data_7PVT # _entry.id 7PVT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PVT pdb_00007pvt 10.2210/pdb7pvt/pdb WWPDB D_1292118487 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-14 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PVT _pdbx_database_status.recvd_initial_deposition_date 2021-10-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email acamara@ual.es _pdbx_contact_author.name_first Ana _pdbx_contact_author.name_last Camara-Artigas _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2197-726X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Camara-Artigas, A.' 1 0000-0003-2197-726X 'Salinas-Garcia, M.C.' 2 0000-0001-9730-3590 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the v-Src SH3 domain Q128R mutant in complex with the synthetic peptide VSL12' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Camara-Artigas, A.' 1 0000-0003-2197-726X primary 'Salinas Garcia, M.C.' 2 0000-0001-9730-3590 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase transforming protein Src' 6861.487 2 2.7.10.2 Q128R ? ? 2 polymer syn VSL12 1317.622 2 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name pp60v-src,p60-Src,v-Src # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GGVTTFVALYDYESWIETDLSFKKGERLQIVNNTEGNWWLAHSVTTGRTGYIPSNYVAPSD GGVTTFVALYDYESWIETDLSFKKGERLQIVNNTEGNWWLAHSVTTGRTGYIPSNYVAPSD A,C ? 2 'polypeptide(L)' no no VSLARRPLPPLP VSLARRPLPPLP B,D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'DI(HYDROXYETHYL)ETHER' PEG 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 VAL n 1 4 THR n 1 5 THR n 1 6 PHE n 1 7 VAL n 1 8 ALA n 1 9 LEU n 1 10 TYR n 1 11 ASP n 1 12 TYR n 1 13 GLU n 1 14 SER n 1 15 TRP n 1 16 ILE n 1 17 GLU n 1 18 THR n 1 19 ASP n 1 20 LEU n 1 21 SER n 1 22 PHE n 1 23 LYS n 1 24 LYS n 1 25 GLY n 1 26 GLU n 1 27 ARG n 1 28 LEU n 1 29 GLN n 1 30 ILE n 1 31 VAL n 1 32 ASN n 1 33 ASN n 1 34 THR n 1 35 GLU n 1 36 GLY n 1 37 ASN n 1 38 TRP n 1 39 TRP n 1 40 LEU n 1 41 ALA n 1 42 HIS n 1 43 SER n 1 44 VAL n 1 45 THR n 1 46 THR n 1 47 GLY n 1 48 ARG n 1 49 THR n 1 50 GLY n 1 51 TYR n 1 52 ILE n 1 53 PRO n 1 54 SER n 1 55 ASN n 1 56 TYR n 1 57 VAL n 1 58 ALA n 1 59 PRO n 1 60 SER n 1 61 ASP n 2 1 VAL n 2 2 SER n 2 3 LEU n 2 4 ALA n 2 5 ARG n 2 6 ARG n 2 7 PRO n 2 8 LEU n 2 9 PRO n 2 10 PRO n 2 11 LEU n 2 12 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 61 _entity_src_gen.gene_src_common_name RSV-SR-E _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene V-SRC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Schmidt-Ruppin E' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rous sarcoma virus (strain Schmidt-Ruppin E)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 270623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHTP1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific unidentified _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32644 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 81 ? ? ? A . n A 1 2 GLY 2 82 ? ? ? A . n A 1 3 VAL 3 83 ? ? ? A . n A 1 4 THR 4 84 84 THR THR A . n A 1 5 THR 5 85 85 THR THR A . n A 1 6 PHE 6 86 86 PHE PHE A . n A 1 7 VAL 7 87 87 VAL VAL A . n A 1 8 ALA 8 88 88 ALA ALA A . n A 1 9 LEU 9 89 89 LEU LEU A . n A 1 10 TYR 10 90 90 TYR TYR A . n A 1 11 ASP 11 91 91 ASP ASP A . n A 1 12 TYR 12 92 92 TYR TYR A . n A 1 13 GLU 13 93 93 GLU GLU A . n A 1 14 SER 14 94 94 SER SER A . n A 1 15 TRP 15 95 95 TRP TRP A . n A 1 16 ILE 16 96 96 ILE ILE A . n A 1 17 GLU 17 97 97 GLU GLU A . n A 1 18 THR 18 98 98 THR THR A . n A 1 19 ASP 19 99 99 ASP ASP A . n A 1 20 LEU 20 100 100 LEU LEU A . n A 1 21 SER 21 101 101 SER SER A . n A 1 22 PHE 22 102 102 PHE PHE A . n A 1 23 LYS 23 103 103 LYS LYS A . n A 1 24 LYS 24 104 104 LYS LYS A . n A 1 25 GLY 25 105 105 GLY GLY A . n A 1 26 GLU 26 106 106 GLU GLU A . n A 1 27 ARG 27 107 107 ARG ARG A . n A 1 28 LEU 28 108 108 LEU LEU A . n A 1 29 GLN 29 109 109 GLN GLN A . n A 1 30 ILE 30 110 110 ILE ILE A . n A 1 31 VAL 31 111 111 VAL VAL A . n A 1 32 ASN 32 112 ? ? ? A . n A 1 33 ASN 33 113 ? ? ? A . n A 1 34 THR 34 114 ? ? ? A . n A 1 35 GLU 35 115 ? ? ? A . n A 1 36 GLY 36 116 116 GLY GLY A . n A 1 37 ASN 37 117 117 ASN ASN A . n A 1 38 TRP 38 118 118 TRP TRP A . n A 1 39 TRP 39 119 119 TRP TRP A . n A 1 40 LEU 40 120 120 LEU LEU A . n A 1 41 ALA 41 121 121 ALA ALA A . n A 1 42 HIS 42 122 122 HIS HIS A . n A 1 43 SER 43 123 123 SER SER A . n A 1 44 VAL 44 124 124 VAL VAL A . n A 1 45 THR 45 125 125 THR THR A . n A 1 46 THR 46 126 126 THR THR A . n A 1 47 GLY 47 127 127 GLY GLY A . n A 1 48 ARG 48 128 128 ARG ARG A . n A 1 49 THR 49 129 129 THR THR A . n A 1 50 GLY 50 130 130 GLY GLY A . n A 1 51 TYR 51 131 131 TYR TYR A . n A 1 52 ILE 52 132 132 ILE ILE A . n A 1 53 PRO 53 133 133 PRO PRO A . n A 1 54 SER 54 134 134 SER SER A . n A 1 55 ASN 55 135 135 ASN ASN A . n A 1 56 TYR 56 136 136 TYR TYR A . n A 1 57 VAL 57 137 137 VAL VAL A . n A 1 58 ALA 58 138 138 ALA ALA A . n A 1 59 PRO 59 139 139 PRO PRO A . n A 1 60 SER 60 140 140 SER SER A . n A 1 61 ASP 61 141 ? ? ? A . n B 2 1 VAL 1 1 ? ? ? B . n B 2 2 SER 2 2 ? ? ? B . n B 2 3 LEU 3 3 3 LEU LEU B . n B 2 4 ALA 4 4 4 ALA ALA B . n B 2 5 ARG 5 5 5 ARG ARG B . n B 2 6 ARG 6 6 6 ARG ARG B . n B 2 7 PRO 7 7 7 PRO PRO B . n B 2 8 LEU 8 8 8 LEU LEU B . n B 2 9 PRO 9 9 9 PRO PRO B . n B 2 10 PRO 10 10 10 PRO PRO B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 PRO 12 12 12 PRO PRO B . n C 1 1 GLY 1 81 ? ? ? C . n C 1 2 GLY 2 82 ? ? ? C . n C 1 3 VAL 3 83 ? ? ? C . n C 1 4 THR 4 84 84 THR THR C . n C 1 5 THR 5 85 85 THR THR C . n C 1 6 PHE 6 86 86 PHE PHE C . n C 1 7 VAL 7 87 87 VAL VAL C . n C 1 8 ALA 8 88 88 ALA ALA C . n C 1 9 LEU 9 89 89 LEU LEU C . n C 1 10 TYR 10 90 90 TYR TYR C . n C 1 11 ASP 11 91 91 ASP ASP C . n C 1 12 TYR 12 92 92 TYR TYR C . n C 1 13 GLU 13 93 93 GLU GLU C . n C 1 14 SER 14 94 94 SER SER C . n C 1 15 TRP 15 95 95 TRP TRP C . n C 1 16 ILE 16 96 96 ILE ILE C . n C 1 17 GLU 17 97 97 GLU GLU C . n C 1 18 THR 18 98 98 THR THR C . n C 1 19 ASP 19 99 99 ASP ASP C . n C 1 20 LEU 20 100 100 LEU LEU C . n C 1 21 SER 21 101 101 SER SER C . n C 1 22 PHE 22 102 102 PHE PHE C . n C 1 23 LYS 23 103 103 LYS LYS C . n C 1 24 LYS 24 104 104 LYS LYS C . n C 1 25 GLY 25 105 105 GLY GLY C . n C 1 26 GLU 26 106 106 GLU GLU C . n C 1 27 ARG 27 107 107 ARG ARG C . n C 1 28 LEU 28 108 108 LEU LEU C . n C 1 29 GLN 29 109 109 GLN GLN C . n C 1 30 ILE 30 110 110 ILE ILE C . n C 1 31 VAL 31 111 111 VAL VAL C . n C 1 32 ASN 32 112 112 ASN ASN C . n C 1 33 ASN 33 113 113 ASN ASN C . n C 1 34 THR 34 114 114 THR THR C . n C 1 35 GLU 35 115 115 GLU GLU C . n C 1 36 GLY 36 116 116 GLY GLY C . n C 1 37 ASN 37 117 117 ASN ASN C . n C 1 38 TRP 38 118 118 TRP TRP C . n C 1 39 TRP 39 119 119 TRP TRP C . n C 1 40 LEU 40 120 120 LEU LEU C . n C 1 41 ALA 41 121 121 ALA ALA C . n C 1 42 HIS 42 122 122 HIS HIS C . n C 1 43 SER 43 123 123 SER SER C . n C 1 44 VAL 44 124 124 VAL VAL C . n C 1 45 THR 45 125 125 THR THR C . n C 1 46 THR 46 126 126 THR THR C . n C 1 47 GLY 47 127 127 GLY GLY C . n C 1 48 ARG 48 128 128 ARG ARG C . n C 1 49 THR 49 129 129 THR THR C . n C 1 50 GLY 50 130 130 GLY GLY C . n C 1 51 TYR 51 131 131 TYR TYR C . n C 1 52 ILE 52 132 132 ILE ILE C . n C 1 53 PRO 53 133 133 PRO PRO C . n C 1 54 SER 54 134 134 SER SER C . n C 1 55 ASN 55 135 135 ASN ASN C . n C 1 56 TYR 56 136 136 TYR TYR C . n C 1 57 VAL 57 137 137 VAL VAL C . n C 1 58 ALA 58 138 138 ALA ALA C . n C 1 59 PRO 59 139 139 PRO PRO C . n C 1 60 SER 60 140 ? ? ? C . n C 1 61 ASP 61 141 ? ? ? C . n D 2 1 VAL 1 1 1 VAL VAL D . n D 2 2 SER 2 2 2 SER SER D . n D 2 3 LEU 3 3 3 LEU LEU D . n D 2 4 ALA 4 4 4 ALA ALA D . n D 2 5 ARG 5 5 5 ARG ARG D . n D 2 6 ARG 6 6 6 ARG ARG D . n D 2 7 PRO 7 7 7 PRO PRO D . n D 2 8 LEU 8 8 8 LEU LEU D . n D 2 9 PRO 9 9 9 PRO PRO D . n D 2 10 PRO 10 10 10 PRO PRO D . n D 2 11 LEU 11 11 11 LEU LEU D . n D 2 12 PRO 12 12 12 PRO PRO D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 PEG 1 201 1 PEG PEG A . F 4 GOL 1 201 1 GOL GOL C . G 5 HOH 1 301 10 HOH HOH A . G 5 HOH 2 302 9 HOH HOH A . G 5 HOH 3 303 16 HOH HOH A . G 5 HOH 4 304 3 HOH HOH A . G 5 HOH 5 305 11 HOH HOH A . G 5 HOH 6 306 7 HOH HOH A . G 5 HOH 7 307 29 HOH HOH A . G 5 HOH 8 308 33 HOH HOH A . G 5 HOH 9 309 2 HOH HOH A . G 5 HOH 10 310 19 HOH HOH A . G 5 HOH 11 311 25 HOH HOH A . G 5 HOH 12 312 54 HOH HOH A . G 5 HOH 13 313 53 HOH HOH A . G 5 HOH 14 314 39 HOH HOH A . G 5 HOH 15 315 55 HOH HOH A . H 5 HOH 1 101 35 HOH HOH B . H 5 HOH 2 102 50 HOH HOH B . H 5 HOH 3 103 31 HOH HOH B . H 5 HOH 4 104 14 HOH HOH B . H 5 HOH 5 105 56 HOH HOH B . H 5 HOH 6 106 43 HOH HOH B . I 5 HOH 1 301 22 HOH HOH C . I 5 HOH 2 302 18 HOH HOH C . I 5 HOH 3 303 41 HOH HOH C . I 5 HOH 4 304 5 HOH HOH C . I 5 HOH 5 305 4 HOH HOH C . I 5 HOH 6 306 15 HOH HOH C . I 5 HOH 7 307 46 HOH HOH C . I 5 HOH 8 308 8 HOH HOH C . I 5 HOH 9 309 45 HOH HOH C . I 5 HOH 10 310 28 HOH HOH C . I 5 HOH 11 311 6 HOH HOH C . I 5 HOH 12 312 21 HOH HOH C . I 5 HOH 13 313 1 HOH HOH C . I 5 HOH 14 314 37 HOH HOH C . I 5 HOH 15 315 36 HOH HOH C . I 5 HOH 16 316 12 HOH HOH C . I 5 HOH 17 317 23 HOH HOH C . I 5 HOH 18 318 30 HOH HOH C . I 5 HOH 19 319 32 HOH HOH C . I 5 HOH 20 320 13 HOH HOH C . I 5 HOH 21 321 17 HOH HOH C . I 5 HOH 22 322 34 HOH HOH C . I 5 HOH 23 323 24 HOH HOH C . I 5 HOH 24 324 27 HOH HOH C . I 5 HOH 25 325 47 HOH HOH C . I 5 HOH 26 326 49 HOH HOH C . I 5 HOH 27 327 48 HOH HOH C . I 5 HOH 28 328 26 HOH HOH C . I 5 HOH 29 329 44 HOH HOH C . I 5 HOH 30 330 40 HOH HOH C . J 5 HOH 1 101 38 HOH HOH D . J 5 HOH 2 102 52 HOH HOH D . J 5 HOH 3 103 51 HOH HOH D . J 5 HOH 4 104 42 HOH HOH D . J 5 HOH 5 105 20 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 103 ? CG ? A LYS 23 CG 2 1 Y 1 A LYS 103 ? CD ? A LYS 23 CD 3 1 Y 1 A LYS 103 ? CE ? A LYS 23 CE 4 1 Y 1 A LYS 103 ? NZ ? A LYS 23 NZ 5 1 Y 1 B ARG 5 ? CG ? B ARG 5 CG 6 1 Y 1 B ARG 5 ? CD ? B ARG 5 CD 7 1 Y 1 B ARG 5 ? NE ? B ARG 5 NE 8 1 Y 1 B ARG 5 ? CZ ? B ARG 5 CZ 9 1 Y 1 B ARG 5 ? NH1 ? B ARG 5 NH1 10 1 Y 1 B ARG 5 ? NH2 ? B ARG 5 NH2 11 1 Y 1 C GLU 97 ? CG ? C GLU 17 CG 12 1 Y 1 C GLU 97 ? CD ? C GLU 17 CD 13 1 Y 1 C GLU 97 ? OE1 ? C GLU 17 OE1 14 1 Y 1 C GLU 97 ? OE2 ? C GLU 17 OE2 15 1 Y 1 C LYS 103 ? CG ? C LYS 23 CG 16 1 Y 1 C LYS 103 ? CD ? C LYS 23 CD 17 1 Y 1 C LYS 103 ? CE ? C LYS 23 CE 18 1 Y 1 C LYS 103 ? NZ ? C LYS 23 NZ 19 1 Y 1 C ARG 107 ? CG ? C ARG 27 CG 20 1 Y 1 C ARG 107 ? CD ? C ARG 27 CD 21 1 Y 1 C ARG 107 ? NE ? C ARG 27 NE 22 1 Y 1 C ARG 107 ? CZ ? C ARG 27 CZ 23 1 Y 1 C ARG 107 ? NH1 ? C ARG 27 NH1 24 1 Y 1 C ARG 107 ? NH2 ? C ARG 27 NH2 25 1 Y 1 C GLU 115 ? CG ? C GLU 35 CG 26 1 Y 1 C GLU 115 ? CD ? C GLU 35 CD 27 1 Y 1 C GLU 115 ? OE1 ? C GLU 35 OE1 28 1 Y 1 C GLU 115 ? OE2 ? C GLU 35 OE2 29 1 Y 1 D VAL 1 ? CG1 ? D VAL 1 CG1 30 1 Y 1 D VAL 1 ? CG2 ? D VAL 1 CG2 31 1 Y 1 D ARG 5 ? CG ? D ARG 5 CG 32 1 Y 1 D ARG 5 ? CD ? D ARG 5 CD 33 1 Y 1 D ARG 5 ? NE ? D ARG 5 NE 34 1 Y 1 D ARG 5 ? CZ ? D ARG 5 CZ 35 1 Y 1 D ARG 5 ? NH1 ? D ARG 5 NH1 36 1 Y 1 D ARG 5 ? NH2 ? D ARG 5 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7PVT _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.227 _cell.length_a_esd ? _cell.length_b 51.227 _cell.length_b_esd ? _cell.length_c 46.340 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PVT _symmetry.cell_setting ? _symmetry.Int_Tables_number 145 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PVT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.000 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 283 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M ammonium sulfate, 10% glicerol, 5% PEG300, 40 mM LiCl, 0.1M MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96770 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96770 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 25.130 _reflns.entry_id 7PVT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.600 _reflns.d_resolution_low 17.180 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17900 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.500 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 242 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.069 _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 116716 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.600 1.630 ? ? 5963 ? ? ? 895 100.000 ? ? ? ? 0.802 ? ? ? ? ? ? ? ? 6.700 ? ? ? 1.900 0.870 0.335 ? 1 1 0.790 ? ? ? ? ? ? ? ? ? ? 8.760 17.180 ? ? 588 ? ? ? 97 89.300 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 6.100 ? ? ? 33.000 0.075 0.032 ? 2 1 0.991 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 87.970 _refine.B_iso_mean 36.7025 _refine.B_iso_min 17.550 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PVT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6000 _refine.ls_d_res_low 17.1800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35656 _refine.ls_number_reflns_R_free 1785 _refine.ls_number_reflns_R_work 33871 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4400 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1794 _refine.ls_R_factor_R_free 0.2040 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1781 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.140 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7NER _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.0300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.6000 _refine_hist.d_res_low 17.1800 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 1112 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 131 _refine_hist.pdbx_B_iso_mean_ligand 69.59 _refine_hist.pdbx_B_iso_mean_solvent 37.91 _refine_hist.pdbx_number_atoms_protein 1025 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6000 1.6400 2797 . 156 2641 100.0000 . . . 0.3500 0.0000 0.3034 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.6400 1.6900 2657 . 88 2569 100.0000 . . . 0.2810 0.0000 0.2886 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.6900 1.7500 2755 . 136 2619 100.0000 . . . 0.2608 0.0000 0.2468 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.7500 1.8100 2786 . 176 2610 100.0000 . . . 0.2295 0.0000 0.2245 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.8100 1.8800 2717 . 132 2585 100.0000 . . . 0.2219 0.0000 0.2092 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.8800 1.9600 2804 . 132 2672 100.0000 . . . 0.2393 0.0000 0.1579 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.9700 2.0700 2719 . 132 2587 100.0000 . . . 0.1775 0.0000 0.1442 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.0700 2.2000 2767 . 128 2639 100.0000 . . . 0.2240 0.0000 0.1769 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.2000 2.3700 2739 . 92 2647 100.0000 . . . 0.1731 0.0000 0.1967 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.3700 2.6100 2698 . 176 2522 97.0000 . . . 0.1859 0.0000 0.2025 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.6100 2.9800 2711 . 140 2571 98.0000 . . . 0.2476 0.0000 0.1956 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.9800 3.7500 2742 . 156 2586 100.0000 . . . 0.2004 0.0000 0.1657 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.7500 17.1800 2764 . 141 2623 100.0000 . . . 0.1786 0.0000 0.1511 . . . . . . . 13 . . . # _struct.entry_id 7PVT _struct.title 'Crystal structure of the v-Src SH3 domain Q128R mutant in complex with the synthetic peptide VSL12' _struct.pdbx_model_details 'Intertwined dimer' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PVT _struct_keywords.text 'beta barrel, SH3 domain, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 5 ? I N N 5 ? J N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SRC_RSVSE P63185 ? 1 GGVTTFVALYDYESWIETDLSFKKGERLQIVNNTEGNWWLAHSVTTGQTGYIPSNYVAPSD 81 2 PDB 7PVT 7PVT ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7PVT A 1 ? 61 ? P63185 81 ? 141 ? 81 141 2 2 7PVT B 1 ? 12 ? 7PVT 1 ? 12 ? 1 12 3 1 7PVT C 1 ? 61 ? P63185 81 ? 141 ? 81 141 4 2 7PVT D 1 ? 12 ? 7PVT 1 ? 12 ? 1 12 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PVT ARG A 48 ? UNP P63185 GLN 128 'engineered mutation' 128 1 3 7PVT ARG C 48 ? UNP P63185 GLN 128 'engineered mutation' 128 2 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 author_defined_assembly ? dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1100 ? 1 MORE -5 ? 1 'SSA (A^2)' 4130 ? 2 'ABSA (A^2)' 1250 ? 2 MORE -7 ? 2 'SSA (A^2)' 4040 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,G,H 2 1 C,D,F,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 49 ? PRO A 53 ? THR A 129 PRO A 133 AA1 2 TRP A 38 ? HIS A 42 ? TRP A 118 HIS A 122 AA1 3 ARG A 27 ? ILE A 30 ? ARG A 107 ILE A 110 AA1 4 THR A 5 ? ALA A 8 ? THR A 85 ALA A 88 AA1 5 VAL A 57 ? PRO A 59 ? VAL A 137 PRO A 139 AA2 1 THR C 49 ? PRO C 53 ? THR C 129 PRO C 133 AA2 2 TRP C 38 ? HIS C 42 ? TRP C 118 HIS C 122 AA2 3 ARG C 27 ? ASN C 32 ? ARG C 107 ASN C 112 AA2 4 THR C 5 ? ALA C 8 ? THR C 85 ALA C 88 AA2 5 VAL C 57 ? ALA C 58 ? VAL C 137 ALA C 138 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 50 ? O GLY A 130 N ALA A 41 ? N ALA A 121 AA1 2 3 O HIS A 42 ? O HIS A 122 N GLN A 29 ? N GLN A 109 AA1 3 4 O LEU A 28 ? O LEU A 108 N PHE A 6 ? N PHE A 86 AA1 4 5 N VAL A 7 ? N VAL A 87 O ALA A 58 ? O ALA A 138 AA2 1 2 O GLY C 50 ? O GLY C 130 N ALA C 41 ? N ALA C 121 AA2 2 3 O LEU C 40 ? O LEU C 120 N VAL C 31 ? N VAL C 111 AA2 3 4 O LEU C 28 ? O LEU C 108 N PHE C 6 ? N PHE C 86 AA2 4 5 N VAL C 7 ? N VAL C 87 O ALA C 58 ? O ALA C 138 # _phasing.method MR # _pdbx_entry_details.entry_id 7PVT _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 81 ? A GLY 1 2 1 Y 1 A GLY 82 ? A GLY 2 3 1 Y 1 A VAL 83 ? A VAL 3 4 1 Y 1 A ASN 112 ? A ASN 32 5 1 Y 1 A ASN 113 ? A ASN 33 6 1 Y 1 A THR 114 ? A THR 34 7 1 Y 1 A GLU 115 ? A GLU 35 8 1 Y 1 A ASP 141 ? A ASP 61 9 1 Y 1 B VAL 1 ? B VAL 1 10 1 Y 1 B SER 2 ? B SER 2 11 1 Y 1 C GLY 81 ? C GLY 1 12 1 Y 1 C GLY 82 ? C GLY 2 13 1 Y 1 C VAL 83 ? C VAL 3 14 1 Y 1 C SER 140 ? C SER 60 15 1 Y 1 C ASP 141 ? C ASP 61 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PEG C1 C N N 230 PEG O1 O N N 231 PEG C2 C N N 232 PEG O2 O N N 233 PEG C3 C N N 234 PEG C4 C N N 235 PEG O4 O N N 236 PEG H11 H N N 237 PEG H12 H N N 238 PEG HO1 H N N 239 PEG H21 H N N 240 PEG H22 H N N 241 PEG H31 H N N 242 PEG H32 H N N 243 PEG H41 H N N 244 PEG H42 H N N 245 PEG HO4 H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PEG C1 O1 sing N N 218 PEG C1 C2 sing N N 219 PEG C1 H11 sing N N 220 PEG C1 H12 sing N N 221 PEG O1 HO1 sing N N 222 PEG C2 O2 sing N N 223 PEG C2 H21 sing N N 224 PEG C2 H22 sing N N 225 PEG O2 C3 sing N N 226 PEG C3 C4 sing N N 227 PEG C3 H31 sing N N 228 PEG C3 H32 sing N N 229 PEG C4 O4 sing N N 230 PEG C4 H41 sing N N 231 PEG C4 H42 sing N N 232 PEG O4 HO4 sing N N 233 PHE N CA sing N N 234 PHE N H sing N N 235 PHE N H2 sing N N 236 PHE CA C sing N N 237 PHE CA CB sing N N 238 PHE CA HA sing N N 239 PHE C O doub N N 240 PHE C OXT sing N N 241 PHE CB CG sing N N 242 PHE CB HB2 sing N N 243 PHE CB HB3 sing N N 244 PHE CG CD1 doub Y N 245 PHE CG CD2 sing Y N 246 PHE CD1 CE1 sing Y N 247 PHE CD1 HD1 sing N N 248 PHE CD2 CE2 doub Y N 249 PHE CD2 HD2 sing N N 250 PHE CE1 CZ doub Y N 251 PHE CE1 HE1 sing N N 252 PHE CE2 CZ sing Y N 253 PHE CE2 HE2 sing N N 254 PHE CZ HZ sing N N 255 PHE OXT HXT sing N N 256 PRO N CA sing N N 257 PRO N CD sing N N 258 PRO N H sing N N 259 PRO CA C sing N N 260 PRO CA CB sing N N 261 PRO CA HA sing N N 262 PRO C O doub N N 263 PRO C OXT sing N N 264 PRO CB CG sing N N 265 PRO CB HB2 sing N N 266 PRO CB HB3 sing N N 267 PRO CG CD sing N N 268 PRO CG HG2 sing N N 269 PRO CG HG3 sing N N 270 PRO CD HD2 sing N N 271 PRO CD HD3 sing N N 272 PRO OXT HXT sing N N 273 SER N CA sing N N 274 SER N H sing N N 275 SER N H2 sing N N 276 SER CA C sing N N 277 SER CA CB sing N N 278 SER CA HA sing N N 279 SER C O doub N N 280 SER C OXT sing N N 281 SER CB OG sing N N 282 SER CB HB2 sing N N 283 SER CB HB3 sing N N 284 SER OG HG sing N N 285 SER OXT HXT sing N N 286 THR N CA sing N N 287 THR N H sing N N 288 THR N H2 sing N N 289 THR CA C sing N N 290 THR CA CB sing N N 291 THR CA HA sing N N 292 THR C O doub N N 293 THR C OXT sing N N 294 THR CB OG1 sing N N 295 THR CB CG2 sing N N 296 THR CB HB sing N N 297 THR OG1 HG1 sing N N 298 THR CG2 HG21 sing N N 299 THR CG2 HG22 sing N N 300 THR CG2 HG23 sing N N 301 THR OXT HXT sing N N 302 TRP N CA sing N N 303 TRP N H sing N N 304 TRP N H2 sing N N 305 TRP CA C sing N N 306 TRP CA CB sing N N 307 TRP CA HA sing N N 308 TRP C O doub N N 309 TRP C OXT sing N N 310 TRP CB CG sing N N 311 TRP CB HB2 sing N N 312 TRP CB HB3 sing N N 313 TRP CG CD1 doub Y N 314 TRP CG CD2 sing Y N 315 TRP CD1 NE1 sing Y N 316 TRP CD1 HD1 sing N N 317 TRP CD2 CE2 doub Y N 318 TRP CD2 CE3 sing Y N 319 TRP NE1 CE2 sing Y N 320 TRP NE1 HE1 sing N N 321 TRP CE2 CZ2 sing Y N 322 TRP CE3 CZ3 doub Y N 323 TRP CE3 HE3 sing N N 324 TRP CZ2 CH2 doub Y N 325 TRP CZ2 HZ2 sing N N 326 TRP CZ3 CH2 sing Y N 327 TRP CZ3 HZ3 sing N N 328 TRP CH2 HH2 sing N N 329 TRP OXT HXT sing N N 330 TYR N CA sing N N 331 TYR N H sing N N 332 TYR N H2 sing N N 333 TYR CA C sing N N 334 TYR CA CB sing N N 335 TYR CA HA sing N N 336 TYR C O doub N N 337 TYR C OXT sing N N 338 TYR CB CG sing N N 339 TYR CB HB2 sing N N 340 TYR CB HB3 sing N N 341 TYR CG CD1 doub Y N 342 TYR CG CD2 sing Y N 343 TYR CD1 CE1 sing Y N 344 TYR CD1 HD1 sing N N 345 TYR CD2 CE2 doub Y N 346 TYR CD2 HD2 sing N N 347 TYR CE1 CZ doub Y N 348 TYR CE1 HE1 sing N N 349 TYR CE2 CZ sing Y N 350 TYR CE2 HE2 sing N N 351 TYR CZ OH sing N N 352 TYR OH HH sing N N 353 TYR OXT HXT sing N N 354 VAL N CA sing N N 355 VAL N H sing N N 356 VAL N H2 sing N N 357 VAL CA C sing N N 358 VAL CA CB sing N N 359 VAL CA HA sing N N 360 VAL C O doub N N 361 VAL C OXT sing N N 362 VAL CB CG1 sing N N 363 VAL CB CG2 sing N N 364 VAL CB HB sing N N 365 VAL CG1 HG11 sing N N 366 VAL CG1 HG12 sing N N 367 VAL CG1 HG13 sing N N 368 VAL CG2 HG21 sing N N 369 VAL CG2 HG22 sing N N 370 VAL CG2 HG23 sing N N 371 VAL OXT HXT sing N N 372 # _pdbx_audit_support.funding_organization 'Ministry of Economy and Competitiveness (MINECO)' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number BIO2006-78020-R _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7NER _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7PVT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019521 _atom_sites.fract_transf_matrix[1][2] 0.011270 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022541 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021579 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_