data_7P4V # _entry.id 7P4V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7P4V pdb_00007p4v 10.2210/pdb7p4v/pdb WWPDB D_1292116956 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-06 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7P4V _pdbx_database_status.recvd_initial_deposition_date 2021-07-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mueller, M.-C.' 1 0000-0002-2617-2826 'Wagner, T.' 2 0000-0002-3382-8969 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The Oxoglutarate Binding Site and Regulatory Mechanism Are Conserved in Ammonium Transporter Inhibitors GlnKs from Methanococcales . ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms22168631 _citation.pdbx_database_id_PubMed 34445335 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Muller, M.C.' 1 0000-0002-2617-2826 primary 'Wagner, T.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GlnK1 from Methanothermococcus thermolithotrophicus' 14648.796 1 ? ? ? 'Protein was expressed with a His-tag in the N-terminal.' 2 non-polymer syn "2'-DEOXYADENOSINE-5'-DIPHOSPHATE" 411.202 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMKKVEAIIRPERLDIVKNALSDAGYVGMTVSEVKGRGIQGGIVERYRGREYIVDLLPKIK IEMAVNDEDVEKVIDIICENAKTGEFGDGKIFVIPIEEVVRVRTGERGNDAI ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMKKVEAIIRPERLDIVKNALSDAGYVGMTVSEVKGRGIQGGIVERYRGREYIVDLLPKIK IEMAVNDEDVEKVIDIICENAKTGEFGDGKIFVIPIEEVVRVRTGERGNDAI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "2'-DEOXYADENOSINE-5'-DIPHOSPHATE" DAT 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 LYS n 1 23 LYS n 1 24 VAL n 1 25 GLU n 1 26 ALA n 1 27 ILE n 1 28 ILE n 1 29 ARG n 1 30 PRO n 1 31 GLU n 1 32 ARG n 1 33 LEU n 1 34 ASP n 1 35 ILE n 1 36 VAL n 1 37 LYS n 1 38 ASN n 1 39 ALA n 1 40 LEU n 1 41 SER n 1 42 ASP n 1 43 ALA n 1 44 GLY n 1 45 TYR n 1 46 VAL n 1 47 GLY n 1 48 MET n 1 49 THR n 1 50 VAL n 1 51 SER n 1 52 GLU n 1 53 VAL n 1 54 LYS n 1 55 GLY n 1 56 ARG n 1 57 GLY n 1 58 ILE n 1 59 GLN n 1 60 GLY n 1 61 GLY n 1 62 ILE n 1 63 VAL n 1 64 GLU n 1 65 ARG n 1 66 TYR n 1 67 ARG n 1 68 GLY n 1 69 ARG n 1 70 GLU n 1 71 TYR n 1 72 ILE n 1 73 VAL n 1 74 ASP n 1 75 LEU n 1 76 LEU n 1 77 PRO n 1 78 LYS n 1 79 ILE n 1 80 LYS n 1 81 ILE n 1 82 GLU n 1 83 MET n 1 84 ALA n 1 85 VAL n 1 86 ASN n 1 87 ASP n 1 88 GLU n 1 89 ASP n 1 90 VAL n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 ILE n 1 95 ASP n 1 96 ILE n 1 97 ILE n 1 98 CYS n 1 99 GLU n 1 100 ASN n 1 101 ALA n 1 102 LYS n 1 103 THR n 1 104 GLY n 1 105 GLU n 1 106 PHE n 1 107 GLY n 1 108 ASP n 1 109 GLY n 1 110 LYS n 1 111 ILE n 1 112 PHE n 1 113 VAL n 1 114 ILE n 1 115 PRO n 1 116 ILE n 1 117 GLU n 1 118 GLU n 1 119 VAL n 1 120 VAL n 1 121 ARG n 1 122 VAL n 1 123 ARG n 1 124 THR n 1 125 GLY n 1 126 GLU n 1 127 ARG n 1 128 GLY n 1 129 ASN n 1 130 ASP n 1 131 ALA n 1 132 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 132 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene glnk1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 2095' _entity_src_gen.gene_src_tissue / _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details / _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanothermococcus thermolithotrophicus DSM 2095' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 523845 _entity_src_gen.pdbx_gene_src_variant / _entity_src_gen.pdbx_gene_src_cell_line / _entity_src_gen.pdbx_gene_src_atcc / _entity_src_gen.pdbx_gene_src_organ / _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell / _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ / _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue / _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant / _entity_src_gen.pdbx_host_org_cell_line / _entity_src_gen.pdbx_host_org_atcc / _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell / _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-28a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DAT non-polymer . "2'-DEOXYADENOSINE-5'-DIPHOSPHATE" DADP 'C10 H15 N5 O9 P2' 411.202 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 LYS 22 2 2 LYS LYS A . n A 1 23 LYS 23 3 3 LYS LYS A . n A 1 24 VAL 24 4 4 VAL VAL A . n A 1 25 GLU 25 5 5 GLU GLU A . n A 1 26 ALA 26 6 6 ALA ALA A . n A 1 27 ILE 27 7 7 ILE ILE A . n A 1 28 ILE 28 8 8 ILE ILE A . n A 1 29 ARG 29 9 9 ARG ARG A . n A 1 30 PRO 30 10 10 PRO PRO A . n A 1 31 GLU 31 11 11 GLU GLU A . n A 1 32 ARG 32 12 12 ARG ARG A . n A 1 33 LEU 33 13 13 LEU LEU A . n A 1 34 ASP 34 14 14 ASP ASP A . n A 1 35 ILE 35 15 15 ILE ILE A . n A 1 36 VAL 36 16 16 VAL VAL A . n A 1 37 LYS 37 17 17 LYS LYS A . n A 1 38 ASN 38 18 18 ASN ASN A . n A 1 39 ALA 39 19 19 ALA ALA A . n A 1 40 LEU 40 20 20 LEU LEU A . n A 1 41 SER 41 21 21 SER SER A . n A 1 42 ASP 42 22 22 ASP ASP A . n A 1 43 ALA 43 23 23 ALA ALA A . n A 1 44 GLY 44 24 24 GLY GLY A . n A 1 45 TYR 45 25 25 TYR TYR A . n A 1 46 VAL 46 26 26 VAL VAL A . n A 1 47 GLY 47 27 27 GLY GLY A . n A 1 48 MET 48 28 28 MET MET A . n A 1 49 THR 49 29 29 THR THR A . n A 1 50 VAL 50 30 30 VAL VAL A . n A 1 51 SER 51 31 31 SER SER A . n A 1 52 GLU 52 32 32 GLU GLU A . n A 1 53 VAL 53 33 33 VAL VAL A . n A 1 54 LYS 54 34 34 LYS LYS A . n A 1 55 GLY 55 35 35 GLY GLY A . n A 1 56 ARG 56 36 36 ARG ARG A . n A 1 57 GLY 57 37 37 GLY GLY A . n A 1 58 ILE 58 38 38 ILE ILE A . n A 1 59 GLN 59 39 39 GLN GLN A . n A 1 60 GLY 60 40 40 GLY GLY A . n A 1 61 GLY 61 41 41 GLY GLY A . n A 1 62 ILE 62 42 42 ILE ILE A . n A 1 63 VAL 63 43 43 VAL VAL A . n A 1 64 GLU 64 44 44 GLU GLU A . n A 1 65 ARG 65 45 45 ARG ARG A . n A 1 66 TYR 66 46 46 TYR TYR A . n A 1 67 ARG 67 47 47 ARG ARG A . n A 1 68 GLY 68 48 48 GLY GLY A . n A 1 69 ARG 69 49 49 ARG ARG A . n A 1 70 GLU 70 50 50 GLU GLU A . n A 1 71 TYR 71 51 51 TYR TYR A . n A 1 72 ILE 72 52 52 ILE ILE A . n A 1 73 VAL 73 53 53 VAL VAL A . n A 1 74 ASP 74 54 54 ASP ASP A . n A 1 75 LEU 75 55 55 LEU LEU A . n A 1 76 LEU 76 56 56 LEU LEU A . n A 1 77 PRO 77 57 57 PRO PRO A . n A 1 78 LYS 78 58 58 LYS LYS A . n A 1 79 ILE 79 59 59 ILE ILE A . n A 1 80 LYS 80 60 60 LYS LYS A . n A 1 81 ILE 81 61 61 ILE ILE A . n A 1 82 GLU 82 62 62 GLU GLU A . n A 1 83 MET 83 63 63 MET MET A . n A 1 84 ALA 84 64 64 ALA ALA A . n A 1 85 VAL 85 65 65 VAL VAL A . n A 1 86 ASN 86 66 66 ASN ASN A . n A 1 87 ASP 87 67 67 ASP ASP A . n A 1 88 GLU 88 68 68 GLU GLU A . n A 1 89 ASP 89 69 69 ASP ASP A . n A 1 90 VAL 90 70 70 VAL VAL A . n A 1 91 GLU 91 71 71 GLU GLU A . n A 1 92 LYS 92 72 72 LYS LYS A . n A 1 93 VAL 93 73 73 VAL VAL A . n A 1 94 ILE 94 74 74 ILE ILE A . n A 1 95 ASP 95 75 75 ASP ASP A . n A 1 96 ILE 96 76 76 ILE ILE A . n A 1 97 ILE 97 77 77 ILE ILE A . n A 1 98 CYS 98 78 78 CYS CYS A . n A 1 99 GLU 99 79 79 GLU GLU A . n A 1 100 ASN 100 80 80 ASN ASN A . n A 1 101 ALA 101 81 81 ALA ALA A . n A 1 102 LYS 102 82 82 LYS LYS A . n A 1 103 THR 103 83 83 THR THR A . n A 1 104 GLY 104 84 84 GLY GLY A . n A 1 105 GLU 105 85 85 GLU GLU A . n A 1 106 PHE 106 86 86 PHE PHE A . n A 1 107 GLY 107 87 87 GLY GLY A . n A 1 108 ASP 108 88 88 ASP ASP A . n A 1 109 GLY 109 89 89 GLY GLY A . n A 1 110 LYS 110 90 90 LYS LYS A . n A 1 111 ILE 111 91 91 ILE ILE A . n A 1 112 PHE 112 92 92 PHE PHE A . n A 1 113 VAL 113 93 93 VAL VAL A . n A 1 114 ILE 114 94 94 ILE ILE A . n A 1 115 PRO 115 95 95 PRO PRO A . n A 1 116 ILE 116 96 96 ILE ILE A . n A 1 117 GLU 117 97 97 GLU GLU A . n A 1 118 GLU 118 98 98 GLU GLU A . n A 1 119 VAL 119 99 99 VAL VAL A . n A 1 120 VAL 120 100 100 VAL VAL A . n A 1 121 ARG 121 101 101 ARG ARG A . n A 1 122 VAL 122 102 102 VAL VAL A . n A 1 123 ARG 123 103 103 ARG ARG A . n A 1 124 THR 124 104 104 THR THR A . n A 1 125 GLY 125 105 105 GLY GLY A . n A 1 126 GLU 126 106 106 GLU GLU A . n A 1 127 ARG 127 107 107 ARG ARG A . n A 1 128 GLY 128 108 108 GLY GLY A . n A 1 129 ASN 129 109 109 ASN ASN A . n A 1 130 ASP 130 110 110 ASP ASP A . n A 1 131 ALA 131 111 111 ALA ALA A . n A 1 132 ILE 132 112 112 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DAT 1 201 201 DAT DAT A . C 3 CL 1 202 3 CL CL A . D 3 CL 1 203 4 CL CL A . E 4 HOH 1 301 32 HOH HOH A . E 4 HOH 2 302 3 HOH HOH A . E 4 HOH 3 303 7 HOH HOH A . E 4 HOH 4 304 15 HOH HOH A . E 4 HOH 5 305 4 HOH HOH A . E 4 HOH 6 306 23 HOH HOH A . E 4 HOH 7 307 24 HOH HOH A . E 4 HOH 8 308 27 HOH HOH A . E 4 HOH 9 309 26 HOH HOH A . E 4 HOH 10 310 11 HOH HOH A . E 4 HOH 11 311 20 HOH HOH A . E 4 HOH 12 312 28 HOH HOH A . E 4 HOH 13 313 22 HOH HOH A . E 4 HOH 14 314 6 HOH HOH A . E 4 HOH 15 315 1 HOH HOH A . E 4 HOH 16 316 29 HOH HOH A . E 4 HOH 17 317 14 HOH HOH A . E 4 HOH 18 318 35 HOH HOH A . E 4 HOH 19 319 30 HOH HOH A . E 4 HOH 20 320 33 HOH HOH A . E 4 HOH 21 321 36 HOH HOH A . E 4 HOH 22 322 12 HOH HOH A . E 4 HOH 23 323 38 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7P4V _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.296 _cell.length_a_esd ? _cell.length_b 87.296 _cell.length_b_esd ? _cell.length_c 46.010 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7P4V _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7P4V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.69 _exptl_crystal.description 'transparent hexagonal rod' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;GlnK1 crystallized at a concentration of 33 mg/ml in 25 mM TrisHCl pH 7.6, 10% glycerol, 2mM dithiothreitol and 500mM NaCl . Drop of 0.6 ul of protein was mixed with 0.6 ul of the crystallization solution in a 96-Well MRC 2-Drop Crystallization Plates in polystyrene (SWISSCI). The reservoir contained 90 ul of the following crystallization solution: 35 % w/v Pentaerythritol propoxylate (17/8 PO/OH), 100 mM MES pH 6.5, 200 mM Ammonium sulfate. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00003 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00003 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7P4V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.94 _reflns.d_resolution_low 75.601 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10108 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 89.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.3 _reflns.pdbx_Rmerge_I_obs 0.053 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.055 _reflns.pdbx_Rpim_I_all 0.013 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 2.148 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 502 _reflns_shell.percent_possible_all 60.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.711 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 18.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.759 _reflns_shell.pdbx_Rpim_I_all 0.403 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.773 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 130.320 _refine.B_iso_mean 62.7293 _refine.B_iso_min 32.230 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'The last refinement cycle was performed with hydrogens in riding position' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7P4V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9400 _refine.ls_d_res_low 39.3000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9995 _refine.ls_number_reflns_R_free 492 _refine.ls_number_reflns_R_work 9503 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 65.5400 _refine.ls_percent_reflns_R_free 4.9200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1980 _refine.ls_R_factor_R_free 0.2257 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1966 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2J9D _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.7900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9400 _refine_hist.d_res_low 39.3000 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 933 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 113 _refine_hist.pdbx_B_iso_mean_ligand 52.82 _refine_hist.pdbx_B_iso_mean_solvent 55.07 _refine_hist.pdbx_number_atoms_protein 882 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9400 2.1300 438 . 27 411 12.0000 . . . 0.4037 0.0000 0.3979 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.1400 2.4400 2183 . 127 2056 58.0000 . . . 0.3194 0.0000 0.3033 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.4400 3.0800 3656 . 163 3493 96.0000 . . . 0.2989 0.0000 0.2646 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.0800 39.3000 3718 . 175 3543 95.0000 . . . 0.1973 0.0000 0.1669 . . . . . . . 4 . . . # _struct.entry_id 7P4V _struct.title 'GlnK1 from Methanothermococcus thermolithotrophicus with dADP at a resolution of 1.94 A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7P4V _struct_keywords.text ;PII-family, Methanococcales, methanogenic archaea, hydrogenotrophs, protein regulation, inhibitor, T-loop, conformational change, dADP, 2-oxoglutarate, nitrogen metabolism, SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7P4V _struct_ref.pdbx_db_accession 7P4V _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7P4V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7P4V _struct_ref_seq.db_align_beg -19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -19 _struct_ref_seq.pdbx_auth_seq_align_end 112 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9440 ? 1 MORE -36 ? 1 'SSA (A^2)' 15470 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 43.6480000000 0.8660254038 -0.5000000000 0.0000000000 -75.6005536488 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 87.2960000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 29 ? GLU A 31 ? ARG A 9 GLU A 11 5 ? 3 HELX_P HELX_P2 AA2 ARG A 32 ? ALA A 43 ? ARG A 12 ALA A 23 1 ? 12 HELX_P HELX_P3 AA3 ASP A 89 ? LYS A 102 ? ASP A 69 LYS A 82 1 ? 14 HELX_P HELX_P4 AA4 ARG A 127 ? ALA A 131 ? ARG A 107 ALA A 111 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 49 ? GLY A 55 ? THR A 29 GLY A 35 AA1 2 LEU A 76 ? ASN A 86 ? LEU A 56 ASN A 66 AA1 3 MET A 21 ? ILE A 28 ? MET A 1 ILE A 8 AA1 4 LYS A 110 ? ILE A 116 ? LYS A 90 ILE A 96 AA2 1 ILE A 62 ? TYR A 66 ? ILE A 42 TYR A 46 AA2 2 ARG A 69 ? VAL A 73 ? ARG A 49 VAL A 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 49 ? N THR A 29 O GLU A 82 ? O GLU A 62 AA1 2 3 O VAL A 85 ? O VAL A 65 N LYS A 22 ? N LYS A 2 AA1 3 4 N LYS A 23 ? N LYS A 3 O ILE A 114 ? O ILE A 94 AA2 1 2 N ILE A 62 ? N ILE A 42 O VAL A 73 ? O VAL A 53 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CL 202 ? C CL . 2 1 A CL 203 ? D CL . 3 1 A HOH 323 ? E HOH . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 29.2800 -24.8368 8.7805 0.2848 ? 0.0084 ? -0.0243 ? 0.5897 ? -0.0187 ? 0.4214 ? 3.1926 ? 0.7091 ? 0.6236 ? 2.9775 ? 0.2974 ? 4.7612 ? -0.0467 ? 0.0109 ? -0.2138 ? -0.0249 ? -0.1215 ? 0.4778 ? 0.0630 ? -1.0058 ? 0.1030 ? 2 'X-RAY DIFFRACTION' ? refined 34.8314 -20.9052 11.8148 0.3470 ? 0.0191 ? -0.0135 ? 0.3785 ? 0.0199 ? 0.3117 ? 3.0178 ? 0.5858 ? 0.3300 ? 3.6936 ? 0.2074 ? 4.1599 ? -0.0364 ? 0.1537 ? 0.0799 ? 0.0230 ? -0.0210 ? 0.4285 ? -0.4579 ? -0.6575 ? 0.0593 ? 3 'X-RAY DIFFRACTION' ? refined 41.4729 -4.8646 29.1679 1.2938 ? 0.1075 ? 0.0591 ? 0.4784 ? 0.0058 ? 0.6113 ? 5.5545 ? 0.0750 ? 5.4829 ? 1.6667 ? -0.3094 ? 5.5014 ? -0.1983 ? -0.1853 ? -0.1059 ? 0.6613 ? -0.0907 ? -0.2137 ? -0.4938 ? -0.0019 ? -0.1513 ? 4 'X-RAY DIFFRACTION' ? refined 44.7021 -3.7543 26.6157 1.1722 ? 0.0122 ? 0.0406 ? 0.3465 ? -0.0145 ? 0.6009 ? 1.2526 ? 0.9319 ? -0.0622 ? 2.2869 ? 1.8057 ? 6.8426 ? -0.1704 ? -0.3288 ? -0.2717 ? 0.4401 ? 0.0970 ? -0.5268 ? -1.1022 ? 0.2446 ? -0.0249 ? 5 'X-RAY DIFFRACTION' ? refined 30.4010 -21.1848 4.5921 0.3626 ? 0.0601 ? -0.0944 ? 0.5567 ? -0.0137 ? 0.4129 ? 2.5419 ? 0.2702 ? 0.0259 ? 2.1201 ? -0.7022 ? 4.1582 ? -0.1015 ? 0.2206 ? 0.1473 ? -0.2826 ? 0.0012 ? 0.6813 ? -0.3574 ? -1.1504 ? 0.0892 ? 6 'X-RAY DIFFRACTION' ? refined 38.2314 -41.5493 -0.5484 0.9255 ? -0.2018 ? -0.0100 ? 0.5556 ? -0.1681 ? 0.5456 ? 3.3919 ? 1.0019 ? -0.1542 ? 6.2308 ? -2.1690 ? 3.2020 ? 0.1177 ? 0.6905 ? -0.4321 ? -0.6240 ? 0.3644 ? 0.4339 ? 1.5184 ? -0.4249 ? 0.0154 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? ? A 22 ? ? ;chain 'A' and (resid 0 through 22 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 23 ? ? ? A 41 ? ? ;chain 'A' and (resid 23 through 41 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 42 ? ? ? A 46 ? ? ;chain 'A' and (resid 42 through 46 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 47 ? ? ? A 55 ? ? ;chain 'A' and (resid 47 through 55 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 56 ? ? ? A 96 ? ? ;chain 'A' and (resid 56 through 96 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 97 ? ? ? A 112 ? ? ;chain 'A' and (resid 97 through 112 ) ; # _pdbx_entry_details.entry_id 7P4V _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DAT PB P N N 89 DAT O1B O N N 90 DAT O2B O N N 91 DAT O3B O N N 92 DAT PA P N S 93 DAT O1A O N N 94 DAT O2A O N N 95 DAT O3A O N N 96 DAT "O5'" O N N 97 DAT "C5'" C N N 98 DAT "C4'" C N R 99 DAT "O4'" O N N 100 DAT "C3'" C N S 101 DAT "O3'" O N N 102 DAT "C2'" C N N 103 DAT "C1'" C N R 104 DAT N9 N Y N 105 DAT C8 C Y N 106 DAT N7 N Y N 107 DAT C5 C Y N 108 DAT C6 C Y N 109 DAT N6 N N N 110 DAT N1 N Y N 111 DAT C2 C Y N 112 DAT N3 N Y N 113 DAT C4 C Y N 114 DAT HOB2 H N N 115 DAT HOB3 H N N 116 DAT HOA2 H N N 117 DAT "H5'1" H N N 118 DAT "H5'2" H N N 119 DAT "H4'" H N N 120 DAT "H3'" H N N 121 DAT "HO3'" H N N 122 DAT "H2'1" H N N 123 DAT "H2'2" H N N 124 DAT "H1'" H N N 125 DAT H8 H N N 126 DAT HN61 H N N 127 DAT HN62 H N N 128 DAT H2 H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HIS N N N N 179 HIS CA C N S 180 HIS C C N N 181 HIS O O N N 182 HIS CB C N N 183 HIS CG C Y N 184 HIS ND1 N Y N 185 HIS CD2 C Y N 186 HIS CE1 C Y N 187 HIS NE2 N Y N 188 HIS OXT O N N 189 HIS H H N N 190 HIS H2 H N N 191 HIS HA H N N 192 HIS HB2 H N N 193 HIS HB3 H N N 194 HIS HD1 H N N 195 HIS HD2 H N N 196 HIS HE1 H N N 197 HIS HE2 H N N 198 HIS HXT H N N 199 HOH O O N N 200 HOH H1 H N N 201 HOH H2 H N N 202 ILE N N N N 203 ILE CA C N S 204 ILE C C N N 205 ILE O O N N 206 ILE CB C N S 207 ILE CG1 C N N 208 ILE CG2 C N N 209 ILE CD1 C N N 210 ILE OXT O N N 211 ILE H H N N 212 ILE H2 H N N 213 ILE HA H N N 214 ILE HB H N N 215 ILE HG12 H N N 216 ILE HG13 H N N 217 ILE HG21 H N N 218 ILE HG22 H N N 219 ILE HG23 H N N 220 ILE HD11 H N N 221 ILE HD12 H N N 222 ILE HD13 H N N 223 ILE HXT H N N 224 LEU N N N N 225 LEU CA C N S 226 LEU C C N N 227 LEU O O N N 228 LEU CB C N N 229 LEU CG C N N 230 LEU CD1 C N N 231 LEU CD2 C N N 232 LEU OXT O N N 233 LEU H H N N 234 LEU H2 H N N 235 LEU HA H N N 236 LEU HB2 H N N 237 LEU HB3 H N N 238 LEU HG H N N 239 LEU HD11 H N N 240 LEU HD12 H N N 241 LEU HD13 H N N 242 LEU HD21 H N N 243 LEU HD22 H N N 244 LEU HD23 H N N 245 LEU HXT H N N 246 LYS N N N N 247 LYS CA C N S 248 LYS C C N N 249 LYS O O N N 250 LYS CB C N N 251 LYS CG C N N 252 LYS CD C N N 253 LYS CE C N N 254 LYS NZ N N N 255 LYS OXT O N N 256 LYS H H N N 257 LYS H2 H N N 258 LYS HA H N N 259 LYS HB2 H N N 260 LYS HB3 H N N 261 LYS HG2 H N N 262 LYS HG3 H N N 263 LYS HD2 H N N 264 LYS HD3 H N N 265 LYS HE2 H N N 266 LYS HE3 H N N 267 LYS HZ1 H N N 268 LYS HZ2 H N N 269 LYS HZ3 H N N 270 LYS HXT H N N 271 MET N N N N 272 MET CA C N S 273 MET C C N N 274 MET O O N N 275 MET CB C N N 276 MET CG C N N 277 MET SD S N N 278 MET CE C N N 279 MET OXT O N N 280 MET H H N N 281 MET H2 H N N 282 MET HA H N N 283 MET HB2 H N N 284 MET HB3 H N N 285 MET HG2 H N N 286 MET HG3 H N N 287 MET HE1 H N N 288 MET HE2 H N N 289 MET HE3 H N N 290 MET HXT H N N 291 PHE N N N N 292 PHE CA C N S 293 PHE C C N N 294 PHE O O N N 295 PHE CB C N N 296 PHE CG C Y N 297 PHE CD1 C Y N 298 PHE CD2 C Y N 299 PHE CE1 C Y N 300 PHE CE2 C Y N 301 PHE CZ C Y N 302 PHE OXT O N N 303 PHE H H N N 304 PHE H2 H N N 305 PHE HA H N N 306 PHE HB2 H N N 307 PHE HB3 H N N 308 PHE HD1 H N N 309 PHE HD2 H N N 310 PHE HE1 H N N 311 PHE HE2 H N N 312 PHE HZ H N N 313 PHE HXT H N N 314 PRO N N N N 315 PRO CA C N S 316 PRO C C N N 317 PRO O O N N 318 PRO CB C N N 319 PRO CG C N N 320 PRO CD C N N 321 PRO OXT O N N 322 PRO H H N N 323 PRO HA H N N 324 PRO HB2 H N N 325 PRO HB3 H N N 326 PRO HG2 H N N 327 PRO HG3 H N N 328 PRO HD2 H N N 329 PRO HD3 H N N 330 PRO HXT H N N 331 SER N N N N 332 SER CA C N S 333 SER C C N N 334 SER O O N N 335 SER CB C N N 336 SER OG O N N 337 SER OXT O N N 338 SER H H N N 339 SER H2 H N N 340 SER HA H N N 341 SER HB2 H N N 342 SER HB3 H N N 343 SER HG H N N 344 SER HXT H N N 345 THR N N N N 346 THR CA C N S 347 THR C C N N 348 THR O O N N 349 THR CB C N R 350 THR OG1 O N N 351 THR CG2 C N N 352 THR OXT O N N 353 THR H H N N 354 THR H2 H N N 355 THR HA H N N 356 THR HB H N N 357 THR HG1 H N N 358 THR HG21 H N N 359 THR HG22 H N N 360 THR HG23 H N N 361 THR HXT H N N 362 TYR N N N N 363 TYR CA C N S 364 TYR C C N N 365 TYR O O N N 366 TYR CB C N N 367 TYR CG C Y N 368 TYR CD1 C Y N 369 TYR CD2 C Y N 370 TYR CE1 C Y N 371 TYR CE2 C Y N 372 TYR CZ C Y N 373 TYR OH O N N 374 TYR OXT O N N 375 TYR H H N N 376 TYR H2 H N N 377 TYR HA H N N 378 TYR HB2 H N N 379 TYR HB3 H N N 380 TYR HD1 H N N 381 TYR HD2 H N N 382 TYR HE1 H N N 383 TYR HE2 H N N 384 TYR HH H N N 385 TYR HXT H N N 386 VAL N N N N 387 VAL CA C N S 388 VAL C C N N 389 VAL O O N N 390 VAL CB C N N 391 VAL CG1 C N N 392 VAL CG2 C N N 393 VAL OXT O N N 394 VAL H H N N 395 VAL H2 H N N 396 VAL HA H N N 397 VAL HB H N N 398 VAL HG11 H N N 399 VAL HG12 H N N 400 VAL HG13 H N N 401 VAL HG21 H N N 402 VAL HG22 H N N 403 VAL HG23 H N N 404 VAL HXT H N N 405 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DAT PB O1B doub N N 83 DAT PB O2B sing N N 84 DAT PB O3B sing N N 85 DAT PB O3A sing N N 86 DAT O2B HOB2 sing N N 87 DAT O3B HOB3 sing N N 88 DAT PA O1A doub N N 89 DAT PA O2A sing N N 90 DAT PA O3A sing N N 91 DAT PA "O5'" sing N N 92 DAT O2A HOA2 sing N N 93 DAT "O5'" "C5'" sing N N 94 DAT "C5'" "C4'" sing N N 95 DAT "C5'" "H5'1" sing N N 96 DAT "C5'" "H5'2" sing N N 97 DAT "C4'" "O4'" sing N N 98 DAT "C4'" "C3'" sing N N 99 DAT "C4'" "H4'" sing N N 100 DAT "O4'" "C1'" sing N N 101 DAT "C3'" "O3'" sing N N 102 DAT "C3'" "C2'" sing N N 103 DAT "C3'" "H3'" sing N N 104 DAT "O3'" "HO3'" sing N N 105 DAT "C2'" "C1'" sing N N 106 DAT "C2'" "H2'1" sing N N 107 DAT "C2'" "H2'2" sing N N 108 DAT "C1'" N9 sing N N 109 DAT "C1'" "H1'" sing N N 110 DAT N9 C8 sing Y N 111 DAT N9 C4 sing Y N 112 DAT C8 N7 doub Y N 113 DAT C8 H8 sing N N 114 DAT N7 C5 sing Y N 115 DAT C5 C6 sing Y N 116 DAT C5 C4 doub Y N 117 DAT C6 N6 sing N N 118 DAT C6 N1 doub Y N 119 DAT N6 HN61 sing N N 120 DAT N6 HN62 sing N N 121 DAT N1 C2 sing Y N 122 DAT C2 N3 doub Y N 123 DAT C2 H2 sing N N 124 DAT N3 C4 sing Y N 125 GLN N CA sing N N 126 GLN N H sing N N 127 GLN N H2 sing N N 128 GLN CA C sing N N 129 GLN CA CB sing N N 130 GLN CA HA sing N N 131 GLN C O doub N N 132 GLN C OXT sing N N 133 GLN CB CG sing N N 134 GLN CB HB2 sing N N 135 GLN CB HB3 sing N N 136 GLN CG CD sing N N 137 GLN CG HG2 sing N N 138 GLN CG HG3 sing N N 139 GLN CD OE1 doub N N 140 GLN CD NE2 sing N N 141 GLN NE2 HE21 sing N N 142 GLN NE2 HE22 sing N N 143 GLN OXT HXT sing N N 144 GLU N CA sing N N 145 GLU N H sing N N 146 GLU N H2 sing N N 147 GLU CA C sing N N 148 GLU CA CB sing N N 149 GLU CA HA sing N N 150 GLU C O doub N N 151 GLU C OXT sing N N 152 GLU CB CG sing N N 153 GLU CB HB2 sing N N 154 GLU CB HB3 sing N N 155 GLU CG CD sing N N 156 GLU CG HG2 sing N N 157 GLU CG HG3 sing N N 158 GLU CD OE1 doub N N 159 GLU CD OE2 sing N N 160 GLU OE2 HE2 sing N N 161 GLU OXT HXT sing N N 162 GLY N CA sing N N 163 GLY N H sing N N 164 GLY N H2 sing N N 165 GLY CA C sing N N 166 GLY CA HA2 sing N N 167 GLY CA HA3 sing N N 168 GLY C O doub N N 169 GLY C OXT sing N N 170 GLY OXT HXT sing N N 171 HIS N CA sing N N 172 HIS N H sing N N 173 HIS N H2 sing N N 174 HIS CA C sing N N 175 HIS CA CB sing N N 176 HIS CA HA sing N N 177 HIS C O doub N N 178 HIS C OXT sing N N 179 HIS CB CG sing N N 180 HIS CB HB2 sing N N 181 HIS CB HB3 sing N N 182 HIS CG ND1 sing Y N 183 HIS CG CD2 doub Y N 184 HIS ND1 CE1 doub Y N 185 HIS ND1 HD1 sing N N 186 HIS CD2 NE2 sing Y N 187 HIS CD2 HD2 sing N N 188 HIS CE1 NE2 sing Y N 189 HIS CE1 HE1 sing N N 190 HIS NE2 HE2 sing N N 191 HIS OXT HXT sing N N 192 HOH O H1 sing N N 193 HOH O H2 sing N N 194 ILE N CA sing N N 195 ILE N H sing N N 196 ILE N H2 sing N N 197 ILE CA C sing N N 198 ILE CA CB sing N N 199 ILE CA HA sing N N 200 ILE C O doub N N 201 ILE C OXT sing N N 202 ILE CB CG1 sing N N 203 ILE CB CG2 sing N N 204 ILE CB HB sing N N 205 ILE CG1 CD1 sing N N 206 ILE CG1 HG12 sing N N 207 ILE CG1 HG13 sing N N 208 ILE CG2 HG21 sing N N 209 ILE CG2 HG22 sing N N 210 ILE CG2 HG23 sing N N 211 ILE CD1 HD11 sing N N 212 ILE CD1 HD12 sing N N 213 ILE CD1 HD13 sing N N 214 ILE OXT HXT sing N N 215 LEU N CA sing N N 216 LEU N H sing N N 217 LEU N H2 sing N N 218 LEU CA C sing N N 219 LEU CA CB sing N N 220 LEU CA HA sing N N 221 LEU C O doub N N 222 LEU C OXT sing N N 223 LEU CB CG sing N N 224 LEU CB HB2 sing N N 225 LEU CB HB3 sing N N 226 LEU CG CD1 sing N N 227 LEU CG CD2 sing N N 228 LEU CG HG sing N N 229 LEU CD1 HD11 sing N N 230 LEU CD1 HD12 sing N N 231 LEU CD1 HD13 sing N N 232 LEU CD2 HD21 sing N N 233 LEU CD2 HD22 sing N N 234 LEU CD2 HD23 sing N N 235 LEU OXT HXT sing N N 236 LYS N CA sing N N 237 LYS N H sing N N 238 LYS N H2 sing N N 239 LYS CA C sing N N 240 LYS CA CB sing N N 241 LYS CA HA sing N N 242 LYS C O doub N N 243 LYS C OXT sing N N 244 LYS CB CG sing N N 245 LYS CB HB2 sing N N 246 LYS CB HB3 sing N N 247 LYS CG CD sing N N 248 LYS CG HG2 sing N N 249 LYS CG HG3 sing N N 250 LYS CD CE sing N N 251 LYS CD HD2 sing N N 252 LYS CD HD3 sing N N 253 LYS CE NZ sing N N 254 LYS CE HE2 sing N N 255 LYS CE HE3 sing N N 256 LYS NZ HZ1 sing N N 257 LYS NZ HZ2 sing N N 258 LYS NZ HZ3 sing N N 259 LYS OXT HXT sing N N 260 MET N CA sing N N 261 MET N H sing N N 262 MET N H2 sing N N 263 MET CA C sing N N 264 MET CA CB sing N N 265 MET CA HA sing N N 266 MET C O doub N N 267 MET C OXT sing N N 268 MET CB CG sing N N 269 MET CB HB2 sing N N 270 MET CB HB3 sing N N 271 MET CG SD sing N N 272 MET CG HG2 sing N N 273 MET CG HG3 sing N N 274 MET SD CE sing N N 275 MET CE HE1 sing N N 276 MET CE HE2 sing N N 277 MET CE HE3 sing N N 278 MET OXT HXT sing N N 279 PHE N CA sing N N 280 PHE N H sing N N 281 PHE N H2 sing N N 282 PHE CA C sing N N 283 PHE CA CB sing N N 284 PHE CA HA sing N N 285 PHE C O doub N N 286 PHE C OXT sing N N 287 PHE CB CG sing N N 288 PHE CB HB2 sing N N 289 PHE CB HB3 sing N N 290 PHE CG CD1 doub Y N 291 PHE CG CD2 sing Y N 292 PHE CD1 CE1 sing Y N 293 PHE CD1 HD1 sing N N 294 PHE CD2 CE2 doub Y N 295 PHE CD2 HD2 sing N N 296 PHE CE1 CZ doub Y N 297 PHE CE1 HE1 sing N N 298 PHE CE2 CZ sing Y N 299 PHE CE2 HE2 sing N N 300 PHE CZ HZ sing N N 301 PHE OXT HXT sing N N 302 PRO N CA sing N N 303 PRO N CD sing N N 304 PRO N H sing N N 305 PRO CA C sing N N 306 PRO CA CB sing N N 307 PRO CA HA sing N N 308 PRO C O doub N N 309 PRO C OXT sing N N 310 PRO CB CG sing N N 311 PRO CB HB2 sing N N 312 PRO CB HB3 sing N N 313 PRO CG CD sing N N 314 PRO CG HG2 sing N N 315 PRO CG HG3 sing N N 316 PRO CD HD2 sing N N 317 PRO CD HD3 sing N N 318 PRO OXT HXT sing N N 319 SER N CA sing N N 320 SER N H sing N N 321 SER N H2 sing N N 322 SER CA C sing N N 323 SER CA CB sing N N 324 SER CA HA sing N N 325 SER C O doub N N 326 SER C OXT sing N N 327 SER CB OG sing N N 328 SER CB HB2 sing N N 329 SER CB HB3 sing N N 330 SER OG HG sing N N 331 SER OXT HXT sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TYR N CA sing N N 349 TYR N H sing N N 350 TYR N H2 sing N N 351 TYR CA C sing N N 352 TYR CA CB sing N N 353 TYR CA HA sing N N 354 TYR C O doub N N 355 TYR C OXT sing N N 356 TYR CB CG sing N N 357 TYR CB HB2 sing N N 358 TYR CB HB3 sing N N 359 TYR CG CD1 doub Y N 360 TYR CG CD2 sing Y N 361 TYR CD1 CE1 sing Y N 362 TYR CD1 HD1 sing N N 363 TYR CD2 CE2 doub Y N 364 TYR CD2 HD2 sing N N 365 TYR CE1 CZ doub Y N 366 TYR CE1 HE1 sing N N 367 TYR CE2 CZ sing Y N 368 TYR CE2 HE2 sing N N 369 TYR CZ OH sing N N 370 TYR OH HH sing N N 371 TYR OXT HXT sing N N 372 VAL N CA sing N N 373 VAL N H sing N N 374 VAL N H2 sing N N 375 VAL CA C sing N N 376 VAL CA CB sing N N 377 VAL CA HA sing N N 378 VAL C O doub N N 379 VAL C OXT sing N N 380 VAL CB CG1 sing N N 381 VAL CB CG2 sing N N 382 VAL CB HB sing N N 383 VAL CG1 HG11 sing N N 384 VAL CG1 HG12 sing N N 385 VAL CG1 HG13 sing N N 386 VAL CG2 HG21 sing N N 387 VAL CG2 HG22 sing N N 388 VAL CG2 HG23 sing N N 389 VAL OXT HXT sing N N 390 # _pdbx_audit_support.funding_organization 'Max Planck Society' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id DAT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id DAT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2J9D _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7P4V _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011455 _atom_sites.fract_transf_matrix[1][2] 0.006614 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013227 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021734 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O P S # loop_