chiu, W.' 12 ? primary 'Fidelis, K.' 13 ? primary 'Grinter, R.' 14 ? primary 'Gupta, G.D.' 15 ? primary 'Hartmann, M.D.' 16 ? primary 'Hayes, C.S.' 17 ? primary 'Heidebrecht, T.' 18 ? primary 'Ilari, A.' 19 ? primary 'Joachimiak, A.' 20 ? primary 'Kim, Y.' 21 ? primary 'Linares, R.' 22 ? primary 'Lovering, A.L.' 23 ? primary 'Lunin, V.V.' 24 ? primary 'Lupas, A.N.' 25 ? primary 'Makbul, C.' 26 ? primary 'Michalska, K.' 27 ? primary 'Moult, J.' 28 ? primary 'Mukherjee, P.K.' 29 ? primary 'Nutt, W.S.' 30 ? primary 'Oliver, S.L.' 31 ? primary 'Perrakis, A.' 32 ? primary 'Stols, L.' 33 ? primary 'Tainer, J.A.' 34 ? primary 'Topf, M.' 35 ? primary 'Tsutakawa, S.E.' 36 ? primary 'Valdivia-Delgado, M.' 37 ? primary 'Schwede, T.' 38 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7OC9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.490 _cell.length_a_esd ? _cell.length_b 69.670 _cell.length_b_esd ? _cell.length_c 85.850 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7OC9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Bd0675 14691.395 1 ? ? ? ? 2 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn 'TERTIARY-BUTYL ALCOHOL' 74.122 4 ? ? ? ? 5 water nat water 18.015 74 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGNDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVST SSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF ; _entity_poly.pdbx_seq_one_letter_code_can ;GGNDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVST SSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 ASN n 1 4 ASP n 1 5 PHE n 1 6 VAL n 1 7 SER n 1 8 ARG n 1 9 LEU n 1 10 LYS n 1 11 ALA n 1 12 LEU n 1 13 ASP n 1 14 GLY n 1 15 ARG n 1 16 GLU n 1 17 GLY n 1 18 LYS n 1 19 ILE n 1 20 VAL n 1 21 SER n 1 22 SER n 1 23 TYR n 1 24 ASP n 1 25 ASP n 1 26 GLU n 1 27 ASN n 1 28 THR n 1 29 GLY n 1 30 ARG n 1 31 CYS n 1 32 ARG n 1 33 LEU n 1 34 GLU n 1 35 LEU n 1 36 GLN n 1 37 LYS n 1 38 TYR n 1 39 GLU n 1 40 LEU n 1 41 GLU n 1 42 ASP n 1 43 GLY n 1 44 SER n 1 45 GLN n 1 46 GLY n 1 47 LEU n 1 48 ALA n 1 49 VAL n 1 50 TYR n 1 51 LEU n 1 52 GLN n 1 53 ASP n 1 54 THR n 1 55 GLY n 1 56 MET n 1 57 TYR n 1 58 PHE n 1 59 THR n 1 60 PRO n 1 61 SER n 1 62 ALA n 1 63 GLY n 1 64 LEU n 1 65 ASP n 1 66 LYS n 1 67 GLU n 1 68 THR n 1 69 LYS n 1 70 LEU n 1 71 LYS n 1 72 ASP n 1 73 ALA n 1 74 ASN n 1 75 THR n 1 76 ALA n 1 77 VAL n 1 78 VAL n 1 79 SER n 1 80 THR n 1 81 SER n 1 82 SER n 1 83 GLU n 1 84 ARG n 1 85 PRO n 1 86 GLY n 1 87 GLY n 1 88 ASP n 1 89 ALA n 1 90 CYS n 1 91 GLY n 1 92 ASP n 1 93 PHE n 1 94 GLY n 1 95 GLY n 1 96 ALA n 1 97 LEU n 1 98 GLY n 1 99 TYR n 1 100 LYS n 1 101 LYS n 1 102 VAL n 1 103 LEU n 1 104 VAL n 1 105 LEU n 1 106 LYS n 1 107 ASP n 1 108 ASN n 1 109 GLN n 1 110 VAL n 1 111 THR n 1 112 ILE n 1 113 ARG n 1 114 GLU n 1 115 THR n 1 116 PHE n 1 117 ARG n 1 118 CYS n 1 119 VAL n 1 120 MET n 1 121 ASP n 1 122 GLY n 1 123 PHE n 1 124 LYS n 1 125 LYS n 1 126 TYR n 1 127 ASP n 1 128 LEU n 1 129 SER n 1 130 THR n 1 131 THR n 1 132 CYS n 1 133 GLN n 1 134 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 134 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Bd0675 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15356 / DSM 50701 / NCIB 9529 / HD100' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 264462 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6MQ12_BDEBA _struct_ref.pdbx_db_accession Q6MQ12 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GGNDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVST SSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF ; _struct_ref.pdbx_align_begin 69 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OC9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6MQ12 _struct_ref_seq.db_align_beg 69 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 202 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TBU non-polymer . 'TERTIARY-BUTYL ALCOHOL' 2-METHYL-2-PROPANOL 'C4 H10 O' 74.122 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OC9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;47% v/v MPD 2% t-Butanol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9119 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9119 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7OC9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.5 _reflns.d_resolution_low 42.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25800 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.97 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.1 _reflns.pdbx_Rmerge_I_obs 0.04177 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.27 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.5 _reflns_shell.d_res_low 1.554 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2533 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.887 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.638 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 125.620 _refine.B_iso_mean 47.4395 _refine.B_iso_min 25.670 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7OC9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5000 _refine.ls_d_res_low 42.4280 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25800 _refine.ls_number_reflns_R_free 1260 _refine.ls_number_reflns_R_work 24540 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9700 _refine.ls_percent_reflns_R_free 4.8800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1982 _refine.ls_R_factor_R_free 0.2129 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1974 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.2800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5000 _refine_hist.d_res_low 42.4280 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 1193 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 133 _refine_hist.pdbx_B_iso_mean_ligand 61.52 _refine_hist.pdbx_B_iso_mean_solvent 45.88 _refine_hist.pdbx_number_atoms_protein 1023 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 96 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5001 1.5601 . . 136 2673 98.0000 . . . 0.3421 0.0000 0.3021 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5601 1.6311 . . 134 2674 98.0000 . . . 0.2468 0.0000 0.2634 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6311 1.7171 . . 170 2634 99.0000 . . . 0.2892 0.0000 0.2341 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7171 1.8247 . . 145 2705 99.0000 . . . 0.2312 0.0000 0.2219 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8247 1.9656 . . 123 2712 99.0000 . . . 0.2507 0.0000 0.2178 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9656 2.1634 . . 121 2726 99.0000 . . . 0.2428 0.0000 0.2076 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1634 2.4764 . . 163 2722 100.0000 . . . 0.2386 0.0000 0.2095 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4764 3.1199 . . 131 2798 100.0000 . . . 0.2411 0.0000 0.2170 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1199 42.4280 . . 137 2896 100.0000 . . . 0.1814 0.0000 0.1775 . . . . . . . . . . . # _struct.entry_id 7OC9 _struct.title 'Structure of Bdellovibrio bacteriovorus Bd0675' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OC9 _struct_keywords.text 'Bdellovibrio Secretion Cryptic, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? ASP A 13 ? GLY A 2 ASP A 13 1 ? 12 HELX_P HELX_P2 AA2 MET A 120 ? GLY A 122 ? MET A 120 GLY A 122 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 31 SG A ? ? 1_555 A CYS 132 SG A ? A CYS 31 A CYS 132 1_555 ? ? ? ? ? ? ? 2.009 ? ? disulf2 disulf ? ? A CYS 31 SG B ? ? 1_555 A CYS 132 SG B ? A CYS 31 A CYS 132 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf3 disulf ? ? A CYS 90 SG ? ? ? 1_555 A CYS 118 SG ? ? A CYS 90 A CYS 118 1_555 ? ? ? ? ? ? ? 2.034 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 61 ? LEU A 64 ? SER A 61 LEU A 64 AA1 2 GLN A 45 ? GLN A 52 ? GLN A 45 GLN A 52 AA1 3 ARG A 30 ? GLU A 39 ? ARG A 30 GLU A 39 AA1 4 GLU A 16 ? SER A 22 ? GLU A 16 SER A 22 AA1 5 LYS A 125 ? GLN A 133 ? LYS A 125 GLN A 133 AA1 6 GLN A 109 ? CYS A 118 ? GLN A 109 CYS A 118 AA1 7 ALA A 96 ? LYS A 106 ? ALA A 96 LYS A 106 AA1 8 THR A 75 ? SER A 79 ? THR A 75 SER A 79 AA1 9 LYS A 69 ? ASP A 72 ? LYS A 69 ASP A 72 AA2 1 GLY A 87 ? ASP A 88 ? GLY A 87 ASP A 88 AA2 2 GLY A 91 ? ASP A 92 ? GLY A 91 ASP A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 64 ? O LEU A 64 N LEU A 47 ? N LEU A 47 AA1 2 3 O GLN A 52 ? O GLN A 52 N ARG A 32 ? N ARG A 32 AA1 3 4 O CYS A 31 ? O CYS A 31 N GLY A 17 ? N GLY A 17 AA1 4 5 N LYS A 18 ? N LYS A 18 O GLN A 133 ? O GLN A 133 AA1 5 6 O TYR A 126 ? O TYR A 126 N PHE A 116 ? N PHE A 116 AA1 6 7 O THR A 111 ? O THR A 111 N VAL A 104 ? N VAL A 104 AA1 7 8 O LEU A 103 ? O LEU A 103 N ALA A 76 ? N ALA A 76 AA1 8 9 O VAL A 77 ? O VAL A 77 N LYS A 69 ? N LYS A 69 AA2 1 2 N ASP A 88 ? N ASP A 88 O GLY A 91 ? O GLY A 91 # _atom_sites.entry_id 7OC9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018695 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014353 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011648 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 PHE 134 134 134 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MPD 1 201 201 MPD MPD A . C 3 GOL 1 202 401 GOL GOL A . D 4 TBU 1 203 501 TBU TBU A . E 4 TBU 1 204 601 TBU TBU A . F 4 TBU 1 205 701 TBU TBU A . G 4 TBU 1 206 801 TBU TBU A . H 5 HOH 1 301 27 HOH HOH A . H 5 HOH 2 302 47 HOH HOH A . H 5 HOH 3 303 64 HOH HOH A . H 5 HOH 4 304 80 HOH HOH A . H 5 HOH 5 305 61 HOH HOH A . H 5 HOH 6 306 28 HOH HOH A . H 5 HOH 7 307 42 HOH HOH A . H 5 HOH 8 308 50 HOH HOH A . H 5 HOH 9 309 49 HOH HOH A . H 5 HOH 10 310 41 HOH HOH A . H 5 HOH 11 311 25 HOH HOH A . H 5 HOH 12 312 20 HOH HOH A . H 5 HOH 13 313 1 HOH HOH A . H 5 HOH 14 314 11 HOH HOH A . H 5 HOH 15 315 24 HOH HOH A . H 5 HOH 16 316 36 HOH HOH A . H 5 HOH 17 317 51 HOH HOH A . H 5 HOH 18 318 10 HOH HOH A . H 5 HOH 19 319 19 HOH HOH A . H 5 HOH 20 320 56 HOH HOH A . H 5 HOH 21 321 7 HOH HOH A . H 5 HOH 22 322 2 HOH HOH A . H 5 HOH 23 323 40 HOH HOH A . H 5 HOH 24 324 37 HOH HOH A . H 5 HOH 25 325 12 HOH HOH A . H 5 HOH 26 326 3 HOH HOH A . H 5 HOH 27 327 79 HOH HOH A . H 5 HOH 28 328 54 HOH HOH A . H 5 HOH 29 329 16 HOH HOH A . H 5 HOH 30 330 4 HOH HOH A . H 5 HOH 31 331 59 HOH HOH A . H 5 HOH 32 332 38 HOH HOH A . H 5 HOH 33 333 5 HOH HOH A . H 5 HOH 34 334 66 HOH HOH A . H 5 HOH 35 335 9 HOH HOH A . H 5 HOH 36 336 17 HOH HOH A . H 5 HOH 37 337 23 HOH HOH A . H 5 HOH 38 338 33 HOH HOH A . H 5 HOH 39 339 53 HOH HOH A . H 5 HOH 40 340 58 HOH HOH A . H 5 HOH 41 341 13 HOH HOH A . H 5 HOH 42 342 6 HOH HOH A . H 5 HOH 43 343 29 HOH HOH A . H 5 HOH 44 344 84 HOH HOH A . H 5 HOH 45 345 34 HOH HOH A . H 5 HOH 46 346 52 HOH HOH A . H 5 HOH 47 347 31 HOH HOH A . H 5 HOH 48 348 21 HOH HOH A . H 5 HOH 49 349 48 HOH HOH A . H 5 HOH 50 350 8 HOH HOH A . H 5 HOH 51 351 39 HOH HOH A . H 5 HOH 52 352 26 HOH HOH A . H 5 HOH 53 353 65 HOH HOH A . H 5 HOH 54 354 15 HOH HOH A . H 5 HOH 55 355 22 HOH HOH A . H 5 HOH 56 356 32 HOH HOH A . H 5 HOH 57 357 18 HOH HOH A . H 5 HOH 58 358 75 HOH HOH A . H 5 HOH 59 359 57 HOH HOH A . H 5 HOH 60 360 46 HOH HOH A . H 5 HOH 61 361 45 HOH HOH A . H 5 HOH 62 362 30 HOH HOH A . H 5 HOH 63 363 67 HOH HOH A . H 5 HOH 64 364 14 HOH HOH A . H 5 HOH 65 365 35 HOH HOH A . H 5 HOH 66 366 69 HOH HOH A . H 5 HOH 67 367 44 HOH HOH A . H 5 HOH 68 368 68 HOH HOH A . H 5 HOH 69 369 71 HOH HOH A . H 5 HOH 70 370 83 HOH HOH A . H 5 HOH 71 371 63 HOH HOH A . H 5 HOH 72 372 82 HOH HOH A . H 5 HOH 73 373 81 HOH HOH A . H 5 HOH 74 374 55 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1410 ? 1 MORE 9 ? 1 'SSA (A^2)' 8090 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 372 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id H _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-05 2 'Structure model' 1 1 2021-11-03 3 'Structure model' 1 2 2021-12-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' diffrn_source 5 2 'Structure model' pdbx_database_proc 6 3 'Structure model' citation 7 3 'Structure model' citation_author 8 3 'Structure model' diffrn_source # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_database_2.pdbx_DOI' 11 2 'Structure model' '_database_2.pdbx_database_accession' 12 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 13 3 'Structure model' '_citation.journal_volume' 14 3 'Structure model' '_citation.page_first' 15 3 'Structure model' '_citation.page_last' 16 3 'Structure model' '_citation_author.identifier_ORCID' 17 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 7OC9 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 34 ? ? NE2 A GLN 36 ? ? 1.91 2 1 N A GLY 2 ? ? O A HOH 301 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 85 ? ? -59.71 108.67 2 1 ASP A 88 ? ? -156.32 -158.22 3 1 PHE A 93 ? ? 72.52 -1.99 4 1 MET A 120 ? ? -68.26 24.17 5 1 ASP A 121 ? ? -151.32 45.95 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # _pdbx_audit_support.funding_organization 'Comision Nacional Cientifica y Technologica (CONICYT)' _pdbx_audit_support.country Chile _pdbx_audit_support.grant_number 72180329 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 3 GLYCEROL GOL 4 'TERTIARY-BUTYL ALCOHOL' TBU 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #