data_7PVC # _entry.id 7PVC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PVC pdb_00007pvc 10.2210/pdb7pvc/pdb WWPDB D_1292117503 ? ? BMRB 25839 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2021-10-13 _pdbx_database_PDB_obs_spr.pdb_id 7PVC _pdbx_database_PDB_obs_spr.replace_pdb_id 5FIM _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'structure determined before K+ binding site identified' 5FIM re-refinement BMRB . 25839 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PVC _pdbx_database_status.recvd_initial_deposition_date 2021-10-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Smith, B.O.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-3363-4168 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary 'ACS Sens' ? ? 2379-3694 ? ? 7 ? 1336 1346 ;Tuning the Sensitivity of Genetically Encoded Fluorescent Potassium Indicators through Structure-Guided and Genome Mining Strategies. ; 2022 ? 10.1021/acssensors.1c02201 35427452 ? ? ? ? ? ? ? ? ? UK ? ? 1 Structure STRUE6 2005 1878-4186 ? ? 24 ? 741 749 'The Potassium Binding Protein Kbp Is a Cytoplasmic Potassium Sensor.' 2016 ? 10.1016/j.str.2016.03.017 27112601 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Torres Caban, C.C.' 1 ? primary 'Yang, M.' 2 ? primary 'Lai, C.' 3 ? primary 'Yang, L.' 4 ? primary 'Subach, F.V.' 5 ? primary 'Smith, B.O.' 6 ? primary 'Piatkevich, K.D.' 7 ? primary 'Boyden, E.S.' 8 ? 1 'Ashraf, K.U.' 9 ? 1 'Josts, I.' 10 ? 1 'Mosbahi, K.' 11 ? 1 'Kelly, S.M.' 12 ? 1 'Byron, O.' 13 ? 1 'Smith, B.O.' 14 ? 1 'Walker, D.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Potassium binding protein Kbp' 17154.236 1 ? 'C-terminal His-tag' ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'K(+) binding protein Kbp' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGI ASVDDQVKTATPATASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGI ASVDDQVKTATPATASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LEU n 1 4 PHE n 1 5 ASN n 1 6 PHE n 1 7 VAL n 1 8 LYS n 1 9 ASP n 1 10 ALA n 1 11 GLY n 1 12 GLU n 1 13 LYS n 1 14 LEU n 1 15 TRP n 1 16 ASP n 1 17 ALA n 1 18 VAL n 1 19 THR n 1 20 GLY n 1 21 GLN n 1 22 HIS n 1 23 ASP n 1 24 LYS n 1 25 ASP n 1 26 ASP n 1 27 GLN n 1 28 ALA n 1 29 LYS n 1 30 LYS n 1 31 VAL n 1 32 GLN n 1 33 GLU n 1 34 HIS n 1 35 LEU n 1 36 ASN n 1 37 LYS n 1 38 THR n 1 39 GLY n 1 40 ILE n 1 41 PRO n 1 42 ASP n 1 43 ALA n 1 44 ASP n 1 45 LYS n 1 46 VAL n 1 47 ASN n 1 48 ILE n 1 49 GLN n 1 50 ILE n 1 51 ALA n 1 52 ASP n 1 53 GLY n 1 54 LYS n 1 55 ALA n 1 56 THR n 1 57 VAL n 1 58 THR n 1 59 GLY n 1 60 ASP n 1 61 GLY n 1 62 LEU n 1 63 SER n 1 64 GLN n 1 65 GLU n 1 66 ALA n 1 67 LYS n 1 68 GLU n 1 69 LYS n 1 70 ILE n 1 71 LEU n 1 72 VAL n 1 73 ALA n 1 74 VAL n 1 75 GLY n 1 76 ASN n 1 77 ILE n 1 78 SER n 1 79 GLY n 1 80 ILE n 1 81 ALA n 1 82 SER n 1 83 VAL n 1 84 ASP n 1 85 ASP n 1 86 GLN n 1 87 VAL n 1 88 LYS n 1 89 THR n 1 90 ALA n 1 91 THR n 1 92 PRO n 1 93 ALA n 1 94 THR n 1 95 ALA n 1 96 SER n 1 97 GLN n 1 98 PHE n 1 99 TYR n 1 100 THR n 1 101 VAL n 1 102 LYS n 1 103 SER n 1 104 GLY n 1 105 ASP n 1 106 THR n 1 107 LEU n 1 108 SER n 1 109 ALA n 1 110 ILE n 1 111 SER n 1 112 LYS n 1 113 GLN n 1 114 VAL n 1 115 TYR n 1 116 GLY n 1 117 ASN n 1 118 ALA n 1 119 ASN n 1 120 LEU n 1 121 TYR n 1 122 ASN n 1 123 LYS n 1 124 ILE n 1 125 PHE n 1 126 GLU n 1 127 ALA n 1 128 ASN n 1 129 LYS n 1 130 PRO n 1 131 MET n 1 132 LEU n 1 133 LYS n 1 134 SER n 1 135 PRO n 1 136 ASP n 1 137 LYS n 1 138 ILE n 1 139 TYR n 1 140 PRO n 1 141 GLY n 1 142 GLN n 1 143 VAL n 1 144 LEU n 1 145 ARG n 1 146 ILE n 1 147 PRO n 1 148 GLU n 1 149 GLU n 1 150 LEU n 1 151 GLU n 1 152 HIS n 1 153 HIS n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 157 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'kbp, ygaU, yzzM, b2665, JW2640' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'pET28 backbone' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pKA1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KBP_ECOLI _struct_ref.pdbx_db_accession P0ADE6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGI ASVDDQVKTATPATASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PVC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ADE6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PVC LEU A 150 ? UNP P0ADE6 ? ? 'expression tag' 150 1 1 7PVC GLU A 151 ? UNP P0ADE6 ? ? 'expression tag' 151 2 1 7PVC HIS A 152 ? UNP P0ADE6 ? ? 'expression tag' 152 3 1 7PVC HIS A 153 ? UNP P0ADE6 ? ? 'expression tag' 153 4 1 7PVC HIS A 154 ? UNP P0ADE6 ? ? 'expression tag' 154 5 1 7PVC HIS A 155 ? UNP P0ADE6 ? ? 'expression tag' 155 6 1 7PVC HIS A 156 ? UNP P0ADE6 ? ? 'expression tag' 156 7 1 7PVC HIS A 157 ? UNP P0ADE6 ? ? 'expression tag' 157 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D 1H-13C NOESY' 1 isotropic 4 1 1 '2D HBCBCGHD' 1 isotropic 5 1 1 '2D HBCBCGHE' 1 isotropic 6 1 1 '3D HBHA(CO)NH' 1 isotropic 7 1 1 '3D HBHANH' 1 isotropic 8 1 1 '3D H(CCO)NH' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 1 '3D HNCACB' 1 isotropic 11 1 1 '3D HNCACO' 1 isotropic 12 1 1 '3D HNCO' 1 isotropic 13 1 1 '3D (H)C(CCO)NH' 1 isotropic 14 1 1 '2D 1H-15N HSQC' 1 isotropic 15 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label CN.2 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM [U-13C; U-15N] Kbp, 20 mM sodium phosphate, 5 mM potassium chloride, 0.01 % sodium azide, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label CN.2 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 7PVC 'simulated annealing' ? 2 7PVC 'simulated annealing' ? 3 # _pdbx_nmr_ensemble.entry_id 7PVC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7PVC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' 2 CCPN 2 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 3 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PVC _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7PVC _struct.title 'The structure of Kbp.K from E. coli with potassium bound.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PVC _struct_keywords.text 'potassium ion binding metal ion binding response to potassium ion response to stimulus cytoplasm, Metal Binding Protein' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 23 ? GLY A 39 ? ASP A 23 GLY A 39 1 ? 17 HELX_P HELX_P2 AA2 GLN A 64 ? ASN A 76 ? GLN A 64 ASN A 76 1 ? 13 HELX_P HELX_P3 AA3 THR A 106 ? TYR A 115 ? THR A 106 TYR A 115 1 ? 10 HELX_P HELX_P4 AA4 ASN A 117 ? ASN A 119 ? ASN A 117 ASN A 119 5 ? 3 HELX_P HELX_P5 AA5 LEU A 120 ? LYS A 129 ? LEU A 120 LYS A 129 1 ? 10 HELX_P HELX_P6 AA6 SER A 134 ? ILE A 138 ? SER A 134 ILE A 138 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A VAL 7 O ? ? ? 1_555 B K . K ? ? A VAL 7 A K 201 1_555 ? ? ? ? ? ? ? 2.684 ? ? metalc2 metalc ? ? A ALA 10 O ? ? ? 1_555 B K . K ? ? A ALA 10 A K 201 1_555 ? ? ? ? ? ? ? 2.631 ? ? metalc3 metalc ? ? A GLY 75 O ? ? ? 1_555 B K . K ? ? A GLY 75 A K 201 1_555 ? ? ? ? ? ? ? 2.614 ? ? metalc4 metalc ? ? A ILE 77 O ? ? ? 1_555 B K . K ? ? A ILE 77 A K 201 1_555 ? ? ? ? ? ? ? 2.701 ? ? metalc5 metalc ? ? A ILE 80 O ? ? ? 1_555 B K . K ? ? A ILE 80 A K 201 1_555 ? ? ? ? ? ? ? 2.655 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 1 -7.58 2 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 2 0.04 3 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 3 -7.60 4 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 4 -5.82 5 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 5 -7.58 6 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 6 -6.85 7 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 7 -3.82 8 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 8 -9.71 9 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 9 -5.70 10 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 10 6.93 11 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 11 -6.27 12 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 12 -10.11 13 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 13 -7.58 14 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 14 -5.29 15 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 15 7.54 16 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 16 -6.93 17 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 17 -8.00 18 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 18 -8.47 19 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 19 7.23 20 LYS 129 A . ? LYS 129 A PRO 130 A ? PRO 130 A 20 -6.45 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 3 ? ASN A 5 ? LEU A 3 ASN A 5 AA1 2 SER A 82 ? THR A 91 ? SER A 82 THR A 91 AA1 3 LYS A 54 ? SER A 63 ? LYS A 54 SER A 63 AA1 4 VAL A 46 ? ALA A 51 ? VAL A 46 ALA A 51 AA2 1 GLN A 97 ? THR A 100 ? GLN A 97 THR A 100 AA2 2 VAL A 143 ? ILE A 146 ? VAL A 143 ILE A 146 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 4 ? N PHE A 4 O VAL A 83 ? O VAL A 83 AA1 2 3 O LYS A 88 ? O LYS A 88 N GLY A 59 ? N GLY A 59 AA1 3 4 O THR A 56 ? O THR A 56 N GLN A 49 ? N GLN A 49 AA2 1 2 N GLN A 97 ? N GLN A 97 O ILE A 146 ? O ILE A 146 # _atom_sites.entry_id 7PVC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H K N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 HIS 157 157 157 HIS HIS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email Brian.Smith@glasgow.ac.uk _pdbx_contact_author.name_first Brian _pdbx_contact_author.name_last Smith _pdbx_contact_author.name_mi O _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3363-4168 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id K _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 158 _pdbx_nonpoly_scheme.pdb_mon_id K _pdbx_nonpoly_scheme.auth_mon_id K _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8320 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A VAL 7 ? A VAL 7 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ALA 10 ? A ALA 10 ? 1_555 118.3 ? 2 O ? A VAL 7 ? A VAL 7 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A GLY 75 ? A GLY 75 ? 1_555 97.3 ? 3 O ? A ALA 10 ? A ALA 10 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A GLY 75 ? A GLY 75 ? 1_555 127.4 ? 4 O ? A VAL 7 ? A VAL 7 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ILE 77 ? A ILE 77 ? 1_555 124.4 ? 5 O ? A ALA 10 ? A ALA 10 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ILE 77 ? A ILE 77 ? 1_555 71.4 ? 6 O ? A GLY 75 ? A GLY 75 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ILE 77 ? A ILE 77 ? 1_555 119.9 ? 7 O ? A VAL 7 ? A VAL 7 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ILE 80 ? A ILE 80 ? 1_555 56.3 ? 8 O ? A ALA 10 ? A ALA 10 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ILE 80 ? A ILE 80 ? 1_555 129.2 ? 9 O ? A GLY 75 ? A GLY 75 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ILE 80 ? A ILE 80 ? 1_555 102.3 ? 10 O ? A ILE 77 ? A ILE 77 ? 1_555 K ? B K . ? A K 201 ? 1_555 O ? A ILE 80 ? A ILE 80 ? 1_555 75.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-13 2 'Structure model' 1 1 2021-12-29 3 'Structure model' 1 2 2022-02-16 4 'Structure model' 1 3 2022-05-04 5 'Structure model' 1 4 2022-06-08 6 'Structure model' 1 5 2022-06-15 7 'Structure model' 1 6 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 6 'Structure model' 'Database references' 6 7 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' struct_keywords 2 3 'Structure model' struct 3 4 'Structure model' citation 4 4 'Structure model' citation_author 5 5 'Structure model' citation 6 5 'Structure model' citation_author 7 6 'Structure model' citation 8 7 'Structure model' chem_comp_atom 9 7 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_keywords.text' 2 3 'Structure model' '_struct.title' 3 4 'Structure model' '_citation.journal_abbrev' 4 4 'Structure model' '_citation.journal_id_CSD' 5 4 'Structure model' '_citation.journal_id_ISSN' 6 4 'Structure model' '_citation.pdbx_database_id_DOI' 7 4 'Structure model' '_citation.pdbx_database_id_PubMed' 8 4 'Structure model' '_citation.title' 9 4 'Structure model' '_citation.year' 10 4 'Structure model' '_citation_author.identifier_ORCID' 11 4 'Structure model' '_citation_author.name' 12 5 'Structure model' '_citation.journal_volume' 13 5 'Structure model' '_citation.page_first' 14 5 'Structure model' '_citation.page_last' 15 5 'Structure model' '_citation_author.identifier_ORCID' 16 6 'Structure model' '_citation.pdbx_database_id_PubMed' # _pdbx_entry_details.entry_id 7PVC _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Kbp 1.5 ? mM '[U-13C; U-15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'potassium chloride' 5 ? mM 'natural abundance' 1 'sodium azide' 0.01 ? % 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A GLN 49 ? ? H A THR 56 ? ? 1.59 2 3 HH A TYR 99 ? ? HE21 A GLN 113 ? ? 1.33 3 3 O A GLN 97 ? ? H A ILE 146 ? ? 1.60 4 6 HZ2 A LYS 67 ? ? OE1 A GLU 68 ? ? 1.59 5 6 O A VAL 57 ? ? H A GLN 86 ? ? 1.59 6 7 HH A TYR 99 ? ? HE21 A GLN 113 ? ? 1.26 7 7 HZ3 A LYS 67 ? ? OE1 A GLU 68 ? ? 1.58 8 7 O A GLN 97 ? ? H A ILE 146 ? ? 1.59 9 7 H3 A MET 1 ? ? OD1 A ASP 84 ? ? 1.59 10 8 HA2 A GLY 11 ? ? HH A TYR 139 ? ? 1.32 11 8 OD1 A ASP 26 ? ? HZ2 A LYS 30 ? ? 1.56 12 8 O A GLY 53 ? ? H A ALA 81 ? ? 1.59 13 9 O A GLY 53 ? ? H A ALA 81 ? ? 1.59 14 9 OD1 A ASP 26 ? ? HZ3 A LYS 30 ? ? 1.59 15 9 O A GLN 49 ? ? H A THR 56 ? ? 1.60 16 10 HZ3 A LYS 123 ? ? OE1 A GLU 151 ? ? 1.53 17 10 O A PHE 125 ? ? H A LYS 129 ? ? 1.58 18 12 O A GLN 97 ? ? H A ILE 146 ? ? 1.59 19 14 O A GLN 49 ? ? H A THR 56 ? ? 1.53 20 15 O A GLN 97 ? ? H A ILE 146 ? ? 1.59 21 17 O A VAL 57 ? ? H A GLN 86 ? ? 1.58 22 17 OD1 A ASP 26 ? ? HZ2 A LYS 30 ? ? 1.59 23 19 HH A TYR 99 ? ? HE21 A GLN 113 ? ? 1.34 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CE1 A TYR 115 ? ? CZ A TYR 115 ? ? 1.291 1.381 -0.090 0.013 N 2 9 CE1 A TYR 115 ? ? CZ A TYR 115 ? ? 1.302 1.381 -0.079 0.013 N 3 13 CE1 A TYR 115 ? ? CZ A TYR 115 ? ? 1.265 1.381 -0.116 0.013 N 4 13 CZ A TYR 115 ? ? CE2 A TYR 115 ? ? 1.485 1.381 0.104 0.013 N 5 19 CE1 A PHE 125 ? ? CZ A PHE 125 ? ? 1.500 1.369 0.131 0.019 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 21 ? ? 68.74 -83.38 2 1 HIS A 22 ? ? -136.07 -72.82 3 1 VAL A 46 ? ? -104.66 -169.24 4 1 ASP A 52 ? ? 68.17 -72.03 5 1 ASN A 76 ? ? -107.57 46.10 6 1 PRO A 140 ? ? -53.93 108.64 7 1 GLU A 151 ? ? 54.39 88.73 8 1 HIS A 154 ? ? 62.61 -155.68 9 1 HIS A 155 ? ? 67.79 -70.63 10 2 ASP A 16 ? ? 64.63 104.48 11 2 GLN A 21 ? ? 72.27 -76.52 12 2 HIS A 22 ? ? -174.54 -41.02 13 2 ALA A 51 ? ? -111.50 69.35 14 2 ASP A 52 ? ? 69.16 -71.53 15 2 PRO A 140 ? ? -53.35 109.70 16 2 HIS A 154 ? ? -79.87 -78.16 17 2 HIS A 155 ? ? 57.19 -174.20 18 2 HIS A 156 ? ? -167.18 -30.92 19 3 VAL A 18 ? ? -124.10 -58.73 20 3 GLN A 21 ? ? 73.67 131.90 21 3 ASP A 42 ? ? 57.47 18.47 22 3 ASP A 52 ? ? 71.14 -67.50 23 3 ASN A 76 ? ? -107.39 41.78 24 3 ALA A 90 ? ? 67.65 -43.58 25 3 LYS A 137 ? ? -93.31 32.51 26 3 PRO A 140 ? ? -51.77 108.76 27 3 GLU A 151 ? ? 74.20 -23.58 28 3 HIS A 152 ? ? 58.91 -115.38 29 3 HIS A 156 ? ? 71.10 128.36 30 4 ASP A 16 ? ? 65.41 -7.79 31 4 VAL A 18 ? ? -120.19 -78.19 32 4 ASP A 52 ? ? 69.63 -67.65 33 4 PRO A 140 ? ? -55.67 103.95 34 4 LEU A 150 ? ? -80.19 47.78 35 4 GLU A 151 ? ? 63.77 111.25 36 4 HIS A 153 ? ? 67.40 -175.87 37 4 HIS A 154 ? ? 68.34 167.03 38 5 PHE A 6 ? ? -127.32 -169.70 39 5 LYS A 8 ? ? -105.31 -62.77 40 5 TRP A 15 ? ? -143.04 -81.61 41 5 ASP A 16 ? ? 168.54 -78.25 42 5 LYS A 24 ? ? -142.63 -71.50 43 5 ASP A 42 ? ? 57.10 18.22 44 5 ASP A 52 ? ? 73.49 -62.72 45 5 ASN A 76 ? ? -102.04 57.91 46 5 PRO A 140 ? ? -56.04 107.20 47 5 LEU A 150 ? ? -68.93 90.52 48 5 GLU A 151 ? ? 59.42 -176.67 49 6 ASP A 16 ? ? 66.96 103.14 50 6 GLN A 21 ? ? 62.54 90.40 51 6 LYS A 24 ? ? -158.56 -98.78 52 6 ASP A 52 ? ? 70.43 -66.82 53 6 PRO A 140 ? ? -55.44 103.09 54 6 GLU A 149 ? ? -56.83 85.67 55 6 GLU A 151 ? ? -161.87 -43.87 56 6 HIS A 152 ? ? 68.50 157.81 57 6 HIS A 153 ? ? 69.70 148.04 58 7 TRP A 15 ? ? -147.07 24.11 59 7 ASP A 16 ? ? 69.14 -15.93 60 7 VAL A 18 ? ? -134.02 -74.43 61 7 ASP A 52 ? ? 68.11 -75.27 62 7 LYS A 137 ? ? -85.67 36.34 63 7 GLU A 151 ? ? -42.51 107.68 64 7 HIS A 155 ? ? -58.21 -73.49 65 8 LYS A 8 ? ? -102.31 -62.49 66 8 TRP A 15 ? ? -145.95 30.28 67 8 VAL A 18 ? ? -90.14 49.37 68 8 HIS A 22 ? ? 75.52 -11.29 69 8 ASP A 52 ? ? 69.79 -67.31 70 8 PRO A 140 ? ? -53.93 104.96 71 8 GLU A 149 ? ? -60.56 91.87 72 8 LEU A 150 ? ? -109.69 40.24 73 8 HIS A 152 ? ? 68.46 -67.27 74 8 HIS A 153 ? ? -132.03 -56.11 75 8 HIS A 154 ? ? -179.87 141.46 76 9 THR A 19 ? ? 76.09 -36.29 77 9 HIS A 22 ? ? 68.58 -75.56 78 9 ASP A 42 ? ? 58.03 18.80 79 9 ASP A 52 ? ? 70.55 -69.63 80 9 PRO A 130 ? ? -89.11 30.16 81 9 PRO A 140 ? ? -57.11 108.36 82 9 GLU A 149 ? ? -76.99 28.60 83 9 LEU A 150 ? ? 54.14 78.35 84 9 GLU A 151 ? ? 60.54 -80.36 85 10 ASP A 16 ? ? 67.26 114.42 86 10 THR A 19 ? ? 94.67 50.09 87 10 HIS A 22 ? ? -178.83 -27.45 88 10 LYS A 24 ? ? 70.99 -57.44 89 10 ASP A 42 ? ? 55.22 19.45 90 10 ASP A 52 ? ? 67.88 -5.21 91 10 ASN A 76 ? ? -93.24 54.90 92 10 ALA A 93 ? ? -157.48 -157.36 93 10 PRO A 130 ? ? -87.78 35.46 94 10 PRO A 140 ? ? -56.83 106.97 95 10 GLU A 149 ? ? -58.64 102.17 96 10 HIS A 152 ? ? 70.62 -173.57 97 10 HIS A 153 ? ? 64.96 85.29 98 11 ASP A 9 ? ? -66.18 1.04 99 11 ALA A 17 ? ? -66.64 7.68 100 11 THR A 19 ? ? -146.31 -2.71 101 11 GLN A 21 ? ? -96.70 -99.50 102 11 ASP A 42 ? ? 59.80 17.55 103 11 ASP A 52 ? ? 69.25 -71.63 104 11 SER A 103 ? ? -156.28 -89.38 105 11 PRO A 147 ? ? -57.81 171.58 106 11 GLU A 151 ? ? 64.75 115.60 107 11 HIS A 153 ? ? 50.86 82.48 108 11 HIS A 154 ? ? -65.17 98.47 109 12 ALA A 17 ? ? 72.44 -61.80 110 12 ALA A 51 ? ? -112.30 53.08 111 12 ASP A 52 ? ? 72.36 -68.08 112 12 PRO A 130 ? ? -92.85 33.03 113 12 PRO A 140 ? ? -53.04 107.00 114 12 HIS A 156 ? ? -64.34 -76.59 115 13 ASP A 16 ? ? 69.42 -18.54 116 13 THR A 19 ? ? 71.36 -57.54 117 13 HIS A 22 ? ? -156.21 -63.89 118 13 ASP A 52 ? ? 68.33 -64.86 119 13 ASN A 76 ? ? -87.32 45.92 120 13 ALA A 93 ? ? -165.99 -167.78 121 13 GLU A 149 ? ? -92.86 45.85 122 14 VAL A 18 ? ? -96.09 -63.07 123 14 THR A 19 ? ? -124.62 -52.11 124 14 GLN A 21 ? ? 70.05 110.87 125 14 HIS A 22 ? ? 71.40 -67.86 126 14 ASP A 52 ? ? 71.45 -67.72 127 14 ASP A 84 ? ? -92.83 37.60 128 14 ASP A 85 ? ? -6.20 91.68 129 14 GLU A 149 ? ? -59.51 84.71 130 14 HIS A 152 ? ? 70.81 -70.89 131 14 HIS A 156 ? ? -141.42 30.95 132 15 VAL A 18 ? ? -71.22 -71.84 133 15 THR A 19 ? ? -133.69 -53.39 134 15 HIS A 22 ? ? 70.30 -90.60 135 15 ASP A 42 ? ? 57.12 10.07 136 15 ALA A 51 ? ? -108.96 -73.01 137 15 ASP A 52 ? ? -173.70 107.46 138 15 PRO A 130 ? ? -91.54 39.87 139 15 PRO A 140 ? ? -52.29 105.28 140 15 GLU A 149 ? ? -64.03 90.48 141 15 HIS A 152 ? ? -154.85 25.65 142 15 HIS A 154 ? ? -150.73 -87.70 143 15 HIS A 156 ? ? 72.18 -51.98 144 16 TRP A 15 ? ? -106.66 -77.47 145 16 ASP A 16 ? ? -178.84 -19.87 146 16 GLN A 21 ? ? 73.92 -51.49 147 16 HIS A 22 ? ? -132.74 -83.96 148 16 ASP A 52 ? ? 73.25 -61.57 149 16 PRO A 140 ? ? -55.95 105.38 150 16 GLU A 149 ? ? -64.03 90.78 151 16 LEU A 150 ? ? -98.02 41.38 152 16 GLU A 151 ? ? 71.88 145.38 153 16 HIS A 152 ? ? -167.78 -45.32 154 17 LYS A 8 ? ? -104.49 -61.62 155 17 TRP A 15 ? ? -117.85 -164.84 156 17 THR A 19 ? ? -130.45 -40.42 157 17 HIS A 22 ? ? 72.24 -88.13 158 17 ALA A 51 ? ? -119.27 74.89 159 17 ASP A 52 ? ? 70.98 -66.20 160 17 PRO A 140 ? ? -50.36 106.58 161 18 TRP A 15 ? ? -146.11 42.79 162 18 VAL A 18 ? ? -87.26 46.27 163 18 GLN A 21 ? ? -93.43 54.05 164 18 HIS A 22 ? ? 73.80 -26.73 165 18 LYS A 24 ? ? 77.60 -60.14 166 18 ALA A 51 ? ? -115.85 -79.48 167 18 ASP A 52 ? ? -166.47 105.94 168 18 LYS A 102 ? ? -93.76 -61.15 169 18 SER A 103 ? ? -148.59 -109.51 170 18 LEU A 150 ? ? -90.59 37.91 171 18 HIS A 152 ? ? -106.30 70.76 172 18 HIS A 154 ? ? -81.81 49.01 173 18 HIS A 156 ? ? -140.34 19.43 174 19 ASP A 16 ? ? 59.81 110.45 175 19 GLN A 21 ? ? 69.28 -77.78 176 19 HIS A 22 ? ? -153.09 -68.43 177 19 ASP A 52 ? ? 68.25 -75.84 178 19 PRO A 140 ? ? -52.12 102.09 179 19 LEU A 150 ? ? -74.45 46.00 180 19 GLU A 151 ? ? 51.41 90.47 181 19 HIS A 155 ? ? 70.06 111.78 182 20 ASP A 16 ? ? 66.19 94.46 183 20 ALA A 17 ? ? -66.54 88.51 184 20 VAL A 18 ? ? -122.40 -70.59 185 20 GLN A 21 ? ? 73.29 -49.88 186 20 ALA A 51 ? ? -118.80 50.08 187 20 ASP A 52 ? ? 73.86 -57.96 188 20 PRO A 140 ? ? -52.64 104.07 189 20 GLU A 151 ? ? 53.45 72.14 190 20 HIS A 152 ? ? -174.29 27.02 191 20 HIS A 153 ? ? -91.10 55.63 192 20 HIS A 155 ? ? 62.88 84.26 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 15 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 121 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.050 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 K K K N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TRP N N N N 305 TRP CA C N S 306 TRP C C N N 307 TRP O O N N 308 TRP CB C N N 309 TRP CG C Y N 310 TRP CD1 C Y N 311 TRP CD2 C Y N 312 TRP NE1 N Y N 313 TRP CE2 C Y N 314 TRP CE3 C Y N 315 TRP CZ2 C Y N 316 TRP CZ3 C Y N 317 TRP CH2 C Y N 318 TRP OXT O N N 319 TRP H H N N 320 TRP H2 H N N 321 TRP HA H N N 322 TRP HB2 H N N 323 TRP HB3 H N N 324 TRP HD1 H N N 325 TRP HE1 H N N 326 TRP HE3 H N N 327 TRP HZ2 H N N 328 TRP HZ3 H N N 329 TRP HH2 H N N 330 TRP HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id K _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id K _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'POTASSIUM ION' _pdbx_entity_nonpoly.comp_id K # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'isothermal titration calorimetry' ? 2 1 'NMR Distance Restraints' 'From inter-molecular 2J 13C=O...203/205Tl+ couplings observed in Kbp.Tl+ complex' #