data_7PZ5 # _entry.id 7PZ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PZ5 pdb_00007pz5 10.2210/pdb7pz5/pdb WWPDB D_1292118659 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-24 2 'Structure model' 1 1 2022-09-21 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PZ5 _pdbx_database_status.recvd_initial_deposition_date 2021-10-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'different X-ray dose' 7PZ3 unspecified PDB 'different X-ray dose' 7PZ4 unspecified PDB 'different X-ray dose' 7PZ6 unspecified PDB 'different X-ray dose' 7PZ7 unspecified PDB 'different X-ray dose' 7PZ8 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email leila@chem.ku.dk _pdbx_contact_author.name_first Leila _pdbx_contact_author.name_last 'Lo Leggio' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5135-0882 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tandrup, T.' 1 0000-0002-3448-7019 'Muderspach, S.J.' 2 0000-0002-7032-6941 'Ipsen, J.O.' 3 0000-0001-5509-8496 'Johansen, K.S.' 4 0000-0002-7587-5990 'Lo Leggio, L.' 5 0000-0002-5135-0882 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iucrj _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2052-2525 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 666 _citation.page_last 681 _citation.title ;Changes in active-site geometry on X-ray photoreduction of a lytic polysaccharide monooxygenase active-site copper and saccharide binding. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2052252522007175 _citation.pdbx_database_id_PubMed 36071795 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tandrup, T.' 1 ? primary 'Muderspach, S.J.' 2 ? primary 'Banerjee, S.' 3 ? primary 'Santoni, G.' 4 ? primary 'Ipsen, J.O.' 5 ? primary 'Hernandez-Rollan, C.' 6 ? primary 'Norholm, M.H.H.' 7 ? primary 'Johansen, K.S.' 8 ? primary 'Meilleur, F.' 9 ? primary 'Lo Leggio, L.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gh61 isozyme a' 24418.043 1 3.2.1.4 ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'ACRYLIC ACID' 72.063 1 ? ? ? ? 4 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 5 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305 1 ? ? ? ? 6 water nat water 18.015 275 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TaAA9A,lytic polysaccharide monooxygenase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(HIC)GFVQNIVIDGKNYGGYLVNQYPYMSNPPEVIAWSTTATDLGFVDGTGYQTPDIICHRGAKPGALTAPVSPGGTVE LQWTPWPDSHHGPVINYLAPCNGDCSTVDKTQLEFFKIAESGLINDDNPPGIWASDNLIAANNSWTVTIPTTIAPGNYVL RHEIIALHSAQNQDGAQNYPQCINLQVTGGGSDNPAGTLGTALYHDTDPGILINIYQKLSSYIIPGPPLYTG ; _entity_poly.pdbx_seq_one_letter_code_can ;HGFVQNIVIDGKNYGGYLVNQYPYMSNPPEVIAWSTTATDLGFVDGTGYQTPDIICHRGAKPGALTAPVSPGGTVELQWT PWPDSHHGPVINYLAPCNGDCSTVDKTQLEFFKIAESGLINDDNPPGIWASDNLIAANNSWTVTIPTTIAPGNYVLRHEI IALHSAQNQDGAQNYPQCINLQVTGGGSDNPAGTLGTALYHDTDPGILINIYQKLSSYIIPGPPLYTG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'ACRYLIC ACID' AKR 4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 5 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIC n 1 2 GLY n 1 3 PHE n 1 4 VAL n 1 5 GLN n 1 6 ASN n 1 7 ILE n 1 8 VAL n 1 9 ILE n 1 10 ASP n 1 11 GLY n 1 12 LYS n 1 13 ASN n 1 14 TYR n 1 15 GLY n 1 16 GLY n 1 17 TYR n 1 18 LEU n 1 19 VAL n 1 20 ASN n 1 21 GLN n 1 22 TYR n 1 23 PRO n 1 24 TYR n 1 25 MET n 1 26 SER n 1 27 ASN n 1 28 PRO n 1 29 PRO n 1 30 GLU n 1 31 VAL n 1 32 ILE n 1 33 ALA n 1 34 TRP n 1 35 SER n 1 36 THR n 1 37 THR n 1 38 ALA n 1 39 THR n 1 40 ASP n 1 41 LEU n 1 42 GLY n 1 43 PHE n 1 44 VAL n 1 45 ASP n 1 46 GLY n 1 47 THR n 1 48 GLY n 1 49 TYR n 1 50 GLN n 1 51 THR n 1 52 PRO n 1 53 ASP n 1 54 ILE n 1 55 ILE n 1 56 CYS n 1 57 HIS n 1 58 ARG n 1 59 GLY n 1 60 ALA n 1 61 LYS n 1 62 PRO n 1 63 GLY n 1 64 ALA n 1 65 LEU n 1 66 THR n 1 67 ALA n 1 68 PRO n 1 69 VAL n 1 70 SER n 1 71 PRO n 1 72 GLY n 1 73 GLY n 1 74 THR n 1 75 VAL n 1 76 GLU n 1 77 LEU n 1 78 GLN n 1 79 TRP n 1 80 THR n 1 81 PRO n 1 82 TRP n 1 83 PRO n 1 84 ASP n 1 85 SER n 1 86 HIS n 1 87 HIS n 1 88 GLY n 1 89 PRO n 1 90 VAL n 1 91 ILE n 1 92 ASN n 1 93 TYR n 1 94 LEU n 1 95 ALA n 1 96 PRO n 1 97 CYS n 1 98 ASN n 1 99 GLY n 1 100 ASP n 1 101 CYS n 1 102 SER n 1 103 THR n 1 104 VAL n 1 105 ASP n 1 106 LYS n 1 107 THR n 1 108 GLN n 1 109 LEU n 1 110 GLU n 1 111 PHE n 1 112 PHE n 1 113 LYS n 1 114 ILE n 1 115 ALA n 1 116 GLU n 1 117 SER n 1 118 GLY n 1 119 LEU n 1 120 ILE n 1 121 ASN n 1 122 ASP n 1 123 ASP n 1 124 ASN n 1 125 PRO n 1 126 PRO n 1 127 GLY n 1 128 ILE n 1 129 TRP n 1 130 ALA n 1 131 SER n 1 132 ASP n 1 133 ASN n 1 134 LEU n 1 135 ILE n 1 136 ALA n 1 137 ALA n 1 138 ASN n 1 139 ASN n 1 140 SER n 1 141 TRP n 1 142 THR n 1 143 VAL n 1 144 THR n 1 145 ILE n 1 146 PRO n 1 147 THR n 1 148 THR n 1 149 ILE n 1 150 ALA n 1 151 PRO n 1 152 GLY n 1 153 ASN n 1 154 TYR n 1 155 VAL n 1 156 LEU n 1 157 ARG n 1 158 HIS n 1 159 GLU n 1 160 ILE n 1 161 ILE n 1 162 ALA n 1 163 LEU n 1 164 HIS n 1 165 SER n 1 166 ALA n 1 167 GLN n 1 168 ASN n 1 169 GLN n 1 170 ASP n 1 171 GLY n 1 172 ALA n 1 173 GLN n 1 174 ASN n 1 175 TYR n 1 176 PRO n 1 177 GLN n 1 178 CYS n 1 179 ILE n 1 180 ASN n 1 181 LEU n 1 182 GLN n 1 183 VAL n 1 184 THR n 1 185 GLY n 1 186 GLY n 1 187 GLY n 1 188 SER n 1 189 ASP n 1 190 ASN n 1 191 PRO n 1 192 ALA n 1 193 GLY n 1 194 THR n 1 195 LEU n 1 196 GLY n 1 197 THR n 1 198 ALA n 1 199 LEU n 1 200 TYR n 1 201 HIS n 1 202 ASP n 1 203 THR n 1 204 ASP n 1 205 PRO n 1 206 GLY n 1 207 ILE n 1 208 LEU n 1 209 ILE n 1 210 ASN n 1 211 ILE n 1 212 TYR n 1 213 GLN n 1 214 LYS n 1 215 LEU n 1 216 SER n 1 217 SER n 1 218 TYR n 1 219 ILE n 1 220 ILE n 1 221 PRO n 1 222 GLY n 1 223 PRO n 1 224 PRO n 1 225 LEU n 1 226 TYR n 1 227 THR n 1 228 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 228 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoascus aurantiacus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5087 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Aspergillus oryzae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 5062 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AKR non-polymer . 'ACRYLIC ACID' ? 'C3 H4 O2' 72.063 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EPE non-polymer . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIC 'L-peptide linking' n 4-METHYL-HISTIDINE ? 'C7 H11 N3 O2' 169.181 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIC 1 1 1 HIC HIC A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 TRP 129 129 129 TRP TRP A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 HIS 158 158 158 HIS HIS A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 CYS 178 178 178 CYS CYS A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 HIS 201 201 201 HIS HIS A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 GLN 213 213 213 GLN GLN A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 GLY 228 228 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 301 301 CU CU A . C 3 AKR 1 302 401 AKR AKR A . D 4 NAG 1 303 501 NAG NAG A . E 5 EPE 1 304 601 EPE EPE A . F 6 HOH 1 401 188 HOH HOH A . F 6 HOH 2 402 147 HOH HOH A . F 6 HOH 3 403 65 HOH HOH A . F 6 HOH 4 404 206 HOH HOH A . F 6 HOH 5 405 195 HOH HOH A . F 6 HOH 6 406 87 HOH HOH A . F 6 HOH 7 407 189 HOH HOH A . F 6 HOH 8 408 135 HOH HOH A . F 6 HOH 9 409 124 HOH HOH A . F 6 HOH 10 410 228 HOH HOH A . F 6 HOH 11 411 233 HOH HOH A . F 6 HOH 12 412 133 HOH HOH A . F 6 HOH 13 413 165 HOH HOH A . F 6 HOH 14 414 227 HOH HOH A . F 6 HOH 15 415 102 HOH HOH A . F 6 HOH 16 416 138 HOH HOH A . F 6 HOH 17 417 126 HOH HOH A . F 6 HOH 18 418 212 HOH HOH A . F 6 HOH 19 419 137 HOH HOH A . F 6 HOH 20 420 134 HOH HOH A . F 6 HOH 21 421 101 HOH HOH A . F 6 HOH 22 422 261 HOH HOH A . F 6 HOH 23 423 221 HOH HOH A . F 6 HOH 24 424 13 HOH HOH A . F 6 HOH 25 425 21 HOH HOH A . F 6 HOH 26 426 49 HOH HOH A . F 6 HOH 27 427 93 HOH HOH A . F 6 HOH 28 428 68 HOH HOH A . F 6 HOH 29 429 61 HOH HOH A . F 6 HOH 30 430 265 HOH HOH A . F 6 HOH 31 431 11 HOH HOH A . F 6 HOH 32 432 33 HOH HOH A . F 6 HOH 33 433 47 HOH HOH A . F 6 HOH 34 434 242 HOH HOH A . F 6 HOH 35 435 239 HOH HOH A . F 6 HOH 36 436 183 HOH HOH A . F 6 HOH 37 437 106 HOH HOH A . F 6 HOH 38 438 27 HOH HOH A . F 6 HOH 39 439 218 HOH HOH A . F 6 HOH 40 440 111 HOH HOH A . F 6 HOH 41 441 162 HOH HOH A . F 6 HOH 42 442 264 HOH HOH A . F 6 HOH 43 443 255 HOH HOH A . F 6 HOH 44 444 237 HOH HOH A . F 6 HOH 45 445 66 HOH HOH A . F 6 HOH 46 446 205 HOH HOH A . F 6 HOH 47 447 257 HOH HOH A . F 6 HOH 48 448 152 HOH HOH A . F 6 HOH 49 449 110 HOH HOH A . F 6 HOH 50 450 1 HOH HOH A . F 6 HOH 51 451 86 HOH HOH A . F 6 HOH 52 452 88 HOH HOH A . F 6 HOH 53 453 119 HOH HOH A . F 6 HOH 54 454 60 HOH HOH A . F 6 HOH 55 455 251 HOH HOH A . F 6 HOH 56 456 216 HOH HOH A . F 6 HOH 57 457 22 HOH HOH A . F 6 HOH 58 458 215 HOH HOH A . F 6 HOH 59 459 108 HOH HOH A . F 6 HOH 60 460 235 HOH HOH A . F 6 HOH 61 461 45 HOH HOH A . F 6 HOH 62 462 198 HOH HOH A . F 6 HOH 63 463 71 HOH HOH A . F 6 HOH 64 464 74 HOH HOH A . F 6 HOH 65 465 210 HOH HOH A . F 6 HOH 66 466 2 HOH HOH A . F 6 HOH 67 467 46 HOH HOH A . F 6 HOH 68 468 100 HOH HOH A . F 6 HOH 69 469 273 HOH HOH A . F 6 HOH 70 470 214 HOH HOH A . F 6 HOH 71 471 52 HOH HOH A . F 6 HOH 72 472 213 HOH HOH A . F 6 HOH 73 473 70 HOH HOH A . F 6 HOH 74 474 113 HOH HOH A . F 6 HOH 75 475 31 HOH HOH A . F 6 HOH 76 476 99 HOH HOH A . F 6 HOH 77 477 62 HOH HOH A . F 6 HOH 78 478 107 HOH HOH A . F 6 HOH 79 479 128 HOH HOH A . F 6 HOH 80 480 131 HOH HOH A . F 6 HOH 81 481 23 HOH HOH A . F 6 HOH 82 482 55 HOH HOH A . F 6 HOH 83 483 196 HOH HOH A . F 6 HOH 84 484 72 HOH HOH A . F 6 HOH 85 485 19 HOH HOH A . F 6 HOH 86 486 76 HOH HOH A . F 6 HOH 87 487 82 HOH HOH A . F 6 HOH 88 488 151 HOH HOH A . F 6 HOH 89 489 30 HOH HOH A . F 6 HOH 90 490 98 HOH HOH A . F 6 HOH 91 491 75 HOH HOH A . F 6 HOH 92 492 238 HOH HOH A . F 6 HOH 93 493 3 HOH HOH A . F 6 HOH 94 494 34 HOH HOH A . F 6 HOH 95 495 36 HOH HOH A . F 6 HOH 96 496 77 HOH HOH A . F 6 HOH 97 497 12 HOH HOH A . F 6 HOH 98 498 37 HOH HOH A . F 6 HOH 99 499 193 HOH HOH A . F 6 HOH 100 500 57 HOH HOH A . F 6 HOH 101 501 127 HOH HOH A . F 6 HOH 102 502 117 HOH HOH A . F 6 HOH 103 503 16 HOH HOH A . F 6 HOH 104 504 63 HOH HOH A . F 6 HOH 105 505 191 HOH HOH A . F 6 HOH 106 506 171 HOH HOH A . F 6 HOH 107 507 32 HOH HOH A . F 6 HOH 108 508 275 HOH HOH A . F 6 HOH 109 509 40 HOH HOH A . F 6 HOH 110 510 217 HOH HOH A . F 6 HOH 111 511 247 HOH HOH A . F 6 HOH 112 512 109 HOH HOH A . F 6 HOH 113 513 84 HOH HOH A . F 6 HOH 114 514 185 HOH HOH A . F 6 HOH 115 515 194 HOH HOH A . F 6 HOH 116 516 97 HOH HOH A . F 6 HOH 117 517 38 HOH HOH A . F 6 HOH 118 518 200 HOH HOH A . F 6 HOH 119 519 90 HOH HOH A . F 6 HOH 120 520 41 HOH HOH A . F 6 HOH 121 521 48 HOH HOH A . F 6 HOH 122 522 89 HOH HOH A . F 6 HOH 123 523 28 HOH HOH A . F 6 HOH 124 524 14 HOH HOH A . F 6 HOH 125 525 144 HOH HOH A . F 6 HOH 126 526 59 HOH HOH A . F 6 HOH 127 527 8 HOH HOH A . F 6 HOH 128 528 18 HOH HOH A . F 6 HOH 129 529 44 HOH HOH A . F 6 HOH 130 530 64 HOH HOH A . F 6 HOH 131 531 17 HOH HOH A . F 6 HOH 132 532 53 HOH HOH A . F 6 HOH 133 533 7 HOH HOH A . F 6 HOH 134 534 25 HOH HOH A . F 6 HOH 135 535 179 HOH HOH A . F 6 HOH 136 536 258 HOH HOH A . F 6 HOH 137 537 234 HOH HOH A . F 6 HOH 138 538 78 HOH HOH A . F 6 HOH 139 539 5 HOH HOH A . F 6 HOH 140 540 145 HOH HOH A . F 6 HOH 141 541 181 HOH HOH A . F 6 HOH 142 542 262 HOH HOH A . F 6 HOH 143 543 26 HOH HOH A . F 6 HOH 144 544 9 HOH HOH A . F 6 HOH 145 545 130 HOH HOH A . F 6 HOH 146 546 116 HOH HOH A . F 6 HOH 147 547 115 HOH HOH A . F 6 HOH 148 548 159 HOH HOH A . F 6 HOH 149 549 85 HOH HOH A . F 6 HOH 150 550 43 HOH HOH A . F 6 HOH 151 551 174 HOH HOH A . F 6 HOH 152 552 58 HOH HOH A . F 6 HOH 153 553 260 HOH HOH A . F 6 HOH 154 554 114 HOH HOH A . F 6 HOH 155 555 175 HOH HOH A . F 6 HOH 156 556 231 HOH HOH A . F 6 HOH 157 557 73 HOH HOH A . F 6 HOH 158 558 121 HOH HOH A . F 6 HOH 159 559 50 HOH HOH A . F 6 HOH 160 560 120 HOH HOH A . F 6 HOH 161 561 10 HOH HOH A . F 6 HOH 162 562 39 HOH HOH A . F 6 HOH 163 563 92 HOH HOH A . F 6 HOH 164 564 15 HOH HOH A . F 6 HOH 165 565 186 HOH HOH A . F 6 HOH 166 566 35 HOH HOH A . F 6 HOH 167 567 203 HOH HOH A . F 6 HOH 168 568 166 HOH HOH A . F 6 HOH 169 569 197 HOH HOH A . F 6 HOH 170 570 173 HOH HOH A . F 6 HOH 171 571 6 HOH HOH A . F 6 HOH 172 572 103 HOH HOH A . F 6 HOH 173 573 211 HOH HOH A . F 6 HOH 174 574 184 HOH HOH A . F 6 HOH 175 575 96 HOH HOH A . F 6 HOH 176 576 112 HOH HOH A . F 6 HOH 177 577 207 HOH HOH A . F 6 HOH 178 578 95 HOH HOH A . F 6 HOH 179 579 54 HOH HOH A . F 6 HOH 180 580 187 HOH HOH A . F 6 HOH 181 581 132 HOH HOH A . F 6 HOH 182 582 230 HOH HOH A . F 6 HOH 183 583 209 HOH HOH A . F 6 HOH 184 584 177 HOH HOH A . F 6 HOH 185 585 67 HOH HOH A . F 6 HOH 186 586 29 HOH HOH A . F 6 HOH 187 587 94 HOH HOH A . F 6 HOH 188 588 56 HOH HOH A . F 6 HOH 189 589 104 HOH HOH A . F 6 HOH 190 590 79 HOH HOH A . F 6 HOH 191 591 199 HOH HOH A . F 6 HOH 192 592 80 HOH HOH A . F 6 HOH 193 593 4 HOH HOH A . F 6 HOH 194 594 190 HOH HOH A . F 6 HOH 195 595 172 HOH HOH A . F 6 HOH 196 596 192 HOH HOH A . F 6 HOH 197 597 129 HOH HOH A . F 6 HOH 198 598 69 HOH HOH A . F 6 HOH 199 599 81 HOH HOH A . F 6 HOH 200 600 229 HOH HOH A . F 6 HOH 201 601 244 HOH HOH A . F 6 HOH 202 602 202 HOH HOH A . F 6 HOH 203 603 178 HOH HOH A . F 6 HOH 204 604 83 HOH HOH A . F 6 HOH 205 605 136 HOH HOH A . F 6 HOH 206 606 259 HOH HOH A . F 6 HOH 207 607 140 HOH HOH A . F 6 HOH 208 608 201 HOH HOH A . F 6 HOH 209 609 180 HOH HOH A . F 6 HOH 210 610 243 HOH HOH A . F 6 HOH 211 611 241 HOH HOH A . F 6 HOH 212 612 163 HOH HOH A . F 6 HOH 213 613 155 HOH HOH A . F 6 HOH 214 614 122 HOH HOH A . F 6 HOH 215 615 42 HOH HOH A . F 6 HOH 216 616 157 HOH HOH A . F 6 HOH 217 617 160 HOH HOH A . F 6 HOH 218 618 139 HOH HOH A . F 6 HOH 219 619 269 HOH HOH A . F 6 HOH 220 620 225 HOH HOH A . F 6 HOH 221 621 250 HOH HOH A . F 6 HOH 222 622 220 HOH HOH A . F 6 HOH 223 623 20 HOH HOH A . F 6 HOH 224 624 226 HOH HOH A . F 6 HOH 225 625 253 HOH HOH A . F 6 HOH 226 626 208 HOH HOH A . F 6 HOH 227 627 167 HOH HOH A . F 6 HOH 228 628 158 HOH HOH A . F 6 HOH 229 629 219 HOH HOH A . F 6 HOH 230 630 91 HOH HOH A . F 6 HOH 231 631 236 HOH HOH A . F 6 HOH 232 632 125 HOH HOH A . F 6 HOH 233 633 148 HOH HOH A . F 6 HOH 234 634 267 HOH HOH A . F 6 HOH 235 635 143 HOH HOH A . F 6 HOH 236 636 118 HOH HOH A . F 6 HOH 237 637 153 HOH HOH A . F 6 HOH 238 638 154 HOH HOH A . F 6 HOH 239 639 176 HOH HOH A . F 6 HOH 240 640 224 HOH HOH A . F 6 HOH 241 641 156 HOH HOH A . F 6 HOH 242 642 256 HOH HOH A . F 6 HOH 243 643 142 HOH HOH A . F 6 HOH 244 644 170 HOH HOH A . F 6 HOH 245 645 232 HOH HOH A . F 6 HOH 246 646 246 HOH HOH A . F 6 HOH 247 647 105 HOH HOH A . F 6 HOH 248 648 164 HOH HOH A . F 6 HOH 249 649 169 HOH HOH A . F 6 HOH 250 650 271 HOH HOH A . F 6 HOH 251 651 254 HOH HOH A . F 6 HOH 252 652 168 HOH HOH A . F 6 HOH 253 653 268 HOH HOH A . F 6 HOH 254 654 277 HOH HOH A . F 6 HOH 255 655 272 HOH HOH A . F 6 HOH 256 656 276 HOH HOH A . F 6 HOH 257 657 149 HOH HOH A . F 6 HOH 258 658 141 HOH HOH A . F 6 HOH 259 659 161 HOH HOH A . F 6 HOH 260 660 245 HOH HOH A . F 6 HOH 261 661 240 HOH HOH A . F 6 HOH 262 662 204 HOH HOH A . F 6 HOH 263 663 146 HOH HOH A . F 6 HOH 264 664 266 HOH HOH A . F 6 HOH 265 665 150 HOH HOH A . F 6 HOH 266 666 270 HOH HOH A . F 6 HOH 267 667 249 HOH HOH A . F 6 HOH 268 668 274 HOH HOH A . F 6 HOH 269 669 223 HOH HOH A . F 6 HOH 270 670 182 HOH HOH A . F 6 HOH 271 671 252 HOH HOH A . F 6 HOH 272 672 248 HOH HOH A . F 6 HOH 273 673 222 HOH HOH A . F 6 HOH 274 674 123 HOH HOH A . F 6 HOH 275 675 263 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 104.910 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7PZ5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.410 _cell.length_a_esd ? _cell.length_b 87.290 _cell.length_b_esd ? _cell.length_c 37.410 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PZ5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PZ5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 mM MgCl2, 0.1 M HEPES pH 7.5, 22 %(w/v) Polyacrylic acid 5100 sodium salt.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-09-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7PZ5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.45 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 66959 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 89.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.42 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.71 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.45 _reflns_shell.d_res_low 1.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4641 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.51 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 51.910 _refine.B_iso_mean 13.7320 _refine.B_iso_min 8.100 _refine.correlation_coeff_Fo_to_Fc 0.9700 _refine.correlation_coeff_Fo_to_Fc_free 0.9630 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PZ5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4500 _refine.ls_d_res_low 43.6500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35194 _refine.ls_number_reflns_R_free 1837 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.0100 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1667 _refine.ls_R_factor_R_free 0.1858 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1656 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3ZUD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4500 _refine_hist.d_res_low 43.6500 _refine_hist.number_atoms_solvent 275 _refine_hist.number_atoms_total 2030 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 227 _refine_hist.pdbx_B_iso_mean_ligand 28.23 _refine_hist.pdbx_B_iso_mean_solvent 24.38 _refine_hist.pdbx_number_atoms_protein 1720 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _struct.entry_id 7PZ5 _struct.title 'Structure of an LPMO at 9.56x10^4 Gy' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PZ5 _struct_keywords.text 'Lytic polysaccharide monooxygenase, metalloenzyme, copper, Auxiliary activity, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G3XAP7_THEAU _struct_ref.pdbx_db_accession G3XAP7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HGFVQNIVIDGKNYGGYLVNQYPYMSNPPEVIAWSTTATDLGFVDGTGYQTPDIICHRGAKPGALTAPVSPGGTVELQWT PWPDSHHGPVINYLAPCNGDCSTVDKTQLEFFKIAESGLINDDNPPGIWASDNLIAANNSWTVTIPTTIAPGNYVLRHEI IALHSAQNQDGAQNYPQCINLQVTGGGSDNPAGTLGTALYHDTDPGILINIYQKLSSYIIPGPPLYTG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PZ5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G3XAP7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 228 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 21 ? MET A 25 ? GLN A 21 MET A 25 5 ? 5 HELX_P HELX_P2 AA2 ASP A 45 ? TYR A 49 ? ASP A 45 TYR A 49 5 ? 5 HELX_P HELX_P3 AA3 PRO A 52 ? HIS A 57 ? PRO A 52 HIS A 57 1 ? 6 HELX_P HELX_P4 AA4 ASP A 100 ? VAL A 104 ? ASP A 100 VAL A 104 5 ? 5 HELX_P HELX_P5 AA5 ASP A 105 ? GLN A 108 ? ASP A 105 GLN A 108 5 ? 4 HELX_P HELX_P6 AA6 ALA A 130 ? ALA A 137 ? ALA A 130 ALA A 137 1 ? 8 HELX_P HELX_P7 AA7 THR A 197 ? LEU A 199 ? THR A 197 LEU A 199 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 178 SG ? ? A CYS 56 A CYS 178 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 97 A CYS 101 1_555 ? ? ? ? ? ? ? 2.027 ? ? covale1 covale both ? A HIC 1 C ? ? ? 1_555 A GLY 2 N ? ? A HIC 1 A GLY 2 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale one ? A ASN 138 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 138 A NAG 303 1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation metalc1 metalc ? ? A HIC 1 N ? ? ? 1_555 B CU . CU ? ? A HIC 1 A CU 301 1_555 ? ? ? ? ? ? ? 2.163 ? ? metalc2 metalc ? ? A HIC 1 ND1 ? ? ? 1_555 B CU . CU ? ? A HIC 1 A CU 301 1_555 ? ? ? ? ? ? ? 1.920 ? ? metalc3 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 86 A CU 301 1_555 ? ? ? ? ? ? ? 1.983 ? ? metalc4 metalc ? ? B CU . CU ? ? ? 1_555 F HOH . O ? ? A CU 301 A HOH 403 1_555 ? ? ? ? ? ? ? 2.561 ? ? metalc5 metalc ? ? B CU . CU ? ? ? 1_555 F HOH . O ? ? A CU 301 A HOH 454 1_555 ? ? ? ? ? ? ? 2.086 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A HIC 1 ? A HIC 1 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 ND1 ? A HIC 1 ? A HIC 1 ? 1_555 93.7 ? 2 N ? A HIC 1 ? A HIC 1 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 93.7 ? 3 ND1 ? A HIC 1 ? A HIC 1 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 172.5 ? 4 N ? A HIC 1 ? A HIC 1 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 O ? F HOH . ? A HOH 403 ? 1_555 92.2 ? 5 ND1 ? A HIC 1 ? A HIC 1 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 O ? F HOH . ? A HOH 403 ? 1_555 85.8 ? 6 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 O ? F HOH . ? A HOH 403 ? 1_555 94.2 ? 7 N ? A HIC 1 ? A HIC 1 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 O ? F HOH . ? A HOH 454 ? 1_555 159.0 ? 8 ND1 ? A HIC 1 ? A HIC 1 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 O ? F HOH . ? A HOH 454 ? 1_555 84.4 ? 9 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 O ? F HOH . ? A HOH 454 ? 1_555 88.6 ? 10 O ? F HOH . ? A HOH 403 ? 1_555 CU ? B CU . ? A CU 301 ? 1_555 O ? F HOH . ? A HOH 454 ? 1_555 108.4 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 125 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 125 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 126 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 126 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 11.24 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 12 ? GLY A 15 ? LYS A 12 GLY A 15 AA1 2 VAL A 4 ? ILE A 9 ? VAL A 4 ILE A 9 AA1 3 THR A 74 ? TRP A 79 ? THR A 74 TRP A 79 AA1 4 SER A 140 ? THR A 144 ? SER A 140 THR A 144 AA2 1 ALA A 67 ? VAL A 69 ? ALA A 67 VAL A 69 AA2 2 GLN A 173 ? VAL A 183 ? GLN A 173 VAL A 183 AA2 3 GLY A 152 ? ALA A 162 ? GLY A 152 ALA A 162 AA2 4 VAL A 90 ? PRO A 96 ? VAL A 90 PRO A 96 AA2 5 GLU A 110 ? SER A 117 ? GLU A 110 SER A 117 AA2 6 THR A 194 ? LEU A 195 ? THR A 194 LEU A 195 AA3 1 LEU A 119 ? ASN A 121 ? LEU A 119 ASN A 121 AA3 2 ILE A 128 ? TRP A 129 ? ILE A 128 TRP A 129 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 14 ? O TYR A 14 N ILE A 7 ? N ILE A 7 AA1 2 3 N ASN A 6 ? N ASN A 6 O GLN A 78 ? O GLN A 78 AA1 3 4 N VAL A 75 ? N VAL A 75 O VAL A 143 ? O VAL A 143 AA2 1 2 N VAL A 69 ? N VAL A 69 O GLN A 182 ? O GLN A 182 AA2 2 3 O LEU A 181 ? O LEU A 181 N TYR A 154 ? N TYR A 154 AA2 3 4 O ARG A 157 ? O ARG A 157 N TYR A 93 ? N TYR A 93 AA2 4 5 N LEU A 94 ? N LEU A 94 O PHE A 112 ? O PHE A 112 AA2 5 6 N PHE A 111 ? N PHE A 111 O THR A 194 ? O THR A 194 AA3 1 2 N ASN A 121 ? N ASN A 121 O ILE A 128 ? O ILE A 128 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASN 138 ? ? O A HOH 401 ? ? 1.80 2 1 O A HOH 460 ? ? O A HOH 597 ? ? 1.86 3 1 O A ASN 27 ? ? O A HOH 402 ? ? 1.93 4 1 O2S A EPE 304 ? ? O A HOH 403 ? ? 1.99 5 1 O A HOH 405 ? ? O A HOH 488 ? ? 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 10 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 10 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 10 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 122.65 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation 12.25 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 21 ? ? -134.19 -56.50 2 1 SER A 26 ? ? 63.16 -13.74 3 1 ASN A 27 ? ? -118.84 68.93 4 1 HIS A 57 ? ? 90.62 173.72 5 1 ASN A 139 ? ? 70.57 38.03 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 26 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASN _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 27 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 145.33 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id HIC _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id HIC _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id HIS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_entry_details.entry_id 7PZ5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 675 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.28 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 228 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 228 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal AKR CA C N N 1 AKR CB C N N 2 AKR C C N N 3 AKR O O N N 4 AKR OXT O N N 5 AKR HA1 H N N 6 AKR HB2 H N N 7 AKR HB3 H N N 8 AKR HXT H N N 9 ALA N N N N 10 ALA CA C N S 11 ALA C C N N 12 ALA O O N N 13 ALA CB C N N 14 ALA OXT O N N 15 ALA H H N N 16 ALA H2 H N N 17 ALA HA H N N 18 ALA HB1 H N N 19 ALA HB2 H N N 20 ALA HB3 H N N 21 ALA HXT H N N 22 ARG N N N N 23 ARG CA C N S 24 ARG C C N N 25 ARG O O N N 26 ARG CB C N N 27 ARG CG C N N 28 ARG CD C N N 29 ARG NE N N N 30 ARG CZ C N N 31 ARG NH1 N N N 32 ARG NH2 N N N 33 ARG OXT O N N 34 ARG H H N N 35 ARG H2 H N N 36 ARG HA H N N 37 ARG HB2 H N N 38 ARG HB3 H N N 39 ARG HG2 H N N 40 ARG HG3 H N N 41 ARG HD2 H N N 42 ARG HD3 H N N 43 ARG HE H N N 44 ARG HH11 H N N 45 ARG HH12 H N N 46 ARG HH21 H N N 47 ARG HH22 H N N 48 ARG HXT H N N 49 ASN N N N N 50 ASN CA C N S 51 ASN C C N N 52 ASN O O N N 53 ASN CB C N N 54 ASN CG C N N 55 ASN OD1 O N N 56 ASN ND2 N N N 57 ASN OXT O N N 58 ASN H H N N 59 ASN H2 H N N 60 ASN HA H N N 61 ASN HB2 H N N 62 ASN HB3 H N N 63 ASN HD21 H N N 64 ASN HD22 H N N 65 ASN HXT H N N 66 ASP N N N N 67 ASP CA C N S 68 ASP C C N N 69 ASP O O N N 70 ASP CB C N N 71 ASP CG C N N 72 ASP OD1 O N N 73 ASP OD2 O N N 74 ASP OXT O N N 75 ASP H H N N 76 ASP H2 H N N 77 ASP HA H N N 78 ASP HB2 H N N 79 ASP HB3 H N N 80 ASP HD2 H N N 81 ASP HXT H N N 82 CU CU CU N N 83 CYS N N N N 84 CYS CA C N R 85 CYS C C N N 86 CYS O O N N 87 CYS CB C N N 88 CYS SG S N N 89 CYS OXT O N N 90 CYS H H N N 91 CYS H2 H N N 92 CYS HA H N N 93 CYS HB2 H N N 94 CYS HB3 H N N 95 CYS HG H N N 96 CYS HXT H N N 97 EPE N1 N N N 98 EPE C2 C N N 99 EPE C3 C N N 100 EPE N4 N N N 101 EPE C5 C N N 102 EPE C6 C N N 103 EPE C7 C N N 104 EPE C8 C N N 105 EPE O8 O N N 106 EPE C9 C N N 107 EPE C10 C N N 108 EPE S S N N 109 EPE O1S O N N 110 EPE O2S O N N 111 EPE O3S O N N 112 EPE H21 H N N 113 EPE H22 H N N 114 EPE H31 H N N 115 EPE H32 H N N 116 EPE H51 H N N 117 EPE H52 H N N 118 EPE H61 H N N 119 EPE H62 H N N 120 EPE H71 H N N 121 EPE H72 H N N 122 EPE H81 H N N 123 EPE H82 H N N 124 EPE HO8 H N N 125 EPE H91 H N N 126 EPE H92 H N N 127 EPE H101 H N N 128 EPE H102 H N N 129 EPE HOS3 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIC N N N N 180 HIC CA C N S 181 HIC C C N N 182 HIC O O N N 183 HIC CB C N N 184 HIC CG C Y N 185 HIC ND1 N Y N 186 HIC CD2 C Y N 187 HIC CE1 C Y N 188 HIC NE2 N Y N 189 HIC CZ C N N 190 HIC OXT O N N 191 HIC H H N N 192 HIC H2 H N N 193 HIC HA H N N 194 HIC HB2 H N N 195 HIC HB3 H N N 196 HIC HD2 H N N 197 HIC HE1 H N N 198 HIC HZ1 H N N 199 HIC HZ2 H N N 200 HIC HZ3 H N N 201 HIC HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 HOH O O N N 224 HOH H1 H N N 225 HOH H2 H N N 226 ILE N N N N 227 ILE CA C N S 228 ILE C C N N 229 ILE O O N N 230 ILE CB C N S 231 ILE CG1 C N N 232 ILE CG2 C N N 233 ILE CD1 C N N 234 ILE OXT O N N 235 ILE H H N N 236 ILE H2 H N N 237 ILE HA H N N 238 ILE HB H N N 239 ILE HG12 H N N 240 ILE HG13 H N N 241 ILE HG21 H N N 242 ILE HG22 H N N 243 ILE HG23 H N N 244 ILE HD11 H N N 245 ILE HD12 H N N 246 ILE HD13 H N N 247 ILE HXT H N N 248 LEU N N N N 249 LEU CA C N S 250 LEU C C N N 251 LEU O O N N 252 LEU CB C N N 253 LEU CG C N N 254 LEU CD1 C N N 255 LEU CD2 C N N 256 LEU OXT O N N 257 LEU H H N N 258 LEU H2 H N N 259 LEU HA H N N 260 LEU HB2 H N N 261 LEU HB3 H N N 262 LEU HG H N N 263 LEU HD11 H N N 264 LEU HD12 H N N 265 LEU HD13 H N N 266 LEU HD21 H N N 267 LEU HD22 H N N 268 LEU HD23 H N N 269 LEU HXT H N N 270 LYS N N N N 271 LYS CA C N S 272 LYS C C N N 273 LYS O O N N 274 LYS CB C N N 275 LYS CG C N N 276 LYS CD C N N 277 LYS CE C N N 278 LYS NZ N N N 279 LYS OXT O N N 280 LYS H H N N 281 LYS H2 H N N 282 LYS HA H N N 283 LYS HB2 H N N 284 LYS HB3 H N N 285 LYS HG2 H N N 286 LYS HG3 H N N 287 LYS HD2 H N N 288 LYS HD3 H N N 289 LYS HE2 H N N 290 LYS HE3 H N N 291 LYS HZ1 H N N 292 LYS HZ2 H N N 293 LYS HZ3 H N N 294 LYS HXT H N N 295 MET N N N N 296 MET CA C N S 297 MET C C N N 298 MET O O N N 299 MET CB C N N 300 MET CG C N N 301 MET SD S N N 302 MET CE C N N 303 MET OXT O N N 304 MET H H N N 305 MET H2 H N N 306 MET HA H N N 307 MET HB2 H N N 308 MET HB3 H N N 309 MET HG2 H N N 310 MET HG3 H N N 311 MET HE1 H N N 312 MET HE2 H N N 313 MET HE3 H N N 314 MET HXT H N N 315 NAG C1 C N R 316 NAG C2 C N R 317 NAG C3 C N R 318 NAG C4 C N S 319 NAG C5 C N R 320 NAG C6 C N N 321 NAG C7 C N N 322 NAG C8 C N N 323 NAG N2 N N N 324 NAG O1 O N N 325 NAG O3 O N N 326 NAG O4 O N N 327 NAG O5 O N N 328 NAG O6 O N N 329 NAG O7 O N N 330 NAG H1 H N N 331 NAG H2 H N N 332 NAG H3 H N N 333 NAG H4 H N N 334 NAG H5 H N N 335 NAG H61 H N N 336 NAG H62 H N N 337 NAG H81 H N N 338 NAG H82 H N N 339 NAG H83 H N N 340 NAG HN2 H N N 341 NAG HO1 H N N 342 NAG HO3 H N N 343 NAG HO4 H N N 344 NAG HO6 H N N 345 PHE N N N N 346 PHE CA C N S 347 PHE C C N N 348 PHE O O N N 349 PHE CB C N N 350 PHE CG C Y N 351 PHE CD1 C Y N 352 PHE CD2 C Y N 353 PHE CE1 C Y N 354 PHE CE2 C Y N 355 PHE CZ C Y N 356 PHE OXT O N N 357 PHE H H N N 358 PHE H2 H N N 359 PHE HA H N N 360 PHE HB2 H N N 361 PHE HB3 H N N 362 PHE HD1 H N N 363 PHE HD2 H N N 364 PHE HE1 H N N 365 PHE HE2 H N N 366 PHE HZ H N N 367 PHE HXT H N N 368 PRO N N N N 369 PRO CA C N S 370 PRO C C N N 371 PRO O O N N 372 PRO CB C N N 373 PRO CG C N N 374 PRO CD C N N 375 PRO OXT O N N 376 PRO H H N N 377 PRO HA H N N 378 PRO HB2 H N N 379 PRO HB3 H N N 380 PRO HG2 H N N 381 PRO HG3 H N N 382 PRO HD2 H N N 383 PRO HD3 H N N 384 PRO HXT H N N 385 SER N N N N 386 SER CA C N S 387 SER C C N N 388 SER O O N N 389 SER CB C N N 390 SER OG O N N 391 SER OXT O N N 392 SER H H N N 393 SER H2 H N N 394 SER HA H N N 395 SER HB2 H N N 396 SER HB3 H N N 397 SER HG H N N 398 SER HXT H N N 399 THR N N N N 400 THR CA C N S 401 THR C C N N 402 THR O O N N 403 THR CB C N R 404 THR OG1 O N N 405 THR CG2 C N N 406 THR OXT O N N 407 THR H H N N 408 THR H2 H N N 409 THR HA H N N 410 THR HB H N N 411 THR HG1 H N N 412 THR HG21 H N N 413 THR HG22 H N N 414 THR HG23 H N N 415 THR HXT H N N 416 TRP N N N N 417 TRP CA C N S 418 TRP C C N N 419 TRP O O N N 420 TRP CB C N N 421 TRP CG C Y N 422 TRP CD1 C Y N 423 TRP CD2 C Y N 424 TRP NE1 N Y N 425 TRP CE2 C Y N 426 TRP CE3 C Y N 427 TRP CZ2 C Y N 428 TRP CZ3 C Y N 429 TRP CH2 C Y N 430 TRP OXT O N N 431 TRP H H N N 432 TRP H2 H N N 433 TRP HA H N N 434 TRP HB2 H N N 435 TRP HB3 H N N 436 TRP HD1 H N N 437 TRP HE1 H N N 438 TRP HE3 H N N 439 TRP HZ2 H N N 440 TRP HZ3 H N N 441 TRP HH2 H N N 442 TRP HXT H N N 443 TYR N N N N 444 TYR CA C N S 445 TYR C C N N 446 TYR O O N N 447 TYR CB C N N 448 TYR CG C Y N 449 TYR CD1 C Y N 450 TYR CD2 C Y N 451 TYR CE1 C Y N 452 TYR CE2 C Y N 453 TYR CZ C Y N 454 TYR OH O N N 455 TYR OXT O N N 456 TYR H H N N 457 TYR H2 H N N 458 TYR HA H N N 459 TYR HB2 H N N 460 TYR HB3 H N N 461 TYR HD1 H N N 462 TYR HD2 H N N 463 TYR HE1 H N N 464 TYR HE2 H N N 465 TYR HH H N N 466 TYR HXT H N N 467 VAL N N N N 468 VAL CA C N S 469 VAL C C N N 470 VAL O O N N 471 VAL CB C N N 472 VAL CG1 C N N 473 VAL CG2 C N N 474 VAL OXT O N N 475 VAL H H N N 476 VAL H2 H N N 477 VAL HA H N N 478 VAL HB H N N 479 VAL HG11 H N N 480 VAL HG12 H N N 481 VAL HG13 H N N 482 VAL HG21 H N N 483 VAL HG22 H N N 484 VAL HG23 H N N 485 VAL HXT H N N 486 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal AKR CA CB doub N N 1 AKR CA C sing N N 2 AKR CA HA1 sing N N 3 AKR CB HB2 sing N N 4 AKR CB HB3 sing N N 5 AKR C O doub N N 6 AKR C OXT sing N N 7 AKR OXT HXT sing N N 8 ALA N CA sing N N 9 ALA N H sing N N 10 ALA N H2 sing N N 11 ALA CA C sing N N 12 ALA CA CB sing N N 13 ALA CA HA sing N N 14 ALA C O doub N N 15 ALA C OXT sing N N 16 ALA CB HB1 sing N N 17 ALA CB HB2 sing N N 18 ALA CB HB3 sing N N 19 ALA OXT HXT sing N N 20 ARG N CA sing N N 21 ARG N H sing N N 22 ARG N H2 sing N N 23 ARG CA C sing N N 24 ARG CA CB sing N N 25 ARG CA HA sing N N 26 ARG C O doub N N 27 ARG C OXT sing N N 28 ARG CB CG sing N N 29 ARG CB HB2 sing N N 30 ARG CB HB3 sing N N 31 ARG CG CD sing N N 32 ARG CG HG2 sing N N 33 ARG CG HG3 sing N N 34 ARG CD NE sing N N 35 ARG CD HD2 sing N N 36 ARG CD HD3 sing N N 37 ARG NE CZ sing N N 38 ARG NE HE sing N N 39 ARG CZ NH1 sing N N 40 ARG CZ NH2 doub N N 41 ARG NH1 HH11 sing N N 42 ARG NH1 HH12 sing N N 43 ARG NH2 HH21 sing N N 44 ARG NH2 HH22 sing N N 45 ARG OXT HXT sing N N 46 ASN N CA sing N N 47 ASN N H sing N N 48 ASN N H2 sing N N 49 ASN CA C sing N N 50 ASN CA CB sing N N 51 ASN CA HA sing N N 52 ASN C O doub N N 53 ASN C OXT sing N N 54 ASN CB CG sing N N 55 ASN CB HB2 sing N N 56 ASN CB HB3 sing N N 57 ASN CG OD1 doub N N 58 ASN CG ND2 sing N N 59 ASN ND2 HD21 sing N N 60 ASN ND2 HD22 sing N N 61 ASN OXT HXT sing N N 62 ASP N CA sing N N 63 ASP N H sing N N 64 ASP N H2 sing N N 65 ASP CA C sing N N 66 ASP CA CB sing N N 67 ASP CA HA sing N N 68 ASP C O doub N N 69 ASP C OXT sing N N 70 ASP CB CG sing N N 71 ASP CB HB2 sing N N 72 ASP CB HB3 sing N N 73 ASP CG OD1 doub N N 74 ASP CG OD2 sing N N 75 ASP OD2 HD2 sing N N 76 ASP OXT HXT sing N N 77 CYS N CA sing N N 78 CYS N H sing N N 79 CYS N H2 sing N N 80 CYS CA C sing N N 81 CYS CA CB sing N N 82 CYS CA HA sing N N 83 CYS C O doub N N 84 CYS C OXT sing N N 85 CYS CB SG sing N N 86 CYS CB HB2 sing N N 87 CYS CB HB3 sing N N 88 CYS SG HG sing N N 89 CYS OXT HXT sing N N 90 EPE N1 C2 sing N N 91 EPE N1 C6 sing N N 92 EPE N1 C9 sing N N 93 EPE C2 C3 sing N N 94 EPE C2 H21 sing N N 95 EPE C2 H22 sing N N 96 EPE C3 N4 sing N N 97 EPE C3 H31 sing N N 98 EPE C3 H32 sing N N 99 EPE N4 C5 sing N N 100 EPE N4 C7 sing N N 101 EPE C5 C6 sing N N 102 EPE C5 H51 sing N N 103 EPE C5 H52 sing N N 104 EPE C6 H61 sing N N 105 EPE C6 H62 sing N N 106 EPE C7 C8 sing N N 107 EPE C7 H71 sing N N 108 EPE C7 H72 sing N N 109 EPE C8 O8 sing N N 110 EPE C8 H81 sing N N 111 EPE C8 H82 sing N N 112 EPE O8 HO8 sing N N 113 EPE C9 C10 sing N N 114 EPE C9 H91 sing N N 115 EPE C9 H92 sing N N 116 EPE C10 S sing N N 117 EPE C10 H101 sing N N 118 EPE C10 H102 sing N N 119 EPE S O1S doub N N 120 EPE S O2S doub N N 121 EPE S O3S sing N N 122 EPE O3S HOS3 sing N N 123 GLN N CA sing N N 124 GLN N H sing N N 125 GLN N H2 sing N N 126 GLN CA C sing N N 127 GLN CA CB sing N N 128 GLN CA HA sing N N 129 GLN C O doub N N 130 GLN C OXT sing N N 131 GLN CB CG sing N N 132 GLN CB HB2 sing N N 133 GLN CB HB3 sing N N 134 GLN CG CD sing N N 135 GLN CG HG2 sing N N 136 GLN CG HG3 sing N N 137 GLN CD OE1 doub N N 138 GLN CD NE2 sing N N 139 GLN NE2 HE21 sing N N 140 GLN NE2 HE22 sing N N 141 GLN OXT HXT sing N N 142 GLU N CA sing N N 143 GLU N H sing N N 144 GLU N H2 sing N N 145 GLU CA C sing N N 146 GLU CA CB sing N N 147 GLU CA HA sing N N 148 GLU C O doub N N 149 GLU C OXT sing N N 150 GLU CB CG sing N N 151 GLU CB HB2 sing N N 152 GLU CB HB3 sing N N 153 GLU CG CD sing N N 154 GLU CG HG2 sing N N 155 GLU CG HG3 sing N N 156 GLU CD OE1 doub N N 157 GLU CD OE2 sing N N 158 GLU OE2 HE2 sing N N 159 GLU OXT HXT sing N N 160 GLY N CA sing N N 161 GLY N H sing N N 162 GLY N H2 sing N N 163 GLY CA C sing N N 164 GLY CA HA2 sing N N 165 GLY CA HA3 sing N N 166 GLY C O doub N N 167 GLY C OXT sing N N 168 GLY OXT HXT sing N N 169 HIC N CA sing N N 170 HIC N H sing N N 171 HIC N H2 sing N N 172 HIC CA C sing N N 173 HIC CA CB sing N N 174 HIC CA HA sing N N 175 HIC C O doub N N 176 HIC C OXT sing N N 177 HIC CB CG sing N N 178 HIC CB HB2 sing N N 179 HIC CB HB3 sing N N 180 HIC CG ND1 sing Y N 181 HIC CG CD2 doub Y N 182 HIC ND1 CE1 doub Y N 183 HIC CD2 NE2 sing Y N 184 HIC CD2 HD2 sing N N 185 HIC CE1 NE2 sing Y N 186 HIC CE1 HE1 sing N N 187 HIC NE2 CZ sing N N 188 HIC CZ HZ1 sing N N 189 HIC CZ HZ2 sing N N 190 HIC CZ HZ3 sing N N 191 HIC OXT HXT sing N N 192 HIS N CA sing N N 193 HIS N H sing N N 194 HIS N H2 sing N N 195 HIS CA C sing N N 196 HIS CA CB sing N N 197 HIS CA HA sing N N 198 HIS C O doub N N 199 HIS C OXT sing N N 200 HIS CB CG sing N N 201 HIS CB HB2 sing N N 202 HIS CB HB3 sing N N 203 HIS CG ND1 sing Y N 204 HIS CG CD2 doub Y N 205 HIS ND1 CE1 doub Y N 206 HIS ND1 HD1 sing N N 207 HIS CD2 NE2 sing Y N 208 HIS CD2 HD2 sing N N 209 HIS CE1 NE2 sing Y N 210 HIS CE1 HE1 sing N N 211 HIS NE2 HE2 sing N N 212 HIS OXT HXT sing N N 213 HOH O H1 sing N N 214 HOH O H2 sing N N 215 ILE N CA sing N N 216 ILE N H sing N N 217 ILE N H2 sing N N 218 ILE CA C sing N N 219 ILE CA CB sing N N 220 ILE CA HA sing N N 221 ILE C O doub N N 222 ILE C OXT sing N N 223 ILE CB CG1 sing N N 224 ILE CB CG2 sing N N 225 ILE CB HB sing N N 226 ILE CG1 CD1 sing N N 227 ILE CG1 HG12 sing N N 228 ILE CG1 HG13 sing N N 229 ILE CG2 HG21 sing N N 230 ILE CG2 HG22 sing N N 231 ILE CG2 HG23 sing N N 232 ILE CD1 HD11 sing N N 233 ILE CD1 HD12 sing N N 234 ILE CD1 HD13 sing N N 235 ILE OXT HXT sing N N 236 LEU N CA sing N N 237 LEU N H sing N N 238 LEU N H2 sing N N 239 LEU CA C sing N N 240 LEU CA CB sing N N 241 LEU CA HA sing N N 242 LEU C O doub N N 243 LEU C OXT sing N N 244 LEU CB CG sing N N 245 LEU CB HB2 sing N N 246 LEU CB HB3 sing N N 247 LEU CG CD1 sing N N 248 LEU CG CD2 sing N N 249 LEU CG HG sing N N 250 LEU CD1 HD11 sing N N 251 LEU CD1 HD12 sing N N 252 LEU CD1 HD13 sing N N 253 LEU CD2 HD21 sing N N 254 LEU CD2 HD22 sing N N 255 LEU CD2 HD23 sing N N 256 LEU OXT HXT sing N N 257 LYS N CA sing N N 258 LYS N H sing N N 259 LYS N H2 sing N N 260 LYS CA C sing N N 261 LYS CA CB sing N N 262 LYS CA HA sing N N 263 LYS C O doub N N 264 LYS C OXT sing N N 265 LYS CB CG sing N N 266 LYS CB HB2 sing N N 267 LYS CB HB3 sing N N 268 LYS CG CD sing N N 269 LYS CG HG2 sing N N 270 LYS CG HG3 sing N N 271 LYS CD CE sing N N 272 LYS CD HD2 sing N N 273 LYS CD HD3 sing N N 274 LYS CE NZ sing N N 275 LYS CE HE2 sing N N 276 LYS CE HE3 sing N N 277 LYS NZ HZ1 sing N N 278 LYS NZ HZ2 sing N N 279 LYS NZ HZ3 sing N N 280 LYS OXT HXT sing N N 281 MET N CA sing N N 282 MET N H sing N N 283 MET N H2 sing N N 284 MET CA C sing N N 285 MET CA CB sing N N 286 MET CA HA sing N N 287 MET C O doub N N 288 MET C OXT sing N N 289 MET CB CG sing N N 290 MET CB HB2 sing N N 291 MET CB HB3 sing N N 292 MET CG SD sing N N 293 MET CG HG2 sing N N 294 MET CG HG3 sing N N 295 MET SD CE sing N N 296 MET CE HE1 sing N N 297 MET CE HE2 sing N N 298 MET CE HE3 sing N N 299 MET OXT HXT sing N N 300 NAG C1 C2 sing N N 301 NAG C1 O1 sing N N 302 NAG C1 O5 sing N N 303 NAG C1 H1 sing N N 304 NAG C2 C3 sing N N 305 NAG C2 N2 sing N N 306 NAG C2 H2 sing N N 307 NAG C3 C4 sing N N 308 NAG C3 O3 sing N N 309 NAG C3 H3 sing N N 310 NAG C4 C5 sing N N 311 NAG C4 O4 sing N N 312 NAG C4 H4 sing N N 313 NAG C5 C6 sing N N 314 NAG C5 O5 sing N N 315 NAG C5 H5 sing N N 316 NAG C6 O6 sing N N 317 NAG C6 H61 sing N N 318 NAG C6 H62 sing N N 319 NAG C7 C8 sing N N 320 NAG C7 N2 sing N N 321 NAG C7 O7 doub N N 322 NAG C8 H81 sing N N 323 NAG C8 H82 sing N N 324 NAG C8 H83 sing N N 325 NAG N2 HN2 sing N N 326 NAG O1 HO1 sing N N 327 NAG O3 HO3 sing N N 328 NAG O4 HO4 sing N N 329 NAG O6 HO6 sing N N 330 PHE N CA sing N N 331 PHE N H sing N N 332 PHE N H2 sing N N 333 PHE CA C sing N N 334 PHE CA CB sing N N 335 PHE CA HA sing N N 336 PHE C O doub N N 337 PHE C OXT sing N N 338 PHE CB CG sing N N 339 PHE CB HB2 sing N N 340 PHE CB HB3 sing N N 341 PHE CG CD1 doub Y N 342 PHE CG CD2 sing Y N 343 PHE CD1 CE1 sing Y N 344 PHE CD1 HD1 sing N N 345 PHE CD2 CE2 doub Y N 346 PHE CD2 HD2 sing N N 347 PHE CE1 CZ doub Y N 348 PHE CE1 HE1 sing N N 349 PHE CE2 CZ sing Y N 350 PHE CE2 HE2 sing N N 351 PHE CZ HZ sing N N 352 PHE OXT HXT sing N N 353 PRO N CA sing N N 354 PRO N CD sing N N 355 PRO N H sing N N 356 PRO CA C sing N N 357 PRO CA CB sing N N 358 PRO CA HA sing N N 359 PRO C O doub N N 360 PRO C OXT sing N N 361 PRO CB CG sing N N 362 PRO CB HB2 sing N N 363 PRO CB HB3 sing N N 364 PRO CG CD sing N N 365 PRO CG HG2 sing N N 366 PRO CG HG3 sing N N 367 PRO CD HD2 sing N N 368 PRO CD HD3 sing N N 369 PRO OXT HXT sing N N 370 SER N CA sing N N 371 SER N H sing N N 372 SER N H2 sing N N 373 SER CA C sing N N 374 SER CA CB sing N N 375 SER CA HA sing N N 376 SER C O doub N N 377 SER C OXT sing N N 378 SER CB OG sing N N 379 SER CB HB2 sing N N 380 SER CB HB3 sing N N 381 SER OG HG sing N N 382 SER OXT HXT sing N N 383 THR N CA sing N N 384 THR N H sing N N 385 THR N H2 sing N N 386 THR CA C sing N N 387 THR CA CB sing N N 388 THR CA HA sing N N 389 THR C O doub N N 390 THR C OXT sing N N 391 THR CB OG1 sing N N 392 THR CB CG2 sing N N 393 THR CB HB sing N N 394 THR OG1 HG1 sing N N 395 THR CG2 HG21 sing N N 396 THR CG2 HG22 sing N N 397 THR CG2 HG23 sing N N 398 THR OXT HXT sing N N 399 TRP N CA sing N N 400 TRP N H sing N N 401 TRP N H2 sing N N 402 TRP CA C sing N N 403 TRP CA CB sing N N 404 TRP CA HA sing N N 405 TRP C O doub N N 406 TRP C OXT sing N N 407 TRP CB CG sing N N 408 TRP CB HB2 sing N N 409 TRP CB HB3 sing N N 410 TRP CG CD1 doub Y N 411 TRP CG CD2 sing Y N 412 TRP CD1 NE1 sing Y N 413 TRP CD1 HD1 sing N N 414 TRP CD2 CE2 doub Y N 415 TRP CD2 CE3 sing Y N 416 TRP NE1 CE2 sing Y N 417 TRP NE1 HE1 sing N N 418 TRP CE2 CZ2 sing Y N 419 TRP CE3 CZ3 doub Y N 420 TRP CE3 HE3 sing N N 421 TRP CZ2 CH2 doub Y N 422 TRP CZ2 HZ2 sing N N 423 TRP CZ3 CH2 sing Y N 424 TRP CZ3 HZ3 sing N N 425 TRP CH2 HH2 sing N N 426 TRP OXT HXT sing N N 427 TYR N CA sing N N 428 TYR N H sing N N 429 TYR N H2 sing N N 430 TYR CA C sing N N 431 TYR CA CB sing N N 432 TYR CA HA sing N N 433 TYR C O doub N N 434 TYR C OXT sing N N 435 TYR CB CG sing N N 436 TYR CB HB2 sing N N 437 TYR CB HB3 sing N N 438 TYR CG CD1 doub Y N 439 TYR CG CD2 sing Y N 440 TYR CD1 CE1 sing Y N 441 TYR CD1 HD1 sing N N 442 TYR CD2 CE2 doub Y N 443 TYR CD2 HD2 sing N N 444 TYR CE1 CZ doub Y N 445 TYR CE1 HE1 sing N N 446 TYR CE2 CZ sing Y N 447 TYR CE2 HE2 sing N N 448 TYR CZ OH sing N N 449 TYR OH HH sing N N 450 TYR OXT HXT sing N N 451 VAL N CA sing N N 452 VAL N H sing N N 453 VAL N H2 sing N N 454 VAL CA C sing N N 455 VAL CA CB sing N N 456 VAL CA HA sing N N 457 VAL C O doub N N 458 VAL C OXT sing N N 459 VAL CB CG1 sing N N 460 VAL CB CG2 sing N N 461 VAL CB HB sing N N 462 VAL CG1 HG11 sing N N 463 VAL CG1 HG12 sing N N 464 VAL CG1 HG13 sing N N 465 VAL CG2 HG21 sing N N 466 VAL CG2 HG22 sing N N 467 VAL CG2 HG23 sing N N 468 VAL OXT HXT sing N N 469 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Novo Nordisk Foundation' Denmark NNF17SA0027704 1 'Danish Council for Independent Research' Denmark 8021-00273B 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CU ? ? CU ? ? 'SUBJECT OF INVESTIGATION' ? 2 HIC ? ? HIC ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ZUD _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7PZ5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.029061 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007737 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011456 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027662 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CU N O S # loop_